You are on page 1of 116

27.04.

2011

cenovnik medicina
šifra naslov autori god cena(din)
alergologija
5253 *sp* Atlas of Allergic Diseases Lieberman 2002 5270.00
8546 Color Atlas of Allergic Diseases Martin Roecken 2003 1939.00
36522 Oxford Handbook of Clinical Immunology and Allergy Spickett, Gavin 2006 2875.00
(2/e)
47316 Quantitative Skin Testing for Allergy: IDT and MQT 2006 3235.00
55716 Atopijske bolesti %RJLü0LUMDQD 2000 1038.00
71813 Middleton's Allergy: Principles and Practice, N. Franklin Adkinson 2008 23790.00
73095 PATTERSONS ALLERGIC DISEASES 7E CB GRAMMER 2009 11346.00
111839 Pediatric Allergy,2ed Donald Y. M. Leung 2010 9881.00
117713 Alergijske i imunološke bolesti -/LSR]HQþLüLVXUDGQLFL 2010 5180.00
118503 Alergijske bolesti 9HVHOLQ.LNLQÿDQLQ 2010 1296.00
anatomija
5333 COLOUR ATLAS AND TEXTBOOK OF HUMAN Frotscher, Michael; Kahle, 2002 3775.00
ANATOMY (V. 3) : NERVOUS SYSTEM AND Werner; Frotscher, Mich
SENSORY ORGANS 5 Rev ed
6896 COLOR ATLAS AND TEXTBOOK OF HUMAN Platzer, Werner; Meyer, 2003 3775.00
ANATOMY (VOL 1) : LOCOMOTOR SYSTEM, 5 Ed David B.
14576 Nervous System: Anatomy and Physiology (Netter Frank H. Netter 2000 6460.00
Collection of Medical Illustrations, Volume 1, Part 1)
14585 Musculoskeletal System: Anatomy, Physiology, Frank H. Netter 1999 6460.00
Metabolic Disorders (Netter Collection of Medical
Illustrations, Volume 8, Part 1)
19613 35,58ý1,$1$7206.,$7/$6±VXVWDYRUJDQD]D Werner Platzer, ur. hrv. izd. 2003 2800.00
SRNUHWDQMHFMHORNXSQRSUHUDÿHQRL]GDQMH Ivan Vinter
19614 $1$7206.,$7/$68752%1,25*$1,3ULUXþQLN W. Kahle, H. Leonhardt, W. 1990 1960.00
]DVWXGHQWHLOLMHþQLNH Platzer
urednici hrv.
26081 MEMMLERS HUMAN BODY HEALTH DIS 1,IE COHEN 2005 1922.00
30566 Anatomy and Physiology Saladin, Ken 2006 5245.00
30567 Laboratory Atlas of Anatomy and Physiology Bertram, John W. 2005 3659.00
31307 Anatomija treninga snage Frederic Delavier 2007 2295.00
31526 ANATOMSKI ATLAS 2 Unutarnji organi Helga Fritsch i Wolfgang 2006 2800.00
Kuhnel
31527 $1$7206.,$7/$6äLYþDQLVXVWDYLRVMHWLOD Werner Kahledopunio 2006 2800.00
Michael Frotscher
34755 Atlas of Human Anatomy, International Edition, 4th Netter 2006 3373.00
Edition

35533 POCKET ATLAS OF SECTIONAL ANATOMY : Moeller, Torsten Bert; Reif, 2006 3775.00
COMPUTED TOMOGRAPHY AND MAGNETIC Emil
1 od 116
RESONANCE IMAGING (V. 1) : HEAD AND NECK 3
Rev ed
35535 Pocket Atlas of Sectional Anatomy: Computed Moeller, Torsten Bert; Reif, 2006 3775.00
Tomography and Magnetic Resonance Imaging Emil
Volume 2: Thorax, Abdomen, and Pelvis, 3 rev. ed

35536 POCKET ATLAS OF SECTIONAL ANATOMY : Moeller, Torsten Bert; Reif, 2006 3775.00
COMPUTED TOMOGRAPHY AND MAGNETIC Emil
RESONANCE IMAGING (V. 3) : COMPUTED
TOMOGRAPHY AND MAGNETIC RESONANCE
IMAGING
36058 CLINICAL ANATOMY BY SYSTEMS SNELL 2006 4331.00
36164 Ross and Wilson's Anatomy and Physiology Colouring Anne Waugh 2006 2317.00
and Workbook, 2nd edition
36701 Essentials of Anatomy and Physiology Trent D. Stephens, Rod R. 2006 3952.00
Seeley, Philip Tate
36734 Hole's Human Anatomy and Physiology David N. Shier, Jackie L 2006 5245.00
Butler, Ricki Lewis
36803 Anatomy and Physiology: With OLC Bind-in Card Rod R. Seeley, Trent D. 2005 4879.00
Stephens, Philip Tate
37961 Anatomija i fiziologija Predrag Keros, Branka 2006 1400.00
0DWNRYLü
40210 Netter's Head and Neck Anatomy for Dentistry Neil Norton 2006 3781.00
43472 Gray's Dissection Guide for Human Anatomy, 2nd David Morton 2006 4025.00
edition
47349 Atlas of Anatomy. Head and Neuroanatomy (Thieme Michael Schünke, Erik 2007 6475.00
Atlas of Anatomy) Schulte, Udo Schumacher
47403 BRS Gross Anatomy, 6 Ed Kyung Won Chung, Harold 2007 2440.00
M. Chung
47575 Elsevier's Integrated Anatomy and Embryology Bruce Bogart 2007 3049.00
47697 McMinn's Clinical Atlas of Human Anatomy, Abrahams 2007 3141.00
International Edition, 6th Edition

48406 Gray's Atlas of Anatomy Drake 2007 3961.00


49152 Atlas of Human Anatomy: With Netteranatomy.com, 4 Frank H. Netter 2006 6343.00
Ed
49873 7HPHOMLDQDWRPLMHþRYMHNDVWU 3255.00
49879 .OLQLþNDDQDWRPLMDDEGRPHQDVWU 2796.00
49939 Funkcijska anatomija lokomotornog sustava, 600 str. Predrag Keros, Marko 2007 5903.00
3HüLQD
50144 $WODVDQDWRPLMHþRYHND1HWWHUL]GDQMH Frank H. Netter 2007 7445.00
52054 Lippincott Williams & Wilkins Atlas of Anatomy 2008 4819.00
55092 $WODVGLVHNFLMHþRYHND 0LODQ0LOLVDYOMHYLüL 2011 2000.00
saradnici
55093 Human Anatomy 5th IE Gosling 2008 3415.00

55126 $QDWRPLMDþRYHNDJODYDLYUDW]DVWXGHQWHPHGLFLQH -RYDQRYLü6ODYROMXE9 2006 702.00


autor
55138 Netter's Concise Radiologic Anatomy, Edward Weber 2008 4513.00
55362 Color Atlas and Textbook of Human Anatomy: Color Helga Fritsch, Wolfgang 2007 3775.00
Atlas and Textbook of Human Anatomy 2. Internal Kuehnel
Organs: Bd 2 (Thieme Flexible Taschenbücher)
56131 Rapid Review Gross and Developmental Anatomy: N. Anthony Moore, William 2007 3171.00
With STUDENT CONSULT Online Access (Rapid A. Roy
Review)
59986 Surface Anatomy, John Lumley 2008 2683.00
2 od 116
59986 Surface Anatomy, John Lumley 2008 2683.00
60043 Clinical Tests for the Musculoskeletal System, 2 Ed Buckup 2008 4315.00
60304 Gray's Anatomy for Students 2nd IE: With STUDENT Drake 2009 3825.00
CONSULT Online Access

60307 Gray's Anatomy 40th: The Anatomical Basis of Clinical Strandring 2008 8334.00
Practice, Expert Consult - Online and Print-IE
61349 Surface Anatomy: The Anatomical Basis of Clinical John Lumley 2008 1502.00
Examination IE
63674 Sobotta Atlas of Human Anatomy Putz 2008 5464.00
65049 Case Files: Gross Anatomy IE edition(Lange Case Eugene C. Toy, Lawrence 2008 1707.00
Files) M. Ross, Leonard J. Cleary
65530 Atlas of Anatomy Anne M. Gilroy, Lawrence 2008 7555.00
M. Ross, Brian R. MacPher
65812 Atlas palpatorne anatomije Serge Tixa 2009 1980.00
65976 Opšta patološka anatomija 2SULü0LURVODYDXWRU 2008 1620.00
65977 Specijalna patološka anatomija 2SULü0LURVODYDXWRU 2008 2268.00
66632 $QDWRPLMDþRYHNDSULUXþQLN]DSUDNWLþQXQDVWDYX 9HUD'UDJDQLü1DGHåGD 2007 2484.00
-HOLþLü/-XELFDĈRUÿHYLü9LG
66633 $QDWRPLMDþRYHNDDEGRPHQLNDUOLFD 0LMDþ0LUMDQDDXWRU 2008 1080.00
66634 Anatomija grudnog koša : (thorax) %RJGDQRYLü'UDJRVODY 2008 567.00
autor
66635 Anatomija gornjeg ekstremiteta : [membrum superius] ,OLü$OHNVDQGDUDXWRU 2008 459.00
66636 $QDWRPLMDþRYHNDJODYDLYUDW]DVWXGHQWHPHGLFLQH -RYDQRYLü6ODYROMXE9 2008 783.00
autor
66637 Anatomija donjeg ekstremiteta : [membrum inferius] 0UYDOMHYLü'UDJDQDXWRU 2006 486.00
66638 Anatomija centralnog nervnog sistema $OHNVDQGDU,OLü0LOHQD 2007 648.00
%ODJRWLü6ORERGDQ
0DOREDELü
66639 0RåGDQLLNLþPHQLåLYFLLOXVWURYDQLNRPSHQGLMXP 9HUD'UDJDQLü5DGPLOD 2006 486.00
*XGRYLü=GHQND
.ULYRNXüD/DV
67757 $QDWRPLMDþRYHNDGHVNULSWLYQDLIXQNFLRQDOQD %RãNRYLü0DUMDQ6DXWRU 2005 972.00
67758 Anatomski atlas : za studente medicine i stomatologije Slavoljub 2007 1512.00
-RYDQRYLü0RPþLOR
'-RUGMHYLü1DGHåGD-H
68259 Lower Limb Anatomy, Palpation & Surface Markings, Derek Field 2008 3415.00
68261 Anatomy and Human Movement Study Cards, Nigel Palastanga 2008 2927.00
68916 Oral Anatomy, Histology & Embryology 4thed -IE Berkowitz 2009 3825.00

69013 CLINICALLY ORIENTED ANATOMY 6E - IE MOORE 2009 3904.00


69031 Imaging Atlas of Human Anatomy 4th Weir 2009 2048.00

70096 Funkcionalna i topografska neuroanatomija 0DULQNRYLü6ORERGDQ 1998 1620.00


autor
70784 Human Anatomy and Physiology:International Edition Elaine Marieb Katja Hoehn 2009 5489.00
8ed
70788 Essentials of Anatomy & Physiology:International Editio Frederic Martini Edwin 2009 4315.00
5ed Bartholomew
71061 Gray's Anatomy for Students Flash Cards, 2nd Edition Richard Drake 2009 2927.00

71304 Gray's Anatomy Review Loukas 2009 2322.00

71634 Mosby's Anatomy & Physiology Study and Review Mosby 2009 2317.00
Cards,
71823 Anatomy Trains, 2nd Edition Thomas W. Myers 2008 4025.00
3 od 116
71856 Netter's Anatomy Coloring Book John T. Hansen 2009 1585.00
with Student Consult Access

71859 Sobotta - Atlas of Human Anatomy English/Latin Single Reinhard Putz 2009 13420.00
Volume Edition, 14th Edition

71868 $QDWRPLMDþRYHNDJODYDLYUDW 8QNRYLü6WRMDQNDDXWRU 2003 1512.00


72386 Anatomy Flash Cards Anne M. Gilroy 2008 3235.00
72387 Color Atlas of Human Anatomy, Vol 1: Locomotor Werner Platzer 2008 3775.00
System, 6 Ed
72476 Atlas of Brain Function William W. Orrison 2008 7555.00
73239 GRANTS ATLAS OF ANATOMY 12E (INT ED) PB AGUR 2009 4392.00
74395 $QDWRPLMDþRYHNDRVWHRORJLMD]DVWXGHQWHPHGLFLQH 0LMDþ0LUMDQD%ODJRWLü 2008 675.00
0LOHQDĈRUÿHYLü/-XELFD
76117 Anatomija istezanja Arnold G. Nelson, Jouko 2009 985.00
Kokkonen
76897 Grantov anatomski atlas Agur, En M. R. - autor 2009 7020.00
77911 Netter's Neuroscience Flash Cards, David L. Felten 2004 2927.00
77913 Netter's Musculoskeletal Flash Cards, Jennifer Hart 2007 2927.00
77921 Netter's Concise Orthopaedic Anatomy, Jon C. Thompson 2009 4391.00
78785 Head and Neck Anatomy for Dental Medicine Michael Schünke, Erik 2010 6475.00
Schulte, Udo Schumacher
79370 Netter's Clinical Anatomy, John T. Hansen 2009 4391.00
80110 Clinical Anatomy 12e Ellis H 2010 4269.00
81982 HIGH-YIELD GROSS ANATOMY 4E PB DUDEK 2010 1829.00
81983 ESSENTIAL CLINICAL ANATOMY 4E INT ED PB MOORE 2010 3293.00
82487 Ross and Wilson Anatomy and Physiology in Health Waugh & Grant 2010 1707.00
and Illness International Edition, 11th Edition
82774 COLOR ATLAS OF ANATOMY 7E ( INT ED ) CB ROHEN 2010 5490.00
109327 Atlas of Human Anatomy 5th-IE Netter 2010 3319.00

109409 CLINICAL ANATOMY FOR YOUR POCKET SP GOULD 2008 1829.00


110096 Netter's Anatomy Flash Cards, John T. Hansen 2010 2927.00
110097 Atlas of Human Anatomy,with Student Consult Access , Frank H. Netter 2010 5899.00
5th Edition
111742 Rapid Review Gross and Developmental Anatomy,3ed N. Anthony Moore 2010 3171.00
112268 Anatomy at a Glance Sibani Mazumdar 2010 5977.00
112706 Color Atlas and Textbook of Human Anatomy: Color Werner Kahle, Michael 2010 4315.00
Atlas of Human Anatomy 3: Nervous System and Frotscher
Sensory Organs
112720 Cranial Nerves: Anatomy, Pathology, Imaging Devin K. Binder 2010 8635.00
112722 Schünke, Michael; Schulte, Erik; Schumacher, Udo : Michael Schünke, Erik 2010 6475.00
General Anatomy and Musculoskeletal System Schulte, Udo Schumacher
(Thieme Atlas of Anatomy)
114322 LWW ILLUS Q&A REV ANATOMY EMBRYOLOGY LAMBERT 2010 3410.00
PB
114777 Schaum's Outline of Human Anatomy and Physiology Van de Graaf 2009 1463.00
115060 The Netter Collection of Medical Illustrations: The William F. Young 2010 7807.00
Endocrine System,2
115227 Atlas anatomije - Gilroy Anne M. Gilroy, Brian R. 2010 5999.00
MacPherson, Lawrence M.
R
116018 Netter's Neuroscience Flash Cards, David L. Felten 2010 2927.00
4 od 116
116018 Netter's Neuroscience Flash Cards, David L. Felten 2010 2927.00
116739 $QDWRPLMDRNDVDSULORJRP]DDQDWRPLMXL]SRGUXþMD 3DMLü'XãDQDXWRU 2007 2700.00
neurooftalmologije L]GDYDþ
116962 Atlas anatomije - Gilroy (sa online pristupom) Anne M. Gilroy, Brian R. 2010 6999.00
MacPherson, Lawrence M.
R
117227 MANUAL OF HAND ANATOMY PB BOYER 2010 5490.00
117561 The Netter Collection of Medical Illustrations: David Kaminsky 2011 7807.00
Respiratory System,3
117562 The Netter Collection of Medical Illustrations: Roger P. Smith 2010 7807.00
Reproductive System,1
118462 $QDWRPLMDþRYMHND±)RWRJUDIVNLDWODVVXVWDYQHL Rohen, J. W. (ur.), Yokochi, 2009 8085.00
WRSRJUDIVNHDQDWRPLMHGRUDÿHQRLSURãLUHQRL]GDQMH C. i Lutjen-Drecoll,
118482 Anatomija preseka i arterije mozga 0LOLVDYOMHYLü0LODQDXWRU 2006 864.00
119183 Anatomija treninga snage, 5. izdanje Frederic Delavier 2011 0.00
anesteziologija
8742 Wylie & Churchill-Davidson's a Practice of Anesthesia Healy 2003 23790.00
7th Edition
12479 *sp* Handbook of Local Anesthesia, 5th edition Stanley Malamed 2004 4782.00
16911 Evidence Based Resource in Anaesthesia and Tramer, Martin (Geneva 2003 2745.00
Analgesia - IE University Hospital, Switze
18017 *sp* Peripheral Nerve Blocks: Principles and Practice Admir HadziciJerry Vloka 2004 4758.00
24929 The Physics, Clinical Measurement and Equipment of Patrick MageeiMark Tooley 2005 4370.00
Anaesthetic Practice
26064 Lee's Synopsis of Anaesthesia 13th ,IE Davies 2005 2595.00

36647 Clinical Anesthesiology, 4 Ed - ISE Edward Morgan, Maged S. 2005 2995.00


Mikhail,Michael Murray
37817 EXCERPTA ANAESTHESIOLOGICA Vjenceslav Kiseljak 1998 1120.00
REANIMATOLOGICA ET ALGOLOGICA
47308 Peripheral Regional Anesthesia, with DVD-ROM Gisela Meier, Johannes 2007 12955.00
Büttner
47387 HARVARD MANUAL OF OFFICE-BASED SHAPIRO 2007 2989.00
ANESTHESIA PROCEDURES
47408 Complications in Anesthesiology Nikolaus Gravenstein, 2007 10736.00
Emilio B. Lobato, Robert R.
48392 Decision Making in Anesthesiology, 4th edition Lois Bready 2007 10735.00
49477 Obstetric Anesthesia Pian-Smith/Leffler 2007 3660.00
49862 *sp* PAIN UPDATED : MECHANISMS AND EFFECTS Mathur, Rashmi 2006 2440.00
49941 Lokalna i provodna anestezija, 152 str. 2219.00
52025 Pain Management, 2nd edition Chris Main 2007 5611.00
53853 Intenzivna medicina 0DUNR-XNLü 2008 13300.00
53892 Anesthesiology David Longnecker, David 2008 20739.00
Brown, Mark Newman
55168 Stoelting's Anesthesia and Co-Existing Disease, Roberta Hines 2008 11833.00
60396 Meyler's Side Effects of Drugs Used in Anesthesia Jeffrey K. Aronson 2008 4879.00
(Meylers Side Effects) (Meylers Side Effects)
61070 Obstetric Anaesthesia Clyburn, Paul; Collis, 2008 5371.00
Rachel; Harries, Sarah; Dav
61701 5HJLRQDOQDDQHVWH]LMDLQMHQDSULPHQDXOHþHQMXERODL -RYDQRYLü-RYDQDXWRU 2007 1080.00
bolnih stanja
64308 Regionalna nervna blokada i infiltraciona terapija bola -DQNRYLü'DQLOR0DXWRU 2004 4860.00
64341 2VQRYLGHþMHDQHVWH]LRORJLMH 6LPLü'XãLFD0DXWRU 2005 756.00
66250 Miller's Anesthesia International Edition 2 Volume Set, Miller 2009 17490.00
7th Edition
5 od 116
66422 Fundamentals of Anaesthesia Smith et al 2009 9150.00
68935 CLINICAL ANESTHESIA 6E CB BARASH 2009 16226.00
71569 Pain Management Secrets, 3rd Edition Argoff & McCleane 2009 4025.00
71581 Obstetric, Thoracic and Cardiac Anesthesia, Robert R. Gaiser 2009 5855.00
71786 Anaesthesia and Intensive Care A-Z, 4th Edition-An Steven M. Yentis 2009 9027.00
Encyclopedia of Principles and Practice

72389 Spinal Injection Techniques Theodoros Theodoridis, 2009 15115.00


Jürgen Krämer
74171 Oxford Handbook of Anaesthesia Book and PDA Pack Allman, Keith; Wilson, Iain 2007 5969.00
74223 Oxford Handbook of Anaesthesia and Emergencies in Allman, Keith; McIndoe, 2009 5621.00
Anaesthesia Pack (2/e) Andrew; Wilson, Iain
74225 Emergencies in Anaesthesia (2/e) Allman, Keith; McIndoe, 2009 2745.00
Andrew; Wilson, Iain
74685 McGraw-Hill Specialty Board Review Pain Medicine Salahadin Abdi, Pradeep 2009 4147.00
Chopra, Howard Smith
74687 WESTMEAD MANUAL OF ANAESTHETICS Anthony Padley 2009 4147.00
74688 Anaesthesia in Laparoscopic Surgery Jayashree Sood, Anil 2009 11589.00
Kumar Jain
75483 Principles of Physiology for the Anaesthetist 2e Ian Power 2007 5489.00
79725 Johns Hopkins Anesthesiology Handbook, Eugenie S. Heitmiller 2009 4147.00
80965 The Clinical Anaesthesia Viva Book Barker et al 2009 4270.00
81094 Oxford Handbook of Anaesthesia for PDAs (2/e) Allman, Keith; Wilson, Iain 2007 3501.00
81207 Manual of Pediatric Anesthesia, Jerrold Lerman 2010 5855.00
81879 Anesthesia: a Comprehensive Review, Brian A. Hall 2010 6709.00
82064 Clinical Manual and Review of Transesophageal Mathew 2010 12199.00
Echocardiography
82396 Anesthesia Secrets,4 ed James Duke 2010 4025.00
82416 Pediatric Anesthesiology Review: Clinical Cases for Robert Holzman, Thomas J. 2010 8961.00
Self-Assessment Mancuso, Navil F. Sethna
109995 Cardiac Anaesthesia Barnard, Matthew; Martin, 2010 4996.00
Bruce
110098 Local and Regional Anaesthesia in the Emergency Mike Wells 2010 975.00
Department Made Easy International Edition,
111628 Atlas of Regional Anesthesia,4ed David L. Brown 2010 14152.00
111739 Essence of Anesthesia Practice, Lee A. Fleisher 2010 6099.00
111740 Examination Anaesthesia,2ed Christopher Thomas 2010 4757.00
112486 First Aid for the Anesthesiology Boards (First Aid Himani Bhatt, Karlyn J. 2010 6343.00
Specialty Boards) Powell, Dominique Aimee
Je
112659 Anaesthesiology (Churchill's Ready Reference) Michael (Monty) Mythen 2010 2439.00
113934 Ultrasound Guidance in Regional Anaesthesia (2/e) Marhofer, Peter 2010 4996.00
114224 POCKET ANESTHESIA PB URMAN 2009 3654.00
114225 REVIEW OF CLINICAL ANESTHESIA 5E PB CONNELLY 2009 4874.00
114489 Local and Regional Anaesthesia in the Emergency Mike Wells 2010 2683.00
Department Made Easy,
114831 Anesthesia Emergencies Ruskin, Keith; Rosenbaum, 2010 4064.00
Stanley
114832 Practical Procedures in Anaesthesia and Critical Care Jackson, Guy; Soni, Neil; 2010 4370.00
Whiten, Christopher J.
115014 Anestezija u traumi 3RSRSYLü1DGD 2010 9280.00
115352 %2/X]URFLLOLMHþHQMH 0-XNLü90DMHULü.RJOHU 2010 4200.00
6 od 116
M. Fingler
116051 Training In Anaesthesia Kiff, Kevin; Spoors, 2010 7497.00
Catherine
118357 Core Topics in Airway Management Calder/Pearce 2010 6710.00
biohemija
4108 *sp* Advances in Medicinal Chemistry, Volume 5 Allen B. Reitz 2000 3282.00
4771 *sp* Advances in Magnesium Research 1 Ronald Smetana MD 1997 5947.00
8594 *sp* The Cytokine FactsBook (2nd Edition) Fitzgerald; O'Neill; Gearing 2001 1450.00
8709 *sp* The Practice of Medicinal Chemistry, Second Camille G. Wermuth 2003 1450.00
Edition , 2003
10390 *sp* Clinical Chemistry: Laboratory Management and Kent Lewandrowski 2002 6374.00
Clinical Correlations
11451 Voet WIE Biochemistry, 3 Ed, with CD Donald Voet, Judith G. Voet 2004 4630.00
18851 $QDOLWLþNHWHKQLNHXNOLQLþNRPODERUDWRULMX Božidar Štraus 1997 2520.00
18881 Medicinsko biokemijske smjernice ,YDQDýHSHODN%RåLGDU 2004 3150.00
Štraus, S. Dodig
19572 MEDICINSKOBIOKEMIJSKA DIJAGNOSTIKA U (OL]DEHWD7RSLü'UDJDQ 2004 5600.00
./,1,ý.2-35$.6, 3ULPRUDF6WLSDQ-DQNRYLü
19595 STANICA: MOLEKULARNI PRISTUP G. M. Cooper i R. E. 2004 8400.00
Hausmann
19853 *sp* Biochemistry: The Chemical Reactions of Living David E. Metzler,Carol M. 2001 4636.00
Cells, Vol. 1 Metzler,David J. Sauke
21531 *sp* Annual Reports in Medicinal Chemistry, No. 39 Doherty 2005 6374.00
24202 *sp* ANTIBIOTICS IN LAB MEDICINE 5E LORIAN 2005 7015.00
24412 *sp* Informational Biopolymers of Genes and Gene Blake 2005 3903.00
Expression
24910 Thermodynamic Theory of Site-Specific Binding di Cera 2005 3049.00
Processes in Biological Macromolecules
30872 *sp* Reviews of Physiology, Biochemistry and Susan G. Amara 2005 8808.00
Pharmacology 154
33531 Tietz Clinical Guide to Laboratory Tests,4 Ed Alan Wu 2006 5855.00
35310 Diagnostic Immunohistochemistry, 2nd edition David Dabbs 2006 26718.00
36003 Free Radicals in Biology and Medicine (4/e) Halliwell, Barry; Gutteridge, 2007 5940.00
John
36464 *sp* Intl Stdt Ed-Intro to General, Organic & Bettelheim/Brown/Campbell 2006 1450.00
Biochemistry W/Cd
39738 HIGH-YIELD ACID-BASE 2E LONGENECKER 2006 1580.00
40990 Foye's Principles of Medicinal Chemistry, 6e LEMKE 2007 5856.00

42164 BIOHEMIJA 'DULQND.RUDüHYLü*RUGDQD 2006 2700.00


%MHODNRYLü9LGRVDYD%Ĉ
43807 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
BIOCHEMISTRY
43997 Clinical Chemistry Made Easy IE Hughes 2007 955.00
48947 Tietz's Applied Laboratory Medicine 2e Scott MG 2007 6527.00
49840 *sp* The Aptamer Handbook - Functional Klussmann S 2006 6100.00
Oligonucleotides and Their Applications
50572 Biochemistry and Genetics: PSSAR Wilson 1341.00
55660 Lehninger Principles of Biochemistry, 5 Ed Nelson D. 2008 6343.00
55759 The Origins of Genome Architecture Lynch M. 2007 4879.00
55786 Biokemija $OHNVDQGDU/XWNLü$OELQ 2008 3500.00
-XULü
55788 ./,1,ý.$.(0,-$,02/',-$*1267,.$ -DGUDQND6HUWLüLVXUDGQLFL 2008 4480.00
7 od 116
56318 Fundamental Laboratory Approaches for Biochemistry Ninfa AJ 2009 4025.00
and Biotechnology,
Second Edition
56547 0DUNVRYHRVQRYHPHGLFLQVNHELRKHPLMHNOLQLþNL Michael Lieberman, Allan D. 2008 2490.00
pristup Marks, Colleen Smith
56877 Chemistry of Fungi 2008 7686.00
60196 Biodiesel: A Realistic Fuel Alternative for Diesel Ayhan Demirbas 2008 9404.00
Engines
61348 Clinical Chemistry, International Edition, 6th Edition William Marshall 2008 2322.00
With STUDENT CONSULT Access
61532 The Practice of Medicinal Chemistry, Camille Georges Wermuth 2008 13420.00
61997 %LRKHPLMVNLPDUNHULGLMDJQRVWLNHXNOLQLþNRMSUDNVL 9XNXãLü=YRQLPLUDXWRU 2007 540.00
YRGLþNUHDWLYQHGLMDJQRVWLNHVDVWHSE\VWHSSURWRNRORP
62099 .OLQLþNL]QDþDMDQDOL]HXULQDDWODVVHGLPHQWDXULQD /DOLü1DWDãDDXWRU 2005 3564.00
63497 Biochemistry and Molecular Biology (4/e) Elliott, William H.; Elliott, 2009 3000.00
Daphne C.
65663 Introduction to General, Organic, and Biochemistry Hein M 2008 12932.00
Laboratory Manual 9e
66437 LANGE INSTANT ACCESS: ACID-BASE, FLUIDS & Reilly 2008 1702.00
ELECTROLYTES
69020 Medical Biochemistry,3 Ed John Baynes 2009 5611.00
69264 8UJHQWQLSRUHPHüDMLGLVEDODQVDYRGHLHOHNWUROLWD 9XNXãLü=YRQLPLUDXWRU 2009 540.00
YRGLþNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHSSURWRNRO
UHãDYDQMHGLMDJQRVWLþNLKGLOHPDSULPHQDUDFLRQDOQH
reanimacije
70690 Phytoremediation and Rhizoremediation: Theoretical Martina Mackova 2006 18138.00
Background (Focus on Biotechnology)
70817 Harper's Illustrated Biochemistry 28ed ISE MURRAY 2009 2708.00

70901 Biochemistry Primer for Exercise Science (Primers in Michael E. Houston 2006 3599.00
Exercise Science)
72416 Principles and Techniques of Biochemistry and Wilson/Walker 2010 4575.00
Molecular Biology
72510 HIGH-YIELD BIOCHEMISTRY 3E PB WILCOX 2009 1580.00
73271 Marks' Basic Medical Biochemistry,3/e, International LIEBERMAN 2009 4270.00
Student Edition

73477 LIPPIN ILLUS Q&A REVIEW BIOCHEMISTRY PB LIEBERMAN 2010 3288.00


73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) 2009 3044.00
Fifth Edition
74550 Principles of Biochemistry Voet, Donald 2007 5367.00
77127 Štrausova medicinska biokemija 'XEUDYNDýYRULãüHF,YDQD 2009 8820.00
ýHSHODN
78211 Schaum's Outline of Biochemistry, Third Edition Kuchel ; Easterbrook-Smith 2009 1463.00
(Schaum's Outline Series) ; Montague ; B; Slaytor
79009 Essential Stem Cell Methods, Robert Lanza 2009 5611.00
81098 Oxford Handbook of Clinical and Laboratory Provan, Drew 2010 3495.00
Investigation (3/e)
81986 RENAL ELECTROLYTE DISORDERS 7E PB SCHRIER 2010 6466.00
82782 CONCISE REVIEW CLIN LAB SCIENCE 2E PB HUBBARD 2009 4270.00
109305 %LRKHPLMVNLPDUNHULGLMDJQRVWLNHSULUXþQLNGLMDJQRVWLNH =YRQLPLU9XNXãLü 2010 486.00
109306 Diferencijalna dijagnostika urinarnog nalaza =YRQLPLU9XNXãLü 2010 378.00
109704 Lippincott's Illustrated Reviews: Biochemistry, 5e Harvey 2010 3044.00
111556 Mathematics for the Clinical Laboratory, Lorraine J. Doucette 2010 4269.00

8 od 116
111765 Rapid Review Biochemistry,3ed John W. Pelley 2010 3171.00
112138 Textbook of Biochemistry with Clinical Devlin TM 2010 5977.00
Correlations 7e (WSE)
112331 Deja Review Biochemistry, Second Edition Saad M. Manzoul 2010 1610.00
112530 Biochemistry and Genetics: Pretest Self-Assessment Golder N. Wilson 2010 2561.00
and Review, Fourth Edition (PreTest Basic Science)
112551 Laboratory Medicine: The Diagnosis of Disease in the Michael Laposata 2010 5245.00
Clinical Laboratory (Lange Basic Science)
113639 Biochemistry, Fourth Edition Voet D 2010 6099.00
114262 Biochemistry, Third Edition Pankaja Naik 2009 6343.00
114351 FLUIDS ELECTROLYTES MIE UK EDITION PB SCOTT 2010 2800.00
114593 Mosby's Diagnostic and Laboratory Test Reference, Kathleen Deska Pagana 2010 3903.00
114780 Schaum's Outline of General Organic and Biochemistry Odian 2009 1463.00
for Nursing and Allied Health
114837 Clinical Biochemistry Ahmed, Nessar 2010 3750.00
114845 Biochemistry (4/e) McKee, Trudy; McKee, 2009 4751.00
James R.
116013 Lecture Notes - Clinical Biochemistry 8e Beckett G 2010 3049.00
116270 Essential Biochemistry for Medicine Fry M 2010 2439.00
117712 Stanica, 5. izdanje G. M. Cooper i R. E. 2010 10920.00
Hausmann Gordan Lauc,
urednik
biomedicinsko inžinjerstvo
4996 *sp* Biomechanics: Principles and Applications Schneck Daniel J 2003 4087.00
15691 Applied Bioremediation and Phytoremediation (Soil Ajay Singh and Owen P. 2004 18138.00
Biology) Ward
18818 Fizika za studente u medicini I deo -DVPLQND%UQMDV.UDOMHYLü 2001 1750.00
31793 *sp* Bioengineering Fundamentals Ann Saterbak 2006 1450.00

37825 0HGLFLQVNRLQIURPDWLþNHPHWRGH Kern 2006 1400.00


53283 Biotechnology for Beginners Reinhard Renneberg 2007 2434.00
56801 Molecular Biology and Biotechnology Kreuzer H 2008 6588.00
66401 Biotechnology Smith 2009 2805.00
69049 Bioimpedance and Bioelectricity Basics, Sverre Grimnes 2008 9272.00
69592 MEDICINSKA INFORMATIKA Josipa Kern i Mladen 2009 3500.00
3HWURYHþNL
74184 Illustrated Dictionary of Biotechnology Arora 2009 4147.00
74515 Organic Electronics in Sensors and Biotechnology Ruth Shinar, Joseph Shinar 2009 13419.00
(McGraw-Hill Biophotonics)
76675 Molecular Biotechnology 4e - Principles and Glick BR 2010 10974.00
Applications of Recombinant
DNA
79009 Essential Stem Cell Methods, Robert Lanza 2009 5611.00
80801 Statistics in Human Genetics and Molecular Biology Reilly 2009 4757.00
(Chapman & Hall/CRC Texts in Statistical Science
Series)
112224 Information Retrieval: A Health and Biomedical William Hersh 2008 6231.00
Perspective
116064 Advanced Electroporation Techniques in Biology and Pakhomov 2010 10858.00
Medicine
dermatovenerologija
280 *sp* Strategies for Immunointerventions in Dermatology Burg, Dummer 1997 900.00
400 *sp* Occupational Skin Disease 3Ed Adams 1999 900.00
9 od 116
2741 *sp* Die Haut als Abwehrorgan Braun 400.00
2745 *sp* Wörterbuch der Kosmetik Fey 400.00
5253 *sp* Atlas of Allergic Diseases Lieberman 2002 5270.00
5671 *sp* Atlas of Human Hair: Microscopic Characteristics Fox; Ogle 1998 3233.00
18898 DEKUBITIS -DQNR3DQþHYLü 3500.00
30823 Thieme's Pocket Guide Dermatology Sterry,Paus,Burgdorf 2006 5395.00
37001 Women's Dermatology, An Issue of Dermatologic Kathy Schwarzenberger 2006 7563.00
Clinics
37622 0HGHQLFD1LNROLüLVDUDGQLFL'HUPDWRYHQHURORJLMD 0HGHQLFD1LNROLüL 2007 1566.00
saradnici
39710 *sp* SAUERS MANUAL SKIN DISEASE 9E CB HALL 2006 1500.00
39742 *sp* ATLAS HISTOPATHOLOGY OF SKIN 2E ELDER 2006 10523.00
47442 Clinical Guide: Skin and Wound Care (Clinical Guide to Cathy Thomas Hess 2007 2989.00
Wound Care (Hess/ Springhouse))
51236 Dermatology, 2nd Edition Jean Bolognia 2007 31842.00
2-Volume Set
53888 CURRENT DIAGNOSIS & TREATMENT OF KLAUSNER 2007 3355.00
SEXUALLY TRANSMITTED DISEASES
55165 Braun-Falco´s Dermatology,3 Ed Walter H.C. Burgdorf,Gerd 2009 25969.00
Plewig, Helmut Heinrich
57994 DERMATOVENEROLOGIJA -DVQD/LSR]HQþLü 2008 7000.00
59055 LEVERS HISTOPATHOLOGY OF THE SKIN 10E CB ELDER 2008 26718.00
60011 Dermatology: Fundamentals of Practice Robin Graham-Brown, 2008 5367.00
Johnny Bourke, Tim
Cunliffe
62016 Leg Ulcers 3rd Edition Negus et al 2005 12810.00
63677 Dermatopathology, Dirk Md Elston 2008 7929.00
65667 Fitzpatrick's Color Atlas and Synopsis of Clinical Klaus Wolff, Richard Allen 2009 7075.00
Dermatology: Sixth Edition (Fitzpatrick's Color Atlas & Johnson
Synopsis of Clinical Dermatology)
67423 Handbook of Cosmetic Science and Technology, Third 2009 20130.00
Edition
71582 Dermatological Signs of Internal Disease,4 Ed Jeffrey P. Callen 2009 12566.00
72562 Diagnostic Atlas of Melanocytic Pathology Phillip H. Mckee 2009 17202.00
Expert Consult: Online and Print

73015 Dermatopathology: The Basics Bruce R. Smoller, Kim M. 2009 5664.00


Hiatt
73314 COLOR ATLAS AND SYNOPSIS OF PEDIATRIC KANE 2009 4331.00
DERMATOLOGY, 2 ED -ISE

74465 Life-Threatening Dermatoses and Emergencies in 2009 9066.00


Dermatology
74468 Dermoscopy - An Atlas Scott W. Menzies, Kerry A. 2009 7075.00
Crotty, Christian Ingva
74469 Urticaria and Angioedema, Second Edition 2009 18300.00
74701 Dermatopathology, Third Edition Raymond L. Barnhill, A. Neil 2010 28669.00
Crowson, Cynthia M. M
74723 Atlas and Synopsis of Contact and Occupational Sanjay Ghosh 2009 8173.00
Dermatology
74724 Nail Atlas: A Clinical Approach K.J.P.S. Puri 2009 9149.00
76816 Infectious Diseases of the Skin Elston DM 2009 7320.00
76889 Cosmetic Dermatology: Products and Procedures, 1 Ed Draelos Z 2010 18178.00
77128 DERMATOLOŠKA ONKOLOGIJA -DVQD/LSR]HQþLü$LGD 2009 2520.00
10 od 116
3DãLüLVXUDGQLFL
80420 Dermatologija Gernot Rassner 2004 7020.00
81003 Paediatric Dermatology Lewis-Jones, Sue 2010 5621.00
81107 Oxford Handbook of Medical Dermatology Burge, Susan; Wallis, Dinny 2010 4120.00
81930 *OMLYLþQHLQIHNFLMHNRåHXGHþLMHPX]UDVWX .UVWLü1HERMãD-DXWRU 2008 983.00
82692 SAUERS MANUAL OF SKIN DISEASES 10E CB HALL 2010 6099.00
82721 3UHYHQFLMDGHWHNFLMDLOLMHþHQMHGHNXELWXVD +DQþHYLü-LVXU 2009 4116.00
110358 Step by Step Management of Burns Sujata Sarabahi, S.P. Bajaj 2009 3537.00
111774 Dermatology Secrets Plus,4ed James E. Fitzpatrick 2010 4513.00
112177 Clinical Dermatology 4e Weller R 2008 5484.00
112339 Dermoscopy: An Illustrated Self-Assessment Guide Robert Johr, Wilhelm Stolz 2010 9271.00
112342 Step by Step Chemical Peels Niti Khunger 2010 3171.00
112343 Pediatric Dermatology Arun Inamadar, S 2010 17201.00
Sacchidanand
113455 Dermatology in Clinical Practice Zohra Zaidi, S. W. Lanigan 2010 3396.00
113941 Genetic Skin Disorders () Sybert, Virginia 2010 13756.00
114248 VISUAL DX ESSEN PED DERMATOLOGY CB GOLDSMITH 2009 8052.00
114728 Acute Adult Dermatology - A Colour Handbook CREAMER 2010 3654.00
114733 PSORIASIS MENTER 2010 4880.00
115468 Dermatovenerologija sa propedevtikom : udžbenik za /DOHYLü9DVLü%RVLOMND0 2010 1674.00
studente medicine autor
116131 LIPPIN PRIMARY CARE DERMATOLOGY CB HSU 2010 6588.00
117694 Flaps and Grafts in Dermatologic Surgery, Thomas E. Rohrer 2009 14884.00
118476 Odabrana poglavlja iz pedijatrijske dermatologije Šitum, M., (ur.) 2010 2205.00
endokrinologija
382 *sp* Year Book of Endocrinology 1999 Bagdade 1999 400.00
14581 Endocrine System and Selected Metabolic Diseases Frank H. Netter i Peter H. 2000 7929.00
(Netter Collection of Medical Illustrations, Vol 4) Forsham
18904 'LMDEHWLþNRVWRSDOR -DQNR+DQþHYLü 2800.00
26610 BOLESTI HIPOFIZE Branka Vizner i suradnici 2005 3500.00
26628 Pathology and Genetics of Tumours of Endocrine Ronald A. Delellis,Ricardo 2004 8017.00
Organs (IARC/World Health Organization Classification V. Lloyd,Phillipp U. He
of Tumours)
47438 Greenspan's Basic & Clinical Endocrinology, 8 Ed ISE GARDNER 2007 3654.00
48403 Williams Textbook of Endocrinology, 11th Edition Henry M. Kronenberg 2007 15738.00
48920 Male Sexual & Reproductive Dysfunction Kandeel Fouad R 2007 35990.00
Pathophysiology and Treatm
50096 %2/(67,â7,71-$ý(.OLQLþNDWLUHRLGRORJLMD Miljenko Solter 2007 3360.00
55727 Tiroidna žlezda 7UERMHYLü%RåR 1998 779.00
55740 Neuroendokrinoimunologija 2000 649.00
59858 Oxford Handbook of Endocrinology and Diabetes (2/e) Wass, John; Turner, Helen 2009 2875.00
60395 Meyler's Side Effects of Endocrine and Metabolic Drugs Jeffrey K. Aronson 2008 4879.00
(Meylers Side Effects) (Meylers Side Effects)
61273 Basic Medical Endocrinology H. Maurice Goodman 2008 3050.00
62049 Hyperlipidaemia Third Edition Durrington, P.N. 2007 9150.00
66413 Pediatric Endocrinology and Inborn Errors of Kyriakie Sarafoglou, Georg 2009 6587.00
Metabolism F. Hoffmann, Karl S. Ro
66476 WASH MANL SUBSPEC CONS ENDOCRINOL 2E - WASHINGTON UNIV 2008 2867.00
ISE
66726 OSTEOPOROSIS GUIDE TO DIAG MANAGEMENT CAMACHO 2007 3111.00
PB

11 od 116
71858 Endocrine Secrets, 5th Edition Michael T. Mcdermott 2009 4025.00

72404 Atlas of Thyroid Surgery: Principles, Practice, and Ernst Gemsenjaeger 2008 11875.00
Clinical Cases
72406 The Thyroid and Reproduction (Merck European John Lazarus, Valdis 2009 1075.00
Thyroid Symposium Riga 2009, May 22-25) Pirags, Sigrid Butz

72407 The Thyroid and Autoimmunity(Merck European Wilmar M. Wiersinga, 2007 1075.00
Thyroid Symposium) Hemmo A. Drexhage,
Anthony P.
72433 Yen & Jaffe's Reproductive Endocrinology , 6th Edition Jerome F. Strauss 2009 18910.00
Expert Consult - Online and Print
72463 Lymphedema Management Joachim E. Zuther 2009 6475.00
72513 MANUAL ENDOCRIN & METABOLISM 4E PB LAVIN 2009 3532.00
72619 Oxford Handbook of Diabetes Nursing, 1 ed Avery, Lorraine; Beckwith, 2009 2375.00
Sue
72996 The Bethesda System for Reporting Thyroid Ali, Syed Z.; Cibas, Edmund 2009 3396.00
Cytopathology: Definitions, Criteria and Explanatory S.
Notes
74727 Clinical Endocrinology & Diabetes Mellitus (Two- Y Sachdev 2009 20739.00
Volume Set)
76743 McGraw-Hill Manual Endocrine Surgery Shane Y. Morita, Alan P. B. 2009 6343.00
Dackiw, Martha A. Zei
76747 Pediatric Practice Endocrinology Michael S. Kappy, David B. 2009 7319.00
Allen, Mitchell E. Ge
76882 Lecture Notes - Endocrinology and Diabetes Sam A 2009 2805.00
77125 DIJABETES U ŽENA -RVLSĈHOPLã0DULQD 2009 3920.00
,YDQLãHYLüäHOMNR0HWHONRL
77954 Pediatric Endocrinology, Mark A. Sperling 2008 9393.00
82073 Harrison's Endocrinology Jameson 2010 6343.00
82418 Thyroid Function Testing (Endocrine Updates) 2010 15870.00
110418 âWLWDVWDåOH]GDLWUXGQRüD 9RMYRGLü/-LOMDQD% 1999 1296.00
111567 Endocrinology, 2-Volume Set,6ed J. Larry Jameson 2010 31476.00
112679 Endocrine Physiology, Third Edition (Lange Physiology Patricia E. Molina 2009 4025.00
Series)
113391 Thyroid Cytopathology: 8 (Essentials in Cytopathology) Douglas P. Clark, William 2010 7563.00
C. Faquin
113436 Gestational Diabetes During and After Pregnancy 2010 8499.00
113438 Atlas of Thyroid Lesions 2010 15870.00
115060 The Netter Collection of Medical Illustrations: The William F. Young 2010 7807.00
Endocrine System,2
115475 Guide pratique du diabète André Grimaldi, Agnès 2009 6885.00
Hartemann-Heurtier, Marine
H
116027 ABC of Diabetes 6e Holt T 2010 3171.00
116028 A Practical Manual of Thyroid and Parathyroid Arora A 2010 7197.00
Disease
118478 'LMDEHWLþNRVWRSDOR±3ULUXþQLN +DQþHYLü-LVXU 2010 1764.00
epidemiologija i medic.statistika
18819 Epidemiologija Vladimir Babuš 1997 2380.00
18909 Epidemiologija zaraznih bolesti Darko Ropac 2003 4900.00
18911 3ULUXþQLN]DVMHPLQDUHLYHåEHL]HSLGHPLRORJLMH $ULMDQD9RUNR-RYLü 2002 1512.00
19586 EPIDEMIOLOŠKE METODE Babuš 2000 1750.00
19587 23û$(3,'(0,2/2*,-$ 'LQNR3XQWDULüL'DUNR 2004 1400.00
12 od 116
Ropac
47951 Basic Epidemiology 2 Rev ed R. Bonita; R. Beaglehole; T. 2006 2739.00
Kjellström
54741 Epidemiology , Leon Gordis 2008 4391.00
55790 MODERN EPIDEMIOLOGY 3E CB ROTHMAN 2008 6344.00
60037 Easy Interpretation of Biostatistics, Gail F. Dawson 2008 2561.00
76744 PDQ Epidemiology (Pdq Series) David L. Streiner, Geoffrey 2009 3171.00
R. Norman
113914 A Clinician's Guide to Statistics and Epidemiology in Ghaemi 2009 3415.00
Mental Health
115354 (3,'(0,2/2*,-$.521,ý1,+1(=$5$=1,+ $9RUNR-RYLü06WUQDG, 2010 3080.00
BOLESTI Rudan
115355 EPIDEMIOLOGIJA ZARAZNIH BOLESTI '5RSDF'3XQWDULüL 2010 2030.00
suradnici
116011 Obesity Epidemiology (2/e) Crawford, David; Jeffery, 2010 7503.00
Robert W.; Ball, Kylie;
farmacija
2748 *sp* Qualität pflanzlicher Arzneimittel Hanke 400.00
2759 *sp* Fremdstoffe in Lebensmitteln 400.00
2760 *sp* Lehrbuch der physikalischen Chemie in Eggert 400.00
elementarer Darstellung
2762 *sp* Heilpflanzen Sanfte Behandlung von Pahlow 400.00
Alltagsbeschwerden
2763 *sp* Apotheker in der pharmazeutischen Industrie Brauer 400.00
2771 *sp* Biotechnologie der Arzneistoffe Kreis 400.00
2774 *sp* Biogene Arzneistoffe Rimpler 400.00
2940 Essential of Pharmaceutical Chemistry Donald Cairns 2000 2556.00
3441 Medicines, Ethics and Practice: A guide for pharmacists 2002 1275.00
3443 Global Ingrediente and Formulation Guide 2002 2002 1465.00
English version
4064 *sp* Binding Constants:The Measurement of Molecular Kenneth A.Connors 1987 12926.00
Complex Stability
4105 *sp* Alkaloids: Chemical and Biological Perspectives, S. William Pelletier 1999 7466.00
Volume 14
4881 *sp* Art & Science of Nail Technology 4 Ed Milady 2004 900.00
5115 *sp* German Drug Law 1999 2614.00
5116 *sp* Genetic Engineering Law Hasskarl 2000 1485.00
5117 *sp* European Genetic Engineering Law Hasskarl 2002 4277.00
5118 *sp* EC Guide to Good Manufactoring Practice for Gert Auterhoff 2006 3704.00
Medicinal Products and Active Pharmaceutical
Ingredients
8359 *sp* Validation Fundamentals: How To, What To, When Gibson 1998 5673.00
To Validate
8362 *sp* Aseptic Pharmaceutical Manufacturing II: Groves 1995 7320.00
Applications for the 1990s
8373 *sp* Fluid Sterilization by Filtration: The Filter Integrity Johnston 1997 6039.00
Test and Other Filtration Topics, Second Edition
8375 *sp* Ocular Theraputics and Drug Delivery Reddy 1995 8540.00
9682 WHO Model Formulary, 1 edition Dinesh K Mehta 2002 2556.00
9683 *sp* Annual Register of Pharmaceutical Chemists 2003 RPSGB 2003 400.00
10279 *sp* Compilance Handbook for Pharmaceuticals, Carmen Medina 2003 10393.00
Medical Devices, and Biologics
10280 *sp* Drug Discovery Strategies and Methods Alexandros Makriyannis 2003 9327.00
13 od 116
10489 Chronotherapeutics Redfern 2003 9608.00
10494 Pharmacy Pre-registration Handbook 2nd edition Taylor 2002 3196.00
10495 Practical Exercises in Pharmacy Law and Ethics 2nd Gordon E. Appelbe, Joy 2002 2556.00
edition Wingfield, Lindsay M. Taylo
11889 Pharmaceutical Compounding and Dispensing Marriot/Wilson/Langley/Belc 2006 5118.00
her
16759 REMINGTON SCIENCE & PRAC 21E CB USIP 2005 12139.00
17506 Pocket Guide to Herbal Medicine Karin KraftiChristopher 2004 3775.00
Hobbs
18884 Farmakokinetika (VWHUD.XQHF9DMLü 2004 1750.00
19526 Register zdravil Republike Slovenije 2005 god. 2005 1131.00
20539 *sp* Dale and Appelbe's Pharmacy Law and Ethics, 8 G.E. AppelbeiJoy Wingfield 2005 990.00
Ed
20542 Information Technology for Pharmacists Richard Fisher 2005 3452.00
20543 Introduction to Pharmaceutical Calculations, 2 Ed Judith A. Rees,Ian 2005 2556.00
Smith,Brian Smith
20544 Pharmaceutical Calculations Workbook Ian SmithiJudith A. Rees 2005 2556.00
20545 Locum Pharmacy, 2 Ed Pamela Mason 2004 1659.00
25770 Pharmaceutical Analysis, David G. Watson 2005 4391.00
26729 BENZODIAZEPINI U SUVREMENOJ MEDICINI 0LUR-DNRYOMHYLüL=GUDYNR 2001 1750.00
/DFNRYLü
27669 Manual For Pharmacy Technicians American Society of Health- 2004 8782.00
System PharmacistsiAmer
29134 .OLQLþNDIDUPDFLMDLWHUDSLMD WALKER, EDWARDS 2004 5810.00
29667 Drug Treatment in Urology Eardley 2005 6039.00
30699 The Merck Index, 14th edition Merck 2006 9271.00
30951 Physicochemical Principles of Pharmacy 4th Edition A. T. Florence & D. Attwood 2005 4477.00
32309 Registar lekova Republike Makedonije za 2006 god. 2006 4320.00
33531 Tietz Clinical Guide to Laboratory Tests,4 Ed Alan Wu 2006 5855.00
36361 Pharmacy Law and Practice, 4th edition Jon Merrills 2006 7319.00
36519 Oxford Handbook of Clinical Pharmacy Wiffen, Philip 2006 2750.00
39721 LIPPIN NURSING DRUG GUIDE 2007 KARCH 2006 2190.00
40990 Foye's Principles of Medicinal Chemistry, 6e LEMKE 2007 5856.00

42248 Herbal Medicines 3rd Edition Barnes/Anderson/Phillipson 2007 9608.00


43988 Pocket Essentials of Clinical Medicine, International Ballinger & Patchett 2007 1775.00
Edition, 4th Edition
46909 PDR for Herbal Medicines 4e PDR 2008 4392.00
46948 NACIONALNI REGISTAR VETERINARSKIH LEKOVA 2007 1188.00
2007
48444 Global Pharmaceutical Marketing: Codes of Practice Judith Grice 2007 16013.00
48445 Physical Pharmacy (Fast Track) 2007 2171.00
48447 MCQS in Clinical Pharmacy 2007 2556.00
49111 Stockley's Drug Interactions 8th Edition Karen Baxter (ed) 2007 17294.00
49839 *sp* Prime Ayurvedic Plant Drugs Sukh, Dev 2005 6039.00
50188 *sp* Drug Benefits & Risks - International Textbook of Van Boxtel CJ 2001 7625.00
Clinical Pharmacology
53551 Farmaceutska tehnologija sa biofarmacijom Gordana Vuleta 2007 864.00
53821 Essentials of Pharmaceutical Chemistry, 3 Ed Donald Cairns 2008 3196.00
54054 Nacionalni registar lekova Srbije i Crne Gore 2008 2008 1782.00
55713 Antibiotici 2001 1168.00
57498 Principles and Practice of Pharmaceutical Medicine Edwards LD 2007 15250.00
14 od 116
2e
58729 PDR Concise Drug Guide for Pediatrics PDR 2008 3659.00
60120 Applied Pharmaceutical Practice Chris Langley, Dawn 2008 3837.00
Belcher
60166 Complementary and Alternative Medicine (Fasttrack) Steven B. Kayne 2008 2171.00
60276 PHARMACOECONOMICS AN INTRODUCTION PB RASCATI 2008 3904.00
60345 Meyler's Side Effects of Herbal Medicines, Jeffrey K. Aronson 2008 4879.00
61025 Real World Drug Discovery, Robert Rydzewski 2008 5855.00
61239 )DUPDNRWHUDSLMVNLYRGLþ 2008 2619.00
61740 Toksikologija -RNDQRYLü0LODQDXWRU 2001 1080.00
61959 /HNRYLXSURPHWXSULUXþQLNROHNRYLPDLQMLKRYRM 2008 972.00
primeni
62172 $QWLPLNUREQLOHNRYLSULUXþQLN]DWHUDSLMXLQIHNFLMD .DåLü7RPLVODYDXWRU 2007 378.00
62175 7HUDSLMDEROQLKVLQGURPDSULUXþQLN .DåLü7RPLVODYDXWRU 2007 324.00
62176 1HXURIDUPDNRWHUDSLMD3VLKRIDUPDNRWHUDSLMDSULUXþQLN .DåLü7RPLVODYDXWRU 2007 700.00
za terapiju u neurologiji i psihijatriji
62229 Magistralne formule 2008 *RUGDQD9XOHWD-HOD0LOLü 2008 4320.00
62230 Nacionalni registar lekova Srbije i Crne Gore 2009 2009 2160.00
65805 PHARMACOTHERAPY HANDBOOK 7 ISE Barbara G. Wells, Joseph 2009 3020.00
T. Dipiro, Terry L. Schwi
66841 Pharmacy Ethics and Decision Making (First edition) Joy Wingfield 2007 3196.00
67040 Non-Prescription Medicines 3rd Edition Alan Nathan 2006 3837.00
67043 Rote Liste 2009 2009 10109.00
67066 Handbook of Pharmaceutical Excipients 6th Edition Rowe/Sheskey/Quinn 2009 31385.00
67772 Medicinal Natural Products - A Biosynthetic Dewick P M 2009 4264.00
Approach 3e
69029 Trease & Evans Pharmacognacy 16th IE Evans 2009 3141.00

69867 *RWRYLOHNRYLSULUXþQLN]DIDUPDNRWHUDSLMXL]GDQMH .DåLü7RPLVODYDXWRU 2009 1620.00


70100 /HNRYLXSURPHWXSULUXþQLNROHNRYLPDLQMLKRYRM 2009 1080.00
primeni
70463 3ULUXþQLNL]NR]PHWRORJLMHL]GDQMH Dragana Vasiljevic, 2009 864.00
6QHåDQD6DYLü/MLOMDQD
ĈRUÿHY
71308 Pharmaceutical Practice 4th IE Winfield 2009 3415.00

71531 Pharma-Ecology: The Occurrence and Fate of Jjemba PK 2008 8168.00


Pharmaceuticals and Personal Care Products in the
Environment
71667 British National Formulary , Bnf 2009 3714.00
BNF 58
71828 Psychiatric Drugs Explained, 5th Edition David Healy 2008 2561.00

71880 Drugs in Use (Fourth edition) Edited by Linda J Dodds 2009 3842.00
71885 A Practical Guide to Licensing Herbal Medicinal Brendler/Phillips/Speiss 2009 32025.00
Products
71886 Basic Pharmacokinetics Sunil S Jambhekar 2009 5123.00
71887 MCQs in Pharmacy Practice - 2nd Edition Lilian M. Azzopardi 2009 2561.00
71889 Fast Track: Applied Pharmaceutical Practice Chris Langley & Dawn 2009 2305.00
Belcher
71892 Hospital PreRegistration Pharmacis Training 2009 2556.00
71894 Fast Track: Pharmaceutics - Delivery and Targeting Yvonne Perrie & Thomas 2009 2305.00
Rades

15 od 116
71895 Fast Track: Therapeutics Nadia Bukhari & David 2009 2305.00
Kearney
71900 Introduction to Renal Therapeutics - First Edition C. Ashley and C. Morlidge 2008 3837.00
71911 Lecture Notes in Pharmacy Practice Edited by Lilian M Azzopa 2009 5123.00
71912 Medicines, Ethics and PracticeA Guide for Pharmacists Rpsgb 2009 3203.00
33 (July 2009)
72537 CLINICAL ROWLAND 2010 5246.00
PHARMACOKINETICS/PHARMACODYNAMICS 4E
74363 Forbidden Drugs (3/e) Robson, Philip 2009 1874.00
76748 APPLIED CLINICAL PHARMACOKINETICS BAUER 2008 3325.00

77409 An Introduction to Clinical Pharmaceutics Alexander T Florence 2010 3201.00


79740 Clinical Pharmacy and Therapeutics Text and Evolve Roger Walker 2007 6221.00
ebooks Package,
80305 L'Informatore Farmaceutico 2010 ( Set di Volumi Iniziali 2010 45765.00
+ Aggiornamento Bimestrale Non Piu Mensile)- codice
TX0038433
80984 Nacionalni registar lekova Srbije i Crne Gore 2010 /MLOMDQDĈXNLüLVDUDGQLFL 2010 1620.00
81012 Wilson & Gisvold's Textbook of Organic Medicinal and BEALE / BLOCK 2010 4697.00
Pharmaceutical Chemistry, 12/e (International Edition)

81115 British National Formulary 59 (BNF 59) Joint Formulary Committee 2010 3842.00
81124 Stockley's Drug Interaction Pocket Companion 2010 Baxter, Karen 2010 2945.00
81125 Rote Liste 2010 2010 10109.00
81544 Plant Drug Analysis: A Thin Layer Chromatography Hildebert Wagner, Sabine 2009 9066.00
Atlas Bladt
82032 MARTINS PHYSICAL PHARMACY & SINKO 2010 4874.00
PHARMACEUTICAL SCIENCES 5E
82075 Handbook of Clinical Drug Data Smith 2010 4513.00
82433 L'Informatore Farmaceutico Medicinali 2010 2010 2970.00

83048 European Pharmacopoeia 7th Ed 2011 (volumes 7.0- 2010 54900.00


7.2) - English.
110783 European pharmacopoeia USB STICK subscription 7th 2010 48800.00
Edition 2011 (volumes 7.0 - 7.2)
110790 Lekovi u prometu 2010- Prirucnik o lekovima I njihovoj Vida Jakovljevic, Momir 2010 1188.00
primeni Mikov, Zdenko Tomic
110869 Farmaceutska medicina : odabrana poglavlja Milica Prostran, Milan 2009 4860.00
6WDQXORYLü'UDJRPLU
Marisa
111000 British Pharmacopoeia 2011 6 vol. boxed set (print + Stationery Office (U. k.) 2010 111386.00
CD)
112408 Conducting Your Pharmacy Practice Research Project Felicity J Smith 2010 2048.00
(Second edition)
112423 Medicines Use ReviewsA Practical Guide Susan Youssef 2010 3201.00
112451 British National Formulary 60 (BNF Joint Formulary Committee 2010 4482.00
112648 PHARMACEUTICAL CALCULAT 13E (INT ED) CB ANSEL 2010 6100.00
114198 Pharmacology & Pharmacokinetics: A Basic Reader Tomlin 2010 4530.00
(Competency-Based Critical Care)
114245 BASIC CLINICAL PHARMACOKINETICS 5E PB WINTER 2009 5368.00
115914 Ja farmaceut 0LKDMORYLü*RUGDQD 2003 702.00
ĈXURYLü'UDJDQ8URãHY
Dubr
116050 Drugs in Palliative Care Dickman, Andrew 2010 3120.00

16 od 116
116132 THE HERBAL GUIDE PB BONAKDAR 2010 4630.00
117494 L'Informatore Farmaceutico 2010 - aggiornamento 0.00
settembre 2010 (supplement septembre 2010
farmakologija
39 Pharmacotherapeutics & Advanced Nursing Practice Eisenhauer, Murpby 1998 360.00
3165 *sp* Medical pharmacology at a glance -IE Neal, Michael J. 2002 400.00
4154 *sp* Child and Adolescent Clinical Green 2001 800.00
Psychopharmacology
5539 *sp* Lyophilization: Introduction and Basic Principles Thomas A. Jennings 1999 8967.00
8169 *sp* Opthalmic Drug Delivery Systems (Drugs and the Ashim K. Mitra 2003 11993.00
Pharmaceutical Sciences, 130)
8182 *sp* Microbial Multidrug Efflux Ian T. Paulsen, Kim Lewis 2002 5185.00
8236 *sp* Clinicians' Guide to Aspirin Antony Bayer 1998 900.00
8360 *sp* Documentation Systems: Clear and Simple- video Vesper 1997 4880.00
8956 The Maillard Reactions in Foods and Medicine (Special J. O'Brien, H. E. Nursten, J. 1998 11433.00
Publication (Royal Society of Chemistry), 223) Crabbe
10411 *sp* Physicians' Desk Reference Supplement A 2003 Medical Economics 2003 400.00
Company
10718 The ABC Clinical Guide to Herbs Mark Blumenthal 2003 7555.00
11878 Dictionary of Pharmacovigilance Amer Alghabban 2004 8327.00
11879 The Medicinal Uses of Cannabis and Cannabinoids Geoffrey Guy 2004 4477.00
11887 Concordance Bond 2004 4477.00
14099 *sp* Lipases and Phospholipases in Drug Development G??nter M??ller, Stefan 2004 7930.00
: From Biochemistry to Molecular Pharmacology Petry
14492 Extended Stability for Parenteral Drugs Caryn M. Bing 2003 7688.00
15907 The Organic Chemistry od Drug Design and Drug Silverman 2004 3240.00
Action, 2 Ed - IE
16420 Drugs of Abuse, 2 Ed Simon Wills 2005 3837.00
18019 Farmakologija, 5 edicija, prevod Rang i Dale 2005 3390.00
18822 3RPRüQHWYDULXOMHNRYLPD 0HOLWDâDNRYLü3HWUXãLü 2002 840.00
19588 VITAMINI I MINERALI 0DULFD0HGLüâDULü 2001 3500.00
21717 *sp* Laboratory Auditing For Quality And Regulatory Donald Singer,Raluca- 2005 7807.00
Compliance (Drugs and the Pharmaceutical Sciences: Ioana Stefan,Jacobus Van
a Series of Textbooks and Monographs) Stad
24201 APPLIED PHARMACOKINETICS AND 2005 5124.00
PHARMACODYNAMICS : PRINCIPLES OF
THERAPEUTIC DRUG MONITORING 4 Rev ed
24354 Basic Concepts in Pharmacology Janet L. Stringer 2005 2195.00
25484 Color Atlas of Pharmacology, 3 Ed Heinz Lüllmann,Klaus 2005 3775.00
Mohr,Albrecht Ziegler
25771 Calculations for Pharmaceutical Practice Winfield 2005 2561.00
26619 NUSPOJAVE PSIHOFARMAKA Uzun, Kozumplik, Mimica 2005 1750.00
29688 Register zdravil Republike Slovenije 2006 god 2007 6480.00
30271 *sp* Quality of Life - The Assessment, Analysis and Fayers P 2006 6222.00
Interpretation of Patient-Reported Outcomes 2e
30642 *sp* Rapid Review Pharmacology Pazdernik 2002 1250.00
30872 *sp* Reviews of Physiology, Biochemistry and Susan G. Amara 2005 8808.00
Pharmacology 154
30954 Minor Illness or Major Disease? Responding to Clive Edwards & Paul 2006 3196.00
Symptoms in the Pharmacy 4th Edition Stillman
31691 Principles of Medical Pharmacology, 7th edition Kalant 2006 7441.00
34207 Escop Monographs: The Scientific Foundation for Simon Y. Mills 2003 13932.00
Herbal Medicinal Products
17 od 116
35121 Concise Clinical Pharmacology Ben Greenstein & Adam 2006 2556.00
Greenste
35581 Further MCQs in Pharmacy Practice Lillian M Azzopardi 2006 2556.00
35712 DRUG FACTS & CO POCKET VERSION 2 FACTS & CO 2006 4636.00
35819 CLINICAL DRUG THERAPY 8E ABRAMS 2006 4514.00
36063 PHARMACOLOGY FOR BOARDS AND WARD AYALA 2006 2190.00
36197 Integrated Pharmacology, 3rd edition Clive Page 2006 5611.00
36848 Basic Concepts in Pharmacology-ISE Stringer, Janet L. 2005 2196.00
37821 Rapid Review Pharmacology: With STUDENT Thomas L. Pazdernik, 2007 3171.00
CONSULT Online Access (Rapid Review) Laszlo Kerecsen
39542 Essential Psychopharmacology: the Prescriber's Guide: Stahl 2006 2074.00
Antipsychotics and Mood Stabilizers
39879 Handbook of Pharmaceutical Manufacturing Niazi Sarfaraz K 2004 22326.00
Formulations Uncompresse
40871 Pharmacology 6e IE Rang Dale 2007 3278.00
42618 Handbook of Pharmaceutical Excipients 2005 Book + 2005 44835.00
CD-ROM
43533 Litt's Drug Eruption Reference Manual, 13th Edition Litt 2007 17690.00
43746 Handbook of Pharmaceutical Manufacturing Niazi Sarfaraz K 2004 22326.00
Formulations Over-The-Co
43773 Principles of Pharmacology: The Pathophysiologic GOLAN 2007 2684.00
Basis of Drug Therapy, 2e
43790 *sp* LIPPIN NURSING DRUG GUIDE 2008 KARCH 2007 900.00
43814 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
PHARMACOLOGY
43995 Clinical Pharmacy and Therapeutics, 4E International Roger Walker 2007 2927.00
Edition,
43996 CLINICAL PHARMACOLOGY 10E IE Bennett 2007 3005.00

43998 Pharmaceutical and Medicine Chemistry Int Ed Watson, D G (Senior 2011 1829.00
Lecturer,Dept of
Pharmaceutica
44062 *sp* Drug Information Handbook for Nursing Beatrice B. Turkoski 2007 1679.00
44064 *sp* Lexi-Comp's Drug Information Handbook for Wynn, Meiller, Crossley 2007 900.00
Dentistry
44870 )$50$.2/2â.,35,58ý1,. 2007 1750.00
44871 )$50$.27(5$3,-6.,35,58ý1,. Božidar Vrhovac i suradnici 2007 4900.00
47279 Stahl's Essential Psychopharmacology Stahl/Muntner 2008 3660.00
47399 *sp* Springhouse Nurse's Drug Guide 2008 SPRINGHOUSE 2007 800.00
(Springhouse Nurse's Drug Guide)
47500 Elsevier's Integrated Pharmacology Mark Kester 2007 3049.00
47624 2VQRYQLNRQFHSWLXIDUPDNRORJLMLYRGLþ]DVWXGHQWH Janet L. Stringer 2008 695.00
48363 Pharmacology Principles: Roadside Assistance (Dvd Alan Agins 2007 2561.00
and Workbook),
48436 Nutraceuticals, 2 Ed Brian Lockwood 2007 5118.00
48943 Drug Discovery and Development V 2 - Drug Chorghade MS 2007 6460.00
Development
49012 Drugs and the Liver 2008 3837.00
49013 Molecular BiopharmaceuticsAspects of Drug Edited by Bente Steffanse 2009 16013.00
Characterization, Drug Delivery and Dosage Form
Evaluation
50083 *sp* Europäisches Arzneibuch 5. Ausgabe, 5. Nachtrag 2007 400.00
(Ph.Eur. 5.5)
50084 *sp* Europäisches Arzneibuch 5. Ausgabe, 6. Nachtrag 2007 400.00
18 od 116
(Ph.Eur. 5.06)
50188 *sp* Drug Benefits & Risks - International Textbook of Van Boxtel CJ 2001 7625.00
Clinical Pharmacology
50256 Textbook of Receptor Pharmacology Third Edition Foreman 2010 8539.00
51154 *sp* Medicinal Plants of the Asia-Pacific Wiart 2006 4578.00
51258 Farmakologija-23. izdanje 9DUDJLü0LORãHYLü 2009 2052.00
52562 Clinical Ocular Pharmacology, 5th edition Jimmy Bartlett 2007 10979.00
54315 Medicinal Chemistry and Pharmacological Potential of 2008 15473.00
Fullerenes and Carbon Nanotubes ( Carbon Materials:
Chemistry and Physics)
55109 Pharmacology, Eugenia Fulcher 2008 5733.00
55167 Drug Calculations: Process and Problems for Clinical Meta Brown 2007 4757.00
Practice
55799 Index Nominum, International Drug Directory 19 ed, 2008 32141.00
56217 DRUGS IN PREGNANCY & LACTATION 8E CB BRIGGS 2008 10492.00
57498 Principles and Practice of Pharmaceutical Medicine Edwards LD 2007 15250.00
2e
57985 Registar lijekova Republike Hrvatske za 2008 godinu 2008 4200.00
57988 A Textbook of Clinical Pharmacology and Therapeutics Tim Mant 2008 3659.00
Fifth Edition
58119 Register zdravil Republike Slovenije 2008 god (br. 11) 2008 6728.00
58731 PDR Concise Drug Guide for Advanced Practice PDR 2008 3293.00
Clinicians
59058 Lippincott's Illustrated Review: Pharmacology, HARVEY 2008 2440.00
International Edition, 4e
59927 Drugs for the Heart, 7th Edition Lionel Opie 2008 5611.00
59950 Introduction to Pharmacology Mary Kaye Asperheim 2008 3903.00
Favaro
59973 Pharmacology: A Handbook for Complementary Elaine Mary Aldred 2008 5123.00
Healthcare Professionals
60112 *sp* Martindale's Drugs Restricted in Sport 2008 2008 490.00
Pocket Companion
60148 Biomarker Methods in Drug Discovery and 2008 11334.00
Development (Methods in Pharmacology and
Toxicology)
60402 Meyler's Side Effects of Cardiovascular Drugs (Meylers Jeffrey K. Aronson 2008 4879.00
Side Effects) (Meylers Side Effects)
60403 Meyler's Side Effects of Drugs in Cancer and 2008 4879.00
Immunology (Meylers Side Effects)
61239 )DUPDNRWHUDSLMVNLYRGLþ 2008 2619.00
61532 The Practice of Medicinal Chemistry, Camille Georges Wermuth 2008 13420.00
61751 Europäisches Arzneibuch 5. Ausgabe, 7. Nachtrag 2007 6066.00
(Ph.Eur. 5.7)
62035 Drugs and Pregnancy: a handbook Little, Bertis 2006 3659.00
65351 Master Medicine: Medical Pharmacology, Simon Constable 2007 2927.00
65855 Europäisches Arzneibuch 5. Ausgabe, 4. Nachtrag 2006 1080.00
(Ph.Eur. 5.4)
66408 Clinician's Pocket Drug Reference 2009 Gomella 2009 975.00
66813 Sedation, 5 Ed Stanley F. Malamed 2009 6343.00
66836 Applied Therapeutics: The Clinical Use of Drugs 9/e KODA-KIMBLE 2008 14518.00
67571 Introduction to Neuropsychopharmacology UNKNOWN 2009 3752.00
67699 Pharmacology and Therapeutics, Scott Waldman 2009 15738.00
67766 Brody's Human Pharmacology,5 Ed Lynn Wecker 2009 5977.00

19 od 116
67767 Pharmacology Condensed,2 Ed Maureen Dale 2008 2927.00
67768 Pharmacology, 3rd Edition George M. Brenner 2009 4757.00
With STUDENT CONSULT Online Access

68841 Antidepressants Stahl 2009 3049.00


69092 A Pharmacology Primer, Terry Kenakin 2009 6099.00
69785 Farmakologija H.P.Rang; M.M.Dale 9730.00
70886 McGraw-Hill's I.V. Drug Handbook 1ed ISE SCHULL 2009 2349.00

71062 Pharmacology Flash Cards, 2nd Edition George M. Brenner 2009 3171.00
71701 Natural Standard's Herbal Pharmacotherapy, Catherine Ulbricht 2009 7929.00
71881 FAST TRACK: PHARMACOLOGY RANDALL 2009 2305.00
71890 Evaluation of Herbal Medicinal Products Edited by Peter Houghton 2009 15372.00
73130 PHARMACOLOGY 5E PB BRS (ROSENFELD) 2009 2678.00
73312 Basic & Clinical Pharmacology, 11 Ed-ISE KATZUNG 2009 3550.00

76337 Pocket Guide: Pharmacokinetics Made Easy, 2 Ed Donald J. Birkett 2010 2927.00
79732 Drugs for Pregnant and Lactating Women, Carl P. Weiner 2009 10735.00
79738 Pharmaceutical Analysis Text and Evolve eBooks David G. Watson 2009 4879.00
Package: A Textbook for Pharmacy Students and
Pharmaceutical Chemists
80759 Registar lijekova u Hrvatskoj za 2010, 53. izdanje 2010 4200.00
80826 Stahl's Illustrated Chronic Pain and Fibromyalgia Stahl/Muntner/Ball 2009 3049.00
80830 Stahl's Illustrated Attention Deficit Hyperactivity Stahl/Mignon 2009 3049.00
Disorder
81124 Stockley's Drug Interaction Pocket Companion 2010 Baxter, Karen 2010 2945.00
81541 Katzung & Trevor's Pharmacology Examination and Trevor 2010 4269.00
Board Review, 9 Ed
81932 Lek - doza - vreme i pacijent u bolnici 6WDQLPLURYLü9LROHWDDXWRU 2009 1018.00
81968 Kardiovaskularni lekovi [Elektronski izvor] : 2008 : .DåLü7RPLVODYDXWRU 2009 432.00
SULUXþQLN]DWHUDSLMX
81980 PDR Guide to Drug Interactions, Side Effects PDR 2010 6953.00
and Indications 64e
82031 Ansel's Pharmaceutical Dosage Forms and Drug ALLEN 2010 4941.00
Delivery Systems, 9 Ed
82046 Clinicians Pocket Drug Reference 2010 Gomella 2010 1097.00
82099 HANDBOOK OF PSYCHIATRIC DRUGS 6E PB ROSENBAUM 2009 3660.00
83065 Rang & Dale's Pharmacology Flash Cards, Maureen M. Dale 2010 2683.00
108963 Goodman and Gilman's Pharmacological Basis of Brunton 2011 12078.00
Therapeutics
109700 Clinical Drug Therapy, 9e Abrams 2010 6832.00
110361 $QWLELRWLFL]DNOLQLþNXSUDNVXSULUXþQLN .DåLü7RPLVODYDXWRU 2010 540.00
110792 Pharmaceutical Compounding and Dispensing 2nd Marriott, John F, Wilson 2010 5123.00
edition
110793 Non-Prescription Medicines, 4 Ed Alan Nathan 2010 4482.00
111846 Rapid Review Pharmacology,3ed Thomas L. Pazdernik 2010 3171.00
112379 *,7SULUXþQLN]DWHUDSLMXEROHVWLJDVWURLQWHVWLQDOQRJ .DåLü7RPLVODYDXWRU 2010 540.00
trakta
112404 Medicines, Ethics & Practice 34 (MEP 34)A Guide for Royal Pharmacautical Soc 2010 4482.00
Pharmacists and Pharmacy Technicians
112408 Conducting Your Pharmacy Practice Research Project Felicity J Smith 2010 2048.00
(Second edition)
112423 Medicines Use ReviewsA Practical Guide Susan Youssef 2010 3201.00
20 od 116
112520 Pharmacology: PreTest Self-Assessment and Review, Marshal Shlafer 2010 2561.00
Thirteenth Edition (PreTest Basic Science)
113215 Osnove nanomedicine : embriologija, farmakologija, 0LOHQD3DSLü2EUDGRYLü 2009 2160.00
nanotehnologija 6X]DQD0LOMNRYLü/LGLMD0
113923 Medication Safety Courtenay/Griffiths 2009 2927.00
114048 Lecture Notes - Clinical Pharmacology and McKay GA 2010 2927.00
Therapeutics 8e
114198 Pharmacology & Pharmacokinetics: A Basic Reader Tomlin 2010 4530.00
(Competency-Based Critical Care)
114851 Color Atlas of Pharmacology, 4 Ed Heinz Lüllmann, Klaus 2010 4315.00
Mohr, Albrecht Ziegler
115950 Drugs In Sport Mottram, David 2010 4270.00
116280 PDR for Nutritional Supplements 2e Hendler SS 2009 4392.00
116515 Mosby's 2011 Nursing Drug Reference, Linda Skidmore-Roth 2010 3171.00
118796 Antipsychotics and their Side Effects Gardner/Teehan/Baldessari 2010 4270.00
119297 Understanding Pharmacoepidemiology (Lange Clinical Donna West, Yi Yang 2011 4269.00
Science)
119302 Pharmacotherapy Principles and Practice Study Guide: Michael D. Katz, Kathryn R. 2011 5245.00
A Case-Based Care Plan Approach Matthias, Marie A. Chi
121484 Farmakologija .DåLü7RPLVODYDXWRU 2011 1620.00
fizikalna medicina
18843 Bolesti lumbosakralne kralježnice /XFLMDQ1HJRYHWLü 1993 1400.00
18863 Kineziterapijski program za osobe oboljele od Josipa Gazibara 2002 420.00
miastenije gravis
18869 ,QWHUQLVWLþNDSURSHGHXWLNDLRVQRYHIL]LNDOQH Željko Metelko 1999 2800.00
dijagnostike
18919 )L]LNDOQHRVQRYHLNOLQLþNLDVSHNWLPHGLFLQVNH 6WLSDQ-DQNRYLü 4200.00
dijagnostike
18940 $OJRGLVWURILþQLVLQGURP ,YR-DMLü 2003 1400.00
18944 Fizijatrijsko reumatološka propedeutika ,YR-DMLü 2004 2800.00
30429 *sp* Introduction to Kinesiology Hoffman, Shirl J. 2005 3288.00
43444 Physical Rehabilitation, Michelle H. Cameron 2007 6953.00
43449 Practical Electrotherapy John Fox 2007 2927.00
49872 Križobolja, 129 str. Predrag Keros, Božidar 2002 725.00
ûXUNRYLü
52008 Complementary Therapies for Physical Therapy Judith Deutsch 2008 4879.00
52055 MANUAL OF MUSCULOSKELETAL MEDICINE 2008 2922.00
55128 Diagnostic Imaging for Physical Therapists, James Swain 2008 5123.00
55732 Fizikalna medicina i rehabilitacija-povreda 1LNROLüäDUNR 2004 1188.00
lokomotornog sistema
59888 Physical Diagnosis Secrets: With STUDENT CONSULT Salvatore Mangione 2007 3171.00
Online Access (Secrets)
60776 Scientific Foundations and Principles of Practice in David Magee 2007 5855.00
Musculoskeletal Rehabilitation,
61932 Fizikalna medicina i rehabilitacija -HYWLü0LORUDG5DXWRU 4644.00
61951 .OLQLþNDNLQH]LWHUDSLMD -HYWLü0LORUDG5DXWRU 2006 4644.00
65812 Atlas palpatorne anatomije Serge Tixa 2009 1980.00
67752 ,VSLWLYDQMHVQDJHPLãLüDPDQXHOQDPHWRGD Zec, Živojin - autor 2007 594.00
68261 Anatomy and Human Movement Study Cards, Nigel Palastanga 2008 2927.00
68268 Respiratory Physiotherapy, Beverley Harden 2008 2927.00
69016 ACSM's Exercise is Medicine: A Clinician's Guide to ACSM 2009 4026.00
Exercise Prescription
71644 Mosby's Massage Therapy Review, 3rd Edition Sandy Fritz 2009 3415.00
21 od 116
71644 Mosby's Massage Therapy Review, 3rd Edition Sandy Fritz 2009 3415.00
71651 Mosby's Respiratory Care Online for Egan's Mosby 2009 7807.00
Fundamentals of Respiratory Care (User Guide and
Access Code
71695 Orthopaedic Physical Therapy, 4th Edition Robert Donatelli 2009 8051.00

71770 The Physiotherapist's Pocketbook, 2nd Edition Karen Kenyon 2009 2927.00

71777 A Massage Therapist's Guide to Treating Headaches Sandy Fritz 2009 2927.00
and Neck Pain including DVD,
71779 The Physiotherapist's Pocket Guide to Exercise, Angela Glynn 2009 2683.00
71823 Anatomy Trains, 2nd Edition Thomas W. Myers 2008 4025.00

72463 Lymphedema Management Joachim E. Zuther 2009 6475.00


74789 McGraw-Hill's NPTE (National Physical Therapy Mark Dutton 2009 6221.00
Examination) (Lange)
82852 äLYHWLXVSUDYQRSRVOHSRYUHGHNLþPHQHPRåGLQH %DERYLü5DGH'DXWRU 2010 2160.00
83021 Minor Injuries, Dennis Purcell 2010 4025.00
109697 Kinesiology, 2e Oatis 2010 5124.00
109698 MUSCLE TESTING & FUNCTION 5E (INT ED) PB KENDALL 2010 5124.00
111551 Kinesiology of the Musculoskeletal System,2ed Donald A. Neumann 2009 6709.00
111812 Križobolja Grazio S., Buljan D. 2009 4116.00
111872 Rehabilitaciona medicina u traumatologiji i ortopediji -HYWLü00DULü9/R]R 2009 1026.00
9*DYULü1
114121 Massage for Therapists - A guide to soft tissue Jones E 2009 3659.00
therapy 3e
114485 Introductory Biomechanics, Andrew Kerr 2010 3049.00
114575 Kinesiology, Joseph E. Muscolino 2010 5001.00
115051 Evidence-based Therapeutic Massage, Elizabeth A. Holey 2010 5123.00
117734 Combined Movement Theory, Chris Mccarthy 2010 5489.00
fiziologija
13989 *sp* Biology of Humans 2ed Judith Goodenough Betty 2004 1450.00
McGuire Robert Wallace
14576 Nervous System: Anatomy and Physiology (Netter Frank H. Netter 2000 6460.00
Collection of Medical Illustrations, Volume 1, Part 1)
14585 Musculoskeletal System: Anatomy, Physiology, Frank H. Netter 1999 6460.00
Metabolic Disorders (Netter Collection of Medical
Illustrations, Volume 8, Part 1)
18132 Principles Of Exercise Testing and Interpretation WASSERMAN 2004 8540.00
Includig Pathophysiology and Clinical Applications, 4/e

20914 Physiology 5ed updated SC , IE Berne 2005 3415.00


23794 *sp* Textbook of Medical Physiology 11/e IE Guyton 2005 4000.00
26063 Berne & Levy Principles of Physiology 4th IE Berne 2005 4371.00
26081 MEMMLERS HUMAN BODY HEALTH DIS 1,IE COHEN 2005 1922.00
30566 Anatomy and Physiology Saladin, Ken 2006 5245.00
30567 Laboratory Atlas of Anatomy and Physiology Bertram, John W. 2005 3659.00
30872 *sp* Reviews of Physiology, Biochemistry and Susan G. Amara 2005 8808.00
Pharmacology 154
36164 Ross and Wilson's Anatomy and Physiology Colouring Anne Waugh 2006 2317.00
and Workbook, 2nd edition
36203 Cardiovascular Physiology, 9th edition Matthew Levy 2006 3415.00
36678 REVIEW OF MEDICAL PHYSIOLOGY, 22 Ed - ISE Ganong 2005 2623.00
37961 Anatomija i fiziologija Predrag Keros, Branka 2006 1400.00
22 od 116
0DWNRYLü
39738 HIGH-YIELD ACID-BASE 2E LONGENECKER 2006 1580.00
48358 HIGH YIELD PHYSIOLOGY DUDEK 2008 1464.00
50421 Elsevier's Integrated Physiology Robert Carroll 2006 3049.00
54461 Introduction to Modeling in Physiology and Medicine, Claudio Cobelli 2008 7807.00
55100 Berne & Levy's Physiology 6th IE Koeppen 2008 4098.00
56513 Medicinska fiziologija,jedanaesto izdanje Guyton i Hall 2008 8910.00
56714 Specijalna patološka fiziologija,drugo izdanje Bogdan Beleslin 2008 1790.00
59939 Netter's Essential Physiology, Susan Mulroney 2008 4757.00
60028 Physiology (Crash Course) Shahid 2007 2927.00
60302 Medical Physiology Updated SC 2ed Boron 2009 5738.00
60730 RESPIRATORY PHYSIOLOGY ESSENTIALS 8E PB WEST 2008 2196.00
61533 Textbook of Clinical Hemodynamics Michael Ragosta 2008 7807.00
65926 +RPHRVWD]DLWHOHVQHWHþQRVWL 0XMRYLü9XMDGLQ0DXWRU 2001 1080.00
69300 GI sistem i ishrana : integrativna fiziologija 0XMRYLü9XMDGLQ0DXWRU 2006 292.00
70784 Human Anatomy and Physiology:International Edition Elaine Marieb Katja Hoehn 2009 5489.00
8ed
70788 Essentials of Anatomy & Physiology:International Editio Frederic Martini Edwin 2009 4315.00
5ed Bartholomew
70889 Case Files: Physiology 2ed ISE TOY 2009 1598.00

70890 Medical Physiology: The Big Picture 1ed ISE KIBBLE 2009 2556.00

71634 Mosby's Anatomy & Physiology Study and Review Mosby 2009 2317.00
Cards,
72412 Color Atlas of Physiology, 6 Ed Agamemnon Despopoulos, 2009 3775.00
Stefan Silbernagl
73316 Ganong's Review of Medical Physiology, 23rd Ed-ISE BARRETT 2009 2867.00

73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) 2009 3044.00
Fifth Edition
74791 Vander's Renal Physiology, 7th Edition (Lange Douglas C. Eaton, John 2009 3537.00
Physiology Series) Pooler
74980 An Introduction to Cardiovascular Physiology Fifth J Rodney Levick 2009 3659.00
Edition
75053 Hard Work:Defining Physical Work Performance Brian J. Sharkey, Paul O. 2008 5612.00
Requirements Davis
75483 Principles of Physiology for the Anaesthetist 2e Ian Power 2007 5489.00
76724 Fiziologija centralnog nervnog sistema 0LODQRYLü=YH]GDQ 2009 1080.00
77410 A Laboratory Guide to Human Physiology: Concepts & Fox 2008 7929.00
Clinical Applications
77454 EXERCISE PHYSIOLOGY 7E (INT EDITION) CB MCARDLE 2009 4270.00
77964 Problem-Based Physiology, Robert G. Carroll 2009 3415.00
79742 Berne & Levy Physiology, 6e Updated Edition,-IE Koeppen & Stanton 2009 5054.00
International Edition, 6th Edition

80897 Povišeni holesterol i ateroskleroza /HSãDQRYLü/D]DUDXWRU 2009 486.00


80942 Fiziologija : sistemski prilaz homeokinezi /DåHWLü%RJRVDYDXWRU 2009 1620.00
81362 The Musculoskeletal System, 2nd Edition Philip Sambrook 2010 3049.00

82487 Ross and Wilson Anatomy and Physiology in Health Waugh & Grant 2010 1707.00
and Illness International Edition, 11th Edition
82488 Guyton and Hall Textbook of Medical Physiology, Hall 2010 5489.00
23 od 116
International Edition, 12th Edition

109706 BRS Physiology, 5e,IE Costanzo 2010 3044.00


110088 Fluid, Electrolyte and Acid-Base Physiology, Mitchell L. Halperin 2010 5123.00
111857 Physiology: with STUDENT CONSULT Online Access, Linda S. Costanzo 2009 4757.00
4 Ed
112538 Deja Review Physiology, Second Edition Edward A. Gould 2010 1951.00
115062 Guyton & Hall Physiology Review, John E. Hall 2010 2927.00
115484 ZBIRKA TEST PITANJA IZ FIZIOLOGIJE I 0DWNR0DUXãLü'DQND 2005 1750.00
IMUNOLOGIJE *UþHYLü
116246 PATOFIZIOLOGIJA 7 izd. 6*DPXOLQ00DUXãLü= 2010 9800.00
.RYDþLVXUDGQLFL
116247 PATOFIZIOLOGIJA - zadatci za problemske seminare, Z. KovaË, S. Gamulin i 2010 4200.00
7 izd. suradnici
gastroenterologija i hepatologija
1587 *sp* Mosby's Color Atlas and Text of Gastroenterology Aspinall 2002 3940.00
and Liver Disease
5567 *sp* Morson & Dawson's Gastrointestinal Pathology Basil C. Morson 2003 11285.00
9918 *sp* Inflammatory Bowel Diseases Satsangi 2003 7808.00
16906 Evidence Based Gastroenterology and Hepatology - IE Burroughs, Andrew K. 2004 9150.00
18923 Gastroenterologija i hepatologija 1-2 %RULV9XFHOLü 2004 8400.00
19593 %2/(67,*8â7(5$ý( $QWH%LOLüLVXUDGQLFL 1993 2009.00

24036 Sleisenger and Fordtran's Gastrointestinal and Liver Mark Feldman 2006 24522.00
Disease,8 Ed
24335 Grade: Gastroenterology Quick Glance Edwards 2004 2927.00
29396 Understanding Gastroesophageal Reflux Disease Nicholas J., M.D. Shaheen 2005 1829.00
29664 *sp* Pocket Consultant: Gastroenterology Travis 2005 2772.00
30825 The Pelvic Floor Beate CarriereiFeldt 2006 7555.00
30881 *sp* Proteases in Gastrointestinal Tissues Uwe LendeckeliNigel M. 2006 6801.00
Hooper
34619 Oxford Handbook of Gastroenterology and Hepatology Bloom, Stuart 2006 3375.00
35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New L. M. Portnoy 2006 4533.00
Outlook
36201 Gastrointestinal Physiology, 7th edition Leonard Johnson 2006 3415.00
37091 'HþMDJDVWRHQWHURORJLMD )LOLSRYLü'REULYRMH 1995 648.00
43947 Gastrointestinal Imaging, 3rd edition Robert Halpert 2006 7929.00
47733 Endosonography, Text with DVD Robert Hawes 2006 18422.00
53192 Pearson's Thoracic and Esophageal Surgery, G. Alexander Patterson 2008 31476.00
55200 VIRTUAL COLONOSCOPY CB YEE 2007 10492.00
55701 Inflamatorne bolesti creva 8JOMHãLü0LOHQNR 2004 1058.00
55722 Akutna insuficijencija jetre 519.00
55729 Hirurgija pankreasa 5DGRMH%ýRORYLü 1998 584.00
55735 Slezina 0LOLFD'ýRORYLü5DGRMH% 519.00
ýRORYLü
56138 MANUAL GASTROENTEROLOGY 4E -ISE AVUNDUK 2008 3904.00
59925 Gastrointestinal System (Mosby's Crash Course Chew 2007 2927.00
Series)
62011 Management of Abdominal Hernias 3ed Kingsnorth, Andrew 2003 17995.00
66478 The Washington Manual Gastroenterology WASHINGTON UNIV 2008 2867.00
Subspecialty Consult, 2 Ed-ISE
66480 PRIMO GASTRO POCKET GI,LIVER COMPAN PB GUARDINO 2007 3166.00
24 od 116
67139 Intrevencijska gastroenterologija 0DULMD5RVDQGLü3LODãL 1993 1169.00
saradnici
68247 'LMDJQRVWLþNHGLOHPHKHSDWRORãNLKVLQGURPDLVLQGURPD =YRQLPLU9XNXãLü6WRMDQ 2009 486.00
sepse 5DGLü0DMD0LMDLORYLü
69445 Practical Gastrointestinal Endoscopy - The Cotton P 2008 6709.00
Fundamentals 6e Volume 1
70837 CURRENT Diagnosis and Treatment in GREENBERGER 2009 4269.00
Gastroenterology, Hepatology and Endoscopy 1ed ISE

71191 Ct Colonography: Principles and Practice of Virtual Perry J. Pickhardt 2009 20496.00
Colonoscopy,
72311 Oxford Handbook of Gastrointestinal Nursing Norton 2008 2375.00
72409 Teaching Atlas of Abdominal Imaging Mukesh G. Harisinghani, 2008 10795.00
Peter R. Müller
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch 2008 1939.00
X. Mayr Intestinal Therapy from Europe
73010 Color Atlas of High Resolution Manometry Conklin 2009 11334.00
73011 New Liver Anatomy: Portal Segmentation and the Munemasa Ryu, Akihiro 2009 17571.00
Drainage Vein Cho, Hiroshi Yamamoto
73126 DIAGNOSTIC PATHOLOGY GASTRO AMIRSYS CB GREENSON 2009 27572.00
74808 McGraw-Hill Manual Colorectal Surgery Andreas M. Kaiser 2009 5001.00
76820 Liver Diseases - An Essential Guide for Nurses and Sargent S 2009 4879.00
Health Care Professionals
76822 Endoscopic Ultrasonography 2e Gress F 2009 7319.00
80993 Oxford Case Histories in Gastroenterology and Walsh, Alissa J.; Buchel, 2010 4996.00
Hepatology Otto C.; Collier, Jane;
81363 Netter's Gastroenterology, 2nd Edition (Print Version Martin H. Floch 2010 7929.00
Only)

83032 The Digestive System, Margaret E. Smith 2010 3049.00


109418 Cope's Early Diagnosis of the Acute Abdomen () Silen, William 2010 3439.00
110087 Gi/Liver Secrets Plus, Peter Mcnally 2010 4635.00
110359 Harrison's Gastroenterology and Hepatology Dan L. Longo, Anthony S. 2010 6343.00
Fauci
110454 Sleisenger and Fordtran's Gastrointestinal and Liver Mark Feldman 2010 27572.00
Disease- 2 Volume Set, 9th Ed, Pathophysiology,
Diagnosis, Management, Expert Consult Premium
Edition - Enhanced Online Features and Print
111792 Endosonography,2ed Robert H. Hawes 2010 18056.00
112157 PRAC GUIDE TO ABDOMINAL PELVIC MRI 2E CB LEYENDECKER 2010 11590.00
115351 ALGORITMI U GASTROINTESTINALNOJ R. PulaniÊ i suradnici 2010 2100.00
ENDOSKOPIJI I ENDOSKOPSKOM ULTRAZVUKU
115353 DEZINFEKCIJA, STERILIZACIJA I SKLADIŠTENJE -%UOMDN53XODQLü5 2010 840.00
FLEKSIBILNIH ENDOSKOPA I ENDOSKOPSKOG 2VWRMLü6.DOHQLü
PRIBORA
115365 23û$,63(&,-$/1$*$6752(17(52/2â.$ 0$5,-$526$1',û3,/$â 3081.00
ENDOSKOPIJA
genetika
1413 Genomes T.A. Brown 2002 4099.00
8457 *sp* Guide to Yeast Genetics and Molecular and Cell Guthrie, Fink 2002 1450.00
Biology part B Methods in Enzymology Vol. 350
8458 *sp* Guide to Yeast Genetics and Molecular and Cell Fink 2002 1450.00
Biology part C; Methods in Enzymology Volume 351
8954 Seeds of Concern: The Genetic Manipulation of Plants David R. Murray 2003 2799.00
11517 Phenotypic Plasticity: Functional and Conceptual Thomas J. Dewitt, Howard 2004 7878.00
25 od 116
Approaches M. Brody, Samuel M. Sche
18827 Humana genetika Zergollern 1994 3500.00
22121 Understanding DNA, 3rd edition Calladine Et Al 2004 5123.00
24412 *sp* Informational Biopolymers of Genes and Gene Blake 2005 3903.00
Expression
24413 DNA Replication Kornberg 2005 6953.00
24476 DNA Topology A. BatesiTony Maxwell 2005 2870.00
26622 RACIONALNA DIJAGNOSTIKA NASLJEDNIH I ,YR%DULü$QD6WDYOMHQLü 2005 2100.00
35,52Ĉ(1,+%2/(67, Rukavina

35521 Color Atlas of Genetics 3ed Eberhard Passarge 2006 3775.00


36449 *sp* Student Companion Guide to Accompany Snustad DP 2006 900.00
Principles of Genetics 4e
42835 Introduction to Genetic Analysis Griffiths 2007 6099.00
45595 Thompson & Thompson Genetics in Medicine, 7th Robert Nussbaum 2007 5611.00
edition
47509 Medical Genetics (Oxford Core Texts) Young, Ian D. 2005 2875.00
47578 Emery's Elements of Medical Genetics, 13th edition Peter Turnpenny 2007 3781.00
47579 Elsevier's Integrated Genetics Linda Adkison 2007 3049.00
48492 Recombinant DNA: Genes and GenomesA Short Watson 2007 4391.00
Course
50572 Biochemistry and Genetics: PSSAR Wilson 1341.00
54084 Molecular Biology of the Gene:International Edition 6ed James Watson Tania Baker 2008 5489.00
Stephen Bell Alexander Ga
55759 The Origins of Genome Architecture Lynch M. 2007 4879.00
61720 Principi genetike ĈHOLü1LQRVODYDXWRU 2004 1404.00
62050 Respiratory Genetics Edwin Silverman 2005 15738.00
62150 Emerijevi osnovi medicinske genetike Peter D. Turnpenny, Sian 2009 2490.00
Ellard
63516 The Impact of the Gene: From Mendel's Peas to Colin Tudge 2001 2214.00
Designer Babies
67298 iGenetics:A Molecular Approach: International Edition Peter Russell 2009 5489.00
3ed
68837 Congenital Malformations: Evidence-Based Evaluation Praveen Kumar, Barbara 2007 4879.00
and Management K. Burton
68868 HIGH YIELD GENETICS PB DUDEK 2008 2379.00
71265 Primer of Genetic Analysis Thompson, Jr et al 2007 3049.00
72616 Oxford Handbook of Genetics, 1 Ed Bradley-Smith, Guy; Hope, 2009 2875.00
Sally; Firth, Helen V.;
73099 BRS GENETICS PB BRS (DUDEK) 2009 2678.00
73479 BRS Biochemistry, Molecular Biology, and Genetics, BRS (SWANSON) 2009 3044.00
Fifth Edition
73981 World of the Cell, The:International Edition 7ed Wayne Becker Lewis 2008 5476.00
Kleinsmith Jeff Hardin
Gregory
75615 USMLE Road Map: Genetics Sack 2008 1463.00
77928 Medical Genetics,4 Ed Lynn B. Jorde 2009 5611.00
80801 Statistics in Human Genetics and Molecular Biology Reilly 2009 4757.00
(Chapman & Hall/CRC Texts in Statistical Science
Series)
82890 Human Molecular Genetics Strachan 2010 5978.00
109773 Lewin's Genes X 10e International V Krebs 2010 6099.00
112530 Biochemistry and Genetics: Pretest Self-Assessment Golder N. Wilson 2010 2561.00
26 od 116
and Review, Fourth Edition (PreTest Basic Science)
114132 Essentials of Genetics:International Edition 7ed William Klug Michael 2009 3952.00
Cummings Charlotte
Spencer Mi
114362 Genetics For Dummies 2e Robinson TR 2010 1829.00
114756 Schaum's Outline of Genetics, Fifth Edition (Schaum's Susan Elrod, William 2010 1463.00
Outline Series) Stansfield
114834 Medical Genetics Young, Ian D 2010 3750.00
114924 A Primer of Genome Science Gibson G.; Muse S. 2009 5733.00
117268 Human Genetics, 9 Ed Ricki Lewis 2009 5733.00
gerijatrija
1703 *sp* Reichel's Care of the Elderly Gallo 1999 900.00
1711 The Clinical Care of the Aged Person 7003.00
21896 *sp* Primary Care Geriatrics: a Case Based Approach Ham, Richard J. 2001 1450.00
35848 *sp* The Cambridge Handbook of Age and Ageing Johnson et al 2005 3965.00
40174 Encyclopedia of Gerontology, Two-Volume Set, 2nd James Birren 2006 55510.00
edition
54191 Geriatric Rehabilitation Manual, Timothy Kauffman 2007 5977.00
56778 GERIJATRIJA - medicina starije dobi =LMDG'XUDNRYLüLVXUDGQLFL 2007 6300.00
72320 Oxford Handbook of Geriatric Medicine Bowker 2006 2750.00
72347 Oxford Handbook of Nursing Older People Tabernacle 2009 2375.00
74738 Essentials of Clinical Geriatrics: Sixth Edition Robert L. Kane, Joseph G. 2009 4147.00
Ouslander, Itamar B. Abr
116436 Savremena gerijatrija 2003 0ODGHQ'DYLGRYLü 2003 864.00
'UDJRVODY0LORãHYLü
Vladimir Ko
ginekologija i akušerstvo
11422 Doppler Ultrasound in Gynecology and Obstetrics Christof Sohn 2003 10692.00
14307 Clinical Gynecologic Endocrinology and Infertility, 7 Ed SPEROFF 2004 15006.00
14540 Nazivlje u ginekologiji I porodnistvu Ante Drazancic 2001 1332.00
14544 Ginekologija 9HOLPLUâLPXQLüLVXUDGQLFL 2001 8655.00
16147 *sp* European Practice in Gynaecology and Obstetrics Not Applicable (Na ) 2004 5806.00
Invasive Carcinoma of the Cervix
16148 *sp* European Practice in Gynaecology and Obstetrics W. Kunzel 2004 6221.00
Breech Delivery
17511 *sp* Obstetric and Gynecologic Emergencies: Mark D. Pearlman,Judith E. 2003 3565.00
Diagnosis and Management Tintinalli,Pamela L Dyn
17768 Surgical Techniques in Obstetrics and Gynaecology Darryl J. MaxwelliD. J. 2004 7075.00
MAXWELL
17770 *sp* Hacker and Moore's Essentials of Obstetrics and Neville Hacker 2004 1450.00
Gynecology, 4th edition
18339 Lecture Notes: Obstetrics and Gynaecology IE Diana Hamilton-Fairley 2004 1647.00
18873 /LMHþHQMHUDNDMDMQLND Damir Eljuga 2003 2100.00
18945 .URQLþQD]GMHOLþQDEROXåHQD ,YR-DMLü 2100.00
19590 FETALNA EHOKARDIOGRAFIJA Prenatalna Mladen Miljan 1991 546.00
GLMDJQRVWLNDSULURGQLKVUþDQLKJUHãDND
20086 Medical Complications in Pregnancy (Practical Sabrina CraigoiEmily R 2005 4269.00
Pathways in Obstetrics & Gynecology Series) (Practical Baker
Pathways Obstetrics & Gynecology)
20555 Ultrasound in Obstetrics and Gynecology, Volume 1 - Merz, Eberhard 2005 21595.00
Obstetrics, 2 Ed
20563 Color Doppler Sonography in Gynecology and Schmidt, Werner O. 2005 16195.00
Obstetrics
27 od 116
21699 *sp* An Atlas of Reproductive Function Jonathan Van 2005 8540.00
Blerkom,Stefania A.
Nottola,Tomonori
21735 Atlas of Gynecologic Oncology J.Richard Smith,Guiseppe 2005 19520.00
Del Priore,John Curtin,Jo
21736 Practical Obstetric Hematology Ian A. GreeriPeter Clark 2005 5489.00
24296 *sp* A Clinical Guide for Contraception SPEROFF 2005 2500.00
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2004 3850.00
2 Ed
25483 The Reproductive System At a Glance, 2 Ed -IE Heffner 2006 1342.00
25966 *sp* Medical Disorders in Obstetric Practice De Swiet 2002 5795.00
26078 Obstetrics and Gynecology,IE Charles R.B. Beckmann 2006 2867.00
26609 GINEKOLOŠKA ONKOLOGIJA $QWHûRUXãLü'DPLU%DELü 2005 6300.00
Mirko Šamija, Hrvoje Šo
26898 Prenatal Diagnosis Evans, Mark I. 2007 10980.00
27422 Osteoporosis in Focus Neil Ferguson 2004 3837.00
30562 Handbook Obstetric Medicine 3e Nelson/Piercy 2006 4270.00
34640 Pathology of the Human Placenta, 5 Ed Kurt Benirschke, Peter 2006 18138.00
Kaufmann, Rebecca N.
Baerge
35531 Ultrasound in Obstetrics and Gynecology: Volume 2 - Eberhard Merz 2006 16195.00
Gynecology
36084 NOVAKS GYNECOLOGY 14E BEREK 2006 12993.00
36850 WILLIAMS OBSTETRICS STUDY GUIDE- ISE Cox, Susan 2005 1829.00
37623 3HWNRYLüLVDUDGQLFL*LQHNRORJLMD XGåEHQLN]D 3HWNRYLüLVDUDGQLFL 2004 2700.00
specijalizante)
39911 Gynaecology by Ten Teachers 18th Edition Ash Monga 2006 2439.00
39912 Obstetrics by Ten Teachers Clayton, Stanley G. 2006 2439.00
43281 Diagnostic Imaging: Breast, Wendie A. Berg 2006 22936.00
43772 MANUAL OF OBSTETRICS 7E EVANS 2007 3233.00
43876 Atlas of Gynecological Pathology Tawfik, Ossama 2007 7685.00
43877 Clinical Studies in Obstetrics, Gynaecology and de Costa, Caroline M. 2007 2317.00
Women's Health
43964 Obstetric Ultrasound, 3rd edition Trish Chudleigh 2004 5245.00
43968 Ultrasound in Gynecology, 2nd edition Iian Timor-Tritsch 2006 12566.00
43974 Clinical Gynecology Eric Bieber 2006 12444.00
43977 Clinical Gynecologic Oncology , 7th edition Philip DiSaia 2007 14396.00
45102 Ultrasonography in Obstetrics and Gynecology, 5th Peter Callen 2007 10613.00
edition
47355 Gynecological Cytology Hans Fr. Nauth 2007 17275.00
47467 Obstetrics and Gynecology Azziz, Ricardo; Davis, Jane 2007 2989.00
47503 First Aid/Obstetrics & Gynecology Boards Rahimian 2007 3837.00
48377 BLUEPRINTS OBSTETRICS & GYNECOLOGY 5E PB CALLAHAN 2009 2684.00
48558 ULTRAZVUK U GINEKOLOGIJI I PERINATOLOGIJI Asim Kurjak 2007 12600.00
48885 Atlas of Operative Laparoscopy and Hysteroscopy Donnez 2007 21838.00
48904 Atlas of Lift-Laparoscopy: The New Concept of Gasless Kruschinski 2007 15250.00
Laparoscopy
48915 Atlas of Urogynecological Endoscopy 2006 12078.00
48917 *sp* Male Reproductive Dysfunction Pathophysiology Kandeel Fouad R 2007 18666.00
and Treatment
49007 Human Preimplantation Embryo Selection Cohen 2007 17690.00
49413 Maternal-Fetal Medicine D'alton/Norwitz/Mcelrath 2007 3660.00

28 od 116
49477 Obstetric Anesthesia Pian-Smith/Leffler 2007 3660.00
49536 Drugs During Pregnancy and Lactation, 2nd edition Christof Schaefer 2007 4391.00
49641 Obstetrics and Gynecology, 2 Ed (Case Files) Eugene C. Toy, Benton 2006 1842.00
Baker, etc.
51800 Diagnostic Imaging: Gynecology Hedvig Hricak 2007 22936.00
55720 Urgentna opstetricija äLYDQRYLüäHOMNR 2003 879.00
56144 DANFORTHS OBSTETRICS & GYNECOLOGY 10E GIBBS 2008 13420.00
CB
56145 TeLinde's Operative Gynecology ROCK 2008 14518.00
56217 DRUGS IN PREGNANCY & LACTATION 8E CB BRIGGS 2008 10492.00
57064 VAGINAL SURGERY CB KOVAC 2007 13054.00
58834 William's Gynecology John O Schorge, Gary 2008 12077.00
Cunningham, Barbara
Hoffman
59753 Creasy and Resnik's Maternal-Fetal Medicine: Creasy, Resnik, Iams, 2008 16348.00
Principles and Practice, 6th Edition Expert Consult: Lockwood & Moore
Print Online with Updates
59848 Oxford Handbook of Obstetrics and Gynaecology (2/e) Collins, Sally; Arulkumaran, 2008 2500.00
Sabaratnam; Hayes, Ke
59851 Oxford Handbook of Reproductive Medicine & Family McVeigh, Enda; Homburg, 2008 2500.00
Planning Roy; Guillebaud, John
59913 Ultrasound of Fetal Syndromes: Text with DVD Beryl R. Benacerraf 2007 15738.00
59922 Atlas of Gynecologic Surgical Pathology (Atlas Of...) Philip B. Clement, Robert H. 2008 20496.00
Young
59944 Fetal Medicine: Basic Science and Clinical Practice Charles H. Rodeck, Martin 2008 26352.00
J. Whittle
59981 Early Diagnosis and Treatment of Cancer Series: Lisa Jacobs, Christina 2008 11398.00
Breast Cancer (Early Diagnosis in Cancer) Finlayson
60010 Breast Imaging (DX-Direct Series) U. Fischer, F. Baum, S. 2007 4855.00
Luftner-Nagel
61070 Obstetric Anaesthesia Clyburn, Paul; Collis, 2008 5371.00
Rachel; Harries, Sarah; Dav
61130 100 Cases in Obstetrics and Gynaecology Cecilia Bottomley 2008 2439.00
61135 Overcoming Postnatal Depression: a Five Areas Dr. Christopher Williams 2008 2805.00
Approach
61364 William's Manual of Obstetrics: Pregnancy LEVENO 2007 2073.00
Complications, 22 Ed-ISE
61722 'LMDJQRVWLNDLOHþHQMHREROMHQMDFHUYLNVDYDJLQHLYXOYH 6WDQLPLURYLü%UDQNR 2006 4536.00
Kolposkopski atlas
61738 Asistirana reproduktivna tehnologija u humanoj 5DGXORYLü6ORERGDQ5 2007 3780.00
reprodukciji autor
61956 .OLQLþNDUHSURGXNWLYQDHQGRNULQRORJLMD *RUGDQD03UHOHYLü 1996 1080.00
61994 Atlas radikalnih operacija u ginekologiji : ilustrovano sa 3RþHNRYDF3HWDUDXWRU 2003 2700.00
130 originalnih kolor fotografija i 319 crteža
62035 Drugs and Pregnancy: a handbook Little, Bertis 2006 3659.00
62044 Health Promotion in Midwifery 2nd Edition: Principles Jan Bowden 2006 2439.00
and practice
62046 Women's Vascular Health Ian a Greer 2006 12078.00
63188 Obstetrics and Gynaecology 3e Impey L 2008 4147.00
63678 Contraception: Your Questions Answered, John Guillebaud 2008 4147.00
65879 Osnovi ginekološke dijagnostike 5DGRYLü3HWDUDXWRU 2003 648.00
65880 Infekcije - oboljenja i dijagnostika donjeg dela 3RSRYLü'XãDQDXWRU 2007 432.00
genitalnog sistema žene
65882 Reproduktivna endokrinologija : regulacija ovarijalnog i 'UDJRMHYLü'LNLü6YHWODQD 2001 1296.00
29 od 116
menstrualnog ciklusa, indukcija ovulacije
66265 Essentials of Obstetrics & Gynecology 5e SC IE Hacker 2009 3825.00
68527 Oxford Handbook of Women's Health Nursing, 1 Ed Gupta, Sunanda; Holloway, 2009 2375.00
Debra; Kubba, Ali
68804 Williams Obstetrics, 23 Ed F. Cunningham, Kenneth 2009 11590.00
Leveno, Steven Bloom
68805 Laparoscopic Surgery for Gynecologic Oncology Allan L. Covens, Rachel 2009 11590.00
Kupets
68807 Case Files Gynecologic Surgery (Lange Case Files) Eugene C. Toy, Cristo 2009 2439.00
Papasakelariou, Konrad P.
Ha
68846 Fetal and Neonatal Brain Injury, 4 Ed Stevenson et al 2009 11590.00
68852 Fetal Echocardiography Allan/Cook/Huggon 2009 11590.00
68858 A Practical Guide to Basic Laboratory Andrology Bjorndahl et al 2009 4270.00
68959 Lecture Notes - Obstetric and Gynaecology 3e Hamilton-Fairle D 2008 2805.00
68960 Fetal Cardiology Archer, Nick; Manning, 2009 4370.00
Nicky
69023 Gynecologic Pathology, Marisa Nucci 2009 13542.00
69312 Obstetrics and Gynecology Board Review 3ed ISE Somkuti 2009 3367.00
69596 3252'1,ý.(23(5$&,-( Dubravko Habek i suradnici 2009 5320.00
69775 Urinarna inkontinencija 7LKRPLU59HMQRYLü-RYDQ 2009 2808.00
%+DGåLĈRNLü
69783 Mjesto i uloga kolposkopije u ranoj dijagnozi *RUDQ*UXELãLü1LNROD 2004 1540.00
/MXERMHYLü
70089 $OJRULWPLVDYUHPHQHGLMDJQRVWLNHLOHþHQMDLQIHNWLYQLK %UNLü6QHåDQDDXWRU 2009 972.00
EROHVWLXWUXGQRüL
70099 Humana reprodukcija %RMRYLü6DYRDXWRU 2003 2160.00
70103 3UDNWLþQDJLQHNRORJLMD 5LVWLü/-XERPLUDXWRU 2006 1728.00
L]GDYDþ
70896 Obstetrics & Gynecology: PreTest Self-Assessment & SCHNEIDER 2009 1951.00
Review 12ed ISE

71137 Myles Textbook for Midwives, International Edition, Fraser & Cooper 2009 2185.00
15th Edition

71290 Obstetrics Illustrated 7th IE Hanretty 2009 2595.00

71306 Clinical Obstetrics & Gyneacology 2ed IE Magowan 2009 2185.00

71698 Cytology, Edmund S. Cibas 2009 14640.00


71861 Ultrasound in Obstetrics and Gynaecology Book and Juiry W. Wladimiroff 2009 6343.00
CD-ROM

72279 Oxford Handbook of Midwifery Medforth 2006 2250.00


72395 Plastic and Reconstrutive Surgery of the Breast: A Christian J. Gabka, Heinz 2008 19435.00
Surgical Atlas Bohmert, Philip Blondeel
72433 Yen & Jaffe's Reproductive Endocrinology , 6th Edition Jerome F. Strauss 2009 18910.00
Expert Consult - Online and Print
73101 Principles and Practice of Gynecologic Oncology, 5 Ed BARAKAT 2009 18666.00
73135 MATERNAL NEONATAL CARE MIE UK EDITION PB NURSE 2009 2678.00
73323 Case Files: Obstetrics and Gynecology, 3 Ed -ISE Toy 2009 1732.00

73589 Berek and Hacker's Gynecologic Oncology 5e BEREK, HACKER 2009 13786.00

30 od 116
74201 Oxford Handbook of Obstetrics and Gynaecology 2nd Arulkumaran, Sabaratnam; 2008 4996.00
Edition and Emergencies in Obstetrics and Impey, Lawrence; Hayes, K
Gynaecology Pack
74778 State-of-the-Art Vaginal Surgery Neerja Goel 2009 15249.00
74809 Step-by-Step Colposcopy, Cryosurgery, and LEEP B Shakuntala Baliga 2009 4635.00
75669 Ginekologija i akušerstvo 0ODGHQRYLü'UDJRPLU 2008 1307.00
autor
76746 Gynecological Endoscopy Simplified: Practical Tips by Sunita Tandulwadkar 2009 4635.00
Experts
77126 PORODNIŠTVO ,YDQ.XYDþLü$VLP.XUMDN 2009 6552.00
-RVLSĈHOPLãLVXUDGQLF
79732 Drugs for Pregnant and Lactating Women, Carl P. Weiner 2009 10735.00
79734 Hysteroscopy: Office Evaluation and Management of Linda D. Bradley 2008 12322.00
the Uterine Cavity,
81221 Sperm Banking Pacey/Tomlinson 2009 4270.00
81222 Manual of Intrauterine Insemination and Ovulation Dickey/Brinsden/Pyrzak 2009 4636.00
Induction
81223 Infertility in the Male Lipshultz/Howards/Niederb 2009 15860.00
81249 Ultrasonography in Reproductive Medicine and Rizk 2010 12200.00
Infertility
81294 Environmental Impacts on Reproductive Health and Woodruff et al 2010 8540.00
Fertility
81357 Llewellyn-Jones Fundamentals of Obstetrics and Oats & Abraham 2010 2458.00
Gynaecology International Edition, 9th Edition

81987 HANDBOOK OBS GYN EMERGENCIES 3E PB BENRUBI 2005 5734.00


82003 Handbook for Principles and Practice of Gynecologic LEVINE 2010 3166.00
Oncology
82094 Step by Step Ultrasound in Obstetrics Singh 2010 3109.00
82275 Ginekološka onkologija 6UGMDQ'MXUGMHYLüL9HVQD 2009 5400.00
.HVDLü
108938 Basic Science in Obstetrics and Gynaecology, Phillip Bennett 2010 5733.00
109688 MANUAL GYNECOLOGY OBSTET 4E (INT ED) PB JOHN HOPKINS 2010 4630.00
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman, 2010 3495.00
Sexual Health Richard; Handy, Pauline;
110356 CLINICAL GUIDE FOR CONTRACEPTION 5E PB SPEROFF 2010 5612.00
110418 âWLWDVWDåOH]GDLWUXGQRüD 9RMYRGLü/-LOMDQD% 1999 1296.00
110419 $WODVSRURÿDM 3RþHNRYDF3HWDU 1998 756.00
110420 Fetalni forceps ekstraktor : monografija )ROLü0LURVODYDXWRU 2002 324.00
110421 Atlas ginekološke sonografije 5DGXQRYLü1HERMãD 1991 432.00
110520 Ginekološko akušerski leksikon 1LQNRYLü5DGRVODYDXWRU 2000 486.00
110922 Ginekološko-akušerski leksikon 1LQNRYLü5DGRVODYDXWRU 2006 653.00
111082 Gynaecology, 4th Edition Robert W. Shaw 2010 20130.00
Expert Consult: Online and Print
111650 Urologic Surgery for the Gynecologist and John B. Gebhart 2010 10247.00
Urogynecologist,
111703 Diagnostic Gynecologic and Obstetric Pathology,2ed Christopher P. Crum 2010 21960.00
111714 Fanaroff and Martin's Neonatal-Perinatal Medicine, 9th Richard J. Martin 2010 22082.00
Edition, Diseases of the Fetus and Infant (Expert
Consult - Online and Print) (2-Volume Set)
111865 Savremena ginekologija 'LQXORYLü'XãDQDXWRU 2006 8640.00
L]GDYDþ
112158 Avoiding Common Errors in Obstetrics and Gynecology ROBERTS 2010 3843.00
112159 Breast Pathology: Diagnosis by Needle Core Biopsy, ROSEN 2010 15982.00
31 od 116
3e
112431 Sonography in Obstetrics & Gynecology: Principles and Fleischer ; F; Jeanty 2011 14761.00
Practice
112432 Obstetric Intensive Care Manual, Third Edition Michael R. Foley, Jr., 2010 11589.00
Thomas H. Strong, Thomas
J
113389 Fetal Radiology: A Diagnostic Atlas Reinhard Schumacher, 2011 11334.00
Laurie H. Seaver, Jürgen
Spra
113436 Gestational Diabetes During and After Pregnancy 2010 8499.00
113447 Atlas of Endometrial Histopathology Gisela Dallenbach-Hellweg, 2010 14736.00
Dietmar Schmidt, Friede
114483 High Risk Pregnancy,4 Ed David James 2010 15738.00
114695 Handbook of Obstetric Medicine, Fourth Edition C Nelson-Piercy 2010 6100.00
114740 VULVO-VAGINAL INFECTIONS PB LEDGER 2010 3654.00
115219 100 Q&as About Infertility 2e Gordon 2010 1585.00
115220 Dx/Rx: Sexual Dysfunction in Men and Women Zaslau 2010 3171.00
115225 Dx/Rx: Gynecologic Cancer Dizon 2010 1951.00
115477 Guide de consultation prénatale B. Parmentier, F. Debiève, 2009 5265.00
Pierre Delvoye
115482 120 questions en gynécologie-obstétrique Henri Marret, Jacques 2009 5264.00
Wagner-Ballon, H Guyot
115911 3DWRORJLMDWUXGQRüH 1LQNRYLü5DGRVODYDXWRU 2003 756.00
116016 Obstetrics and Gynecology at a Glance 3e Norwitz E 2010 2683.00
116017 Donald School Ultrasound in Obstetrics and Badreldeen Ahmed 2009 7685.00
Gynecology
116134 EXAM PREP ULTRASOUND ABDOMEN OBS GYN PENNY 2010 5734.00
PB
117562 The Netter Collection of Medical Illustrations: Roger P. Smith 2010 7807.00
Reproductive System,1
118788 The Placenta and Human Developmental Programming Burton et al 2010 7320.00
119325 First Aid for the Obstetrics and Gynecology Clerkship, Matthew S. Kaufman, Latha 2011 1818.00
Third Edition (First Aid Series) Ganti Stead, Jeane Simmo
119621 Infections, Infertility, and Assisted Reproduction Elder/Baker/Ribes 2011 4270.00
119628 Hypertension in Pregnancy Heazell et al 2010 4270.00
119629 Handbook of Fetal Medicine Kumar 2010 3659.00
119870 Imunobiologija genitalnog trakta žena : karakteristike Kataranovski, Milena - autor 2011 1620.00
LPXQVNRJVLVWHPDL]QDþDMXRGEUDQLRGLQIHNFLMD
120082 Atlas kongenitalnih anomalija i oboljenja spoljašnjih 'REDQRYDþNL'XãDQND 2007 756.00
genitalija u razvojnom dobu autor - fotograf
hematologija
165 Bone Marrow Transplantation 2 Ed Shaefer 1996 2560.00
7233 Haematology & Oncology- IE RCP 2003 2440.00
8547 Pocket Atlas of Hematology: Practical Microscopic and Theml 2004 3775.00
Clinical Diagnosis, 2 Ed
18815 Hematologija i transfuziologija -DNãLü/DEDU*UJLþHYLü 1989 3176.00
18824 Transfuzijska medicina *UJLþHYLü 1995 2160.00
18908 Hematologija 0LUD3UHPXåLü/ 2000 2380.00
20718 *sp* Interactions of Blood and the Pulmonary E. Kenneth Weir,Helen L. 2002 900.00
Circulation (American Heart Association Monograph Reeve,John T. Reeves
Series.)
24817 Haematology at a Glance (At a Glance S.),IE Victor HoffbrandiAtul B. 2005 1342.00
Mehta

32 od 116
32097 75$16)8=,-6.$0(',&,1$8./,1,ý.2-35$.6, 'DPLU*UJLþHYLü 2006 4200.00
32125 Transfuziologija Balint Bela 2004 1604.00
36241 Clinical Hematology Neal Young 2006 16714.00
37820 6,'(523(1,ý1$$1(0,-$ 6UÿDQDýXOLü0HOLWD1DNLüL 2006 1400.00
Igor Auer
39733 *sp* WINTROBES CLIN ATLAS HEMATOLOGY TKACHUK 2006 9138.00
43920 Abc of Clinical Haematology Provan 0 3049.00
43950 HANDBK CANCER CHEMOTHERAPY 7E SKEEL 2007 3416.00
47212 *sp* Atlas of Differential Diagnosis in Neoplastic Gorczyca 2004 11590.00
Hematology
55146 Hematology, 5th Edition Basic Principles and Practice Ronald Hoffman 2008 22448.00
(Expert Consult: Online and Print)
55721 Maligne bolesti krvi 0LOLFD'ýRORYLü 1999 1298.00
59893 Haematology: An Illustrated Colour Text Martin R. Howard, Peter J. 2007 3415.00
Hamilton
59934 Color Atlas of Clinical Hematology, 4th Edition A. Victor Hoffbrand 2009 17202.00
Expert Consult - Online and Print

61050 Oxford Handbook of Clinical Haematology, 3 Ed Drew Provan, Charles R J 2009 3125.00
Singer, Trevor Baglin
63646 Hematologija Boris Labar, 2007 4847.00
66474 The Washington Manual Hematology and Oncology WASHINGTON UNIV 2008 2867.00
Subspecialty Consult The Washington Manual
Hematology and Oncology Subspecialty Consult, 2 Ed
66503 Quick Guide to Coagulation Testing Marisa B. Marques, George 2006 2214.00
A. Fritsma
73012 Atlas of Clinical Hematology, 2 Ed Armitage, James 2008 11334.00
73098 BETHESDA HANDBK CLINICAL HEAMATOL 2E PB RODGERS 2009 4026.00
73124 BETHESDA HANDBK CLINICAL ONCOLOGY 3E PB ABRAHAM 2009 3050.00
73150 Wintrobe's Clinical Hematology,2 vol. set GREER 2008 24278.00

81254 The Obstetric Hematology Manual Pavord/Hunt 2010 6100.00


82117 Harrison's Hematology and Oncology Longo 2010 6343.00
82780 IMMUNOHEMATOLOGY PRIN PRACT 3E CB QUINLEY 2010 4752.00
110533 'LMDJQRVWLþNHGLOHPHXKHPDWRORJLMLGLMDJQRVWLþNH 9XNXãLü=YRQLPLUDXWRU 2009 432.00
GLOHPHNOLQLþNLKVLQGURPDUDFLRQDOQDGLMDJQRVWLND
UHãDYDQMHGLMDJQRVWLþNLKGLOHPD
110872 Laboratorijska hematologija : za studente farmacije 0LUROMXE93HWURYLü 2009 972.00
112366 HEMATOLOGY IN CLINICAL PRACTICE HILLMAN 2010 3489.00

119871 +HPLRWHUDSLMVNLSULUXþQLN 0DUMDQRYLü6ORERGDQ 2010 1620.00


autor
hirurgija
173 *sp* Handbook of Endovascular Surgery Ahn, Obrand 1997 350.00
175 *sp* Crucial Controversies in Surgery 1998 Schein 1998 400.00
851 *sp* Clinical Surgery in General 3 Ed Kirk 2000 1450.00
16168 *sp* Atlas of Vascular Surgery Christopher K. ZarinsiBruce 2005 11163.00
L. Gewertz
19594 6895(0(12.,585â.2/,-(ý(1-(78025$ äLYNR*QMLGLüLVXUDGQLFL 2004 2100.00
HIPOFIZE
20128 Surgery Review Illustrated Amit D. Tevar,Rafael 2004 4391.00
Azuaje,Lawrence
Micon,Lawre
23632 *sp* Vascular Surgery,6 Ed Robert Rutherford 2005 20411.00
33 od 116
23632 *sp* Vascular Surgery,6 Ed Robert Rutherford 2005 20411.00
26089 HIGH-YIELD SURGERY 2E- IE NIRULA 2005 1281.00
26432 *sp* Pediatric Surgery, 4th edition Ashcraft 2005 17385.00
26617 ABC KIRURŠKE SVAKIDAŠNJICE -DQNR+DQþHYLüLVXUDGQLFL 2005 4900.00
27859 6-(û$1-$-('12*.,585*$ Mladen Štulhofer 2004 1750.00
31522 KIRURGIJA ZA MEDICINARE 353,û,685$'1,&, 2005 3197.00
34626 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan; 2006 3120.00
Steventon, Nicholas
34756 Churchill's Pocketbook of Surgery 3E - IE Raftery 2006 1638.00
35736 *sp* Vitreous Microsurgery, 4 Edition CHARLES 2006 5500.00
35905 SURGERY OF THE BREAST 2E 2-VOL SPEAR 2005 26230.00
36844 Current Surgical Diagnosis and Treatment-ISE Doherty, Gerard M. 2006 3044.00
37814 ABC KIRURŠKE SVAKIDAŠNJICE 2. dio -DQNR+DQþHYLüLVXUDGQLFL 2006 4900.00
39444 Kompendij neurokirurgije Josip Paladino 2004 1776.00
39620 *sp* COMPLEX & REVISION PROBLEMS IN WARNER 2005 5551.00
SHOULDER SURGERY 2E
39627 *sp* COMPLICATIONS IN SURGERY MULHOLLAND 2005 5246.00
39749 *sp* TEXT MED SURGICAL NURSING 11E (2 SMELTZER 2007 1800.00
42162 HIRURGIJA ZA STUDENTE I LEKARE 'UDJRVODY06WHYRYLü 2000 3456.00
43657 Principles and Practice of Surgery 5e- IE Garden 2007 3005.00
43789 ADVANCED SURGICAL RECALL 3E BLACKBOURNE 2007 2379.00
43991 Medicine & Surgery an Integrated Textbook Lim 2007 6694.00
43993 Essential Surgery International Edition, 4th Edition Burkitt 2007 3141.00
Problems, Diagnosis and Management With STUDENT
CONSULT Online Access
47366 *sp* Surgical Ultrasound Rene Mantke 2006 13766.00
47456 The Physiologic Basis of Surgery J.Patrick O'Leary, Arnold 2007 9760.00
Tabuenca
47504 Sabiston'sTextbook of Surgery 18/e IE Townsend 2007 9837.00
47514 First Exposure to General Surgery ISE Danny Jacobs 2006 1574.00
47863 Medicolegal Reporting in Surgery Jones, Barry J. Jones 1997 11402.00
48324 Medical Devices: Use and Safety Bertil Jacobson 2006 3415.00
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo 2007 14518.00
48887 Minimally Invasive Shoulder and Elbow Surgery Levine William N 2007 28060.00
48904 Atlas of Lift-Laparoscopy: The New Concept of Gasless Kruschinski 2007 15250.00
Laparoscopy
49932 Kirurgija, 1222 str. Tomislav Šoša, Željko 2007 11761.00
6XWOLü=GHQNR6WDQHF
50095 NEUROKIRURGIJA 9ODGLPLU-âLPXQRYLü 2007 5180.00
51730 Underground Clinical Vignettes Step 2: Surgery Sandra I. Kim, Todd A. 2007 1525.00
(Underground Clinical Vignettes: Step 2): Surgery Swanson
(Underground Clinical Vignettes: Step 2)
53192 Pearson's Thoracic and Esophageal Surgery, G. Alexander Patterson 2008 31476.00
54584 Thoracic Surgery Atlas Mark Ferguson 2007 16958.00
55706 +LUXUJLMDRþQHGXSOMH 1164.00
55712 Hirurgija tiroidne i paratiroidnih žlezda 5DGRYDQ-DQNRYLü 2001 909.00
55715 Komplikacije u digestivnoj hirurgiji =RUDQ%*HU]Lü 2000 1947.00
55726 Osnovi neurohirurgije 0LURVODY6DPDUGåLü 1998 584.00
55729 Hirurgija pankreasa 5DGRMH%ýRORYLü 1998 584.00
55738 Hirurgija bilijarnog trakta 5DGRMH%ýRORYLü 1998 519.00
55739 Venski tromboembolizam u hirurgiji 2000 535.00
56573 Illustrated Lecture Notes in Oral and Maxillofacial George Dimitroulis 2008 13176.00
34 od 116
Surgery
56870 KIRURGIJA DOJKE MRVLSIDMGLüLYRGåHSLQD 2006 2479.00
57991 ABC kirurške svakidašnjice 3. dio -DQNR+DQþHYLüLVXUDGQLFL 2008 3500.00
59917 Surgical Techniques in Ophthalmology Series: Teresa C. Chen 2007 11589.00
Glaucoma Surgery: Text with DVD (Surgical
Techniques in Ophthalmology)
59960 Atlas of Minimally Invasive Surgery with DVD Constantine T. Frantzides, 2008 15738.00
Mark A. Carlson
59991 Neurosurgery Practice Questions and Answers Mark Shaya, Remi Nader, 2005 1939.00
Anil Nanda
59994 Operative Neurosurgical Anatomy Damirez Fossett, Anthony J. 2002 10795.00
Caputy
60001 Neurosurgical Intensive Care: The Essentials Javed Siddiqi 2008 6475.00
60140 Advanced Laparoscopic Surgery: Techniques and Tips Namir Katkhouda 2008 17134.00
60189 Fundamentals Of Orthognathic Surgery, 2 Ed Malcolm Harris 2008 7906.00
60729 CLINICAL NEUROSURGERY VOL 54 CB MCKHANN 2007 6832.00
60763 Atlas of Laparoscopic Urologic Surgery (Atlas Of...) Serdar Deger, Jan Roigas, 2007 10370.00
Robert G. Moore
61046 Oxford Handbook of Clinical Surgery (3/e) McLatchie, Greg; Borley, 2007 2750.00
Neil; Chikwe, Joanna
61061 Otolaryngology and Head and Neck Surgery Warner, Giles; Corbridge, 2008 5371.00
Rogan; Martinez-Devesa,
61063 Urological Surgery (Oxford Specialist Handbooks in Reynard, John; Turner, 2008 5315.00
Surgery) Kevin; Mark, Stephen;
Armen
62010 Operative Thoracic Surgery 5 Ed Kaiser 2006 25010.00
62054 Operative Endoscopy and Endoscopic Surgery in Najmaldin, a 2005 21838.00
Infants and Children
62056 Surgery Minitext Lumley et al 2004 2561.00
62098 Hirurgija raka dojke 'äRGLü5DGDQDXWRU 2005 2484.00
62129 +LUXUJLMDRþQHGXSOMH 5RQþHYLü5DGPLOR3 2003 1164.00
autor
63018 Sternberg's Diagnostic Surgical Pathology, 5 Ed MILLS 2009 34892.00
63663 Dermatologic Surgery, Allison Vidimos 2008 7929.00
65974 Urinarne derivacije -RYDQ%+DGåLĈRNLü 2009 2808.00
68936 Surgical Exposures in Orthopaedics: The Anatomic HOPPENFELD 2009 18666.00
Approach, 4 Ed
69212 Abernathy's Surgical Secrets, Alden Harken 2008 4025.00
69598 POVIJEST KIRURGIJE 9LOMDP%LOLü 2009 2800.00
70834 First Aid for the Surgery Clerkship 2ed ISE KAUFMAN 2009 1707.00

71665 Companion to Specialist Surgical Practice Package, Simon Paterson-Brown 2009 60878.00
4th Edition
8-Volume Set

71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Frank Hinman 2008 25132.00
Edition

71831 Gowned and Gloved Surgery: Introduction to Common Robert E. Roses 2009 3171.00
Procedures,
72442 Clinical Research for Surgeons Mohit Bhandari, Anders 2009 9715.00
Joensson
72443 Surgery of Peripheral Nerves: A Case-based Approach Rajiv Midha, Eric I. Zager 2008 10795.00
72450 Intracranial Sterotactic Radiosurgery 2009 16195.00
35 od 116
72457 Functional Neurosurgery (Neurosurgical Operative Phillip A. Starr, Nicholas M. 2008 23755.00
Atlas) Barbaro, Paul S. Lar
72479 An Illustrated Handbook of Flap-Raising Techniques Kartik G. Krishnan 2008 8635.00
72570 Sabiston and Spencer's Surgery of the Chest, 8th Ed -2 Frank Sellke 2010 26230.00
-Volume Set, Expert Consult -Online and Print

72990 Comprehensive Vascular and Endovascular Surgery Hallett, John W. 2009 20618.00
73328 Case Files: Surgery, 3 Ed -ISE Toy 2009 1732.00

74199 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan; 2009 2875.00
(2/e) Steventon, Nicholas
74212 Liver and Pancreatobiliary Surgery Sutcliffe, Robert; 2009 4996.00
Antoniades, Charalambos
Gustav;
74226 Surgical Oncology Chaudry, M Asif; Winslet, 2009 5621.00
Marc Christopher
74376 Paediatric Surgery Davenport, Mark; Pierro, 2009 5621.00
Agostino
74388 Perioperative Medicine (2/e) Chikwe, Joanna; Walther, 2009 4370.00
Axel; Jones, Phil
74778 State-of-the-Art Vaginal Surgery Neerja Goel 2009 15249.00
74787 Atlas of Cataract Surgery K Ravi Kumar Reddy, P. 2009 11711.00
Satyavani
74808 McGraw-Hill Manual Colorectal Surgery Andreas M. Kaiser 2009 5001.00
74809 Step-by-Step Colposcopy, Cryosurgery, and LEEP B Shakuntala Baliga 2009 4635.00
74862 Schwartz's Principles of Surgery, 9 Ed F. Charles Brunicardi, Dana 2009 12200.00
K. Andersen, Timothy R
74984 Operative Oral and Maxillofacial Surgery 2ed John Langdon 2010 26840.00
75868 Hirurgija katarakte %DERYLü6LQLãD 2009 1836.00
76023 Current Diagnosis and Treatment: Surgery 13e -ISE Doherty 2009 4269.00
(LANGE series)
76227 OTORINOLARINGOLOGIJA I KIRURGIJA GLAVE I 9ODGLPLU.DWLü'UDJR 2009 4428.00
VRATA Prgomet i suradnici
76316 Hirurgija ramena 'LNOLü,YDQDXWRU 2009 6156.00
76743 McGraw-Hill Manual Endocrine Surgery Shane Y. Morita, Alan P. B. 2009 6343.00
Dackiw, Martha A. Zei
77940 Colorectal Surgery, Robin K. S. Phillips 2009 9149.00
80939 Abdominalna hirurgija : pitanjanja i odgovori 6HNXOLü6WRMDQ'DXWRU 2006 5400.00
81017 Post-operative Complications (2/e) Leaper, David; Whitaker, 2010 4370.00
Iain
81018 Renal Transplantation Torpey, Nicholas; Moghal, 2010 4996.00
Nadeem E; Watson, Evelyn
81029 Atlas of Cardiac Surgical Techniques, Frank Sellke 2009 20496.00
81031 Carpentier's Reconstructive Valve Surgery, Alain Carpentier 2010 15250.00
81204 Ashcraft's Pediatric Surgery,5 Ed George W. Holcomb 2010 23546.00
81243 Plastic Surgery Secrets Plus,2ed Jeffrey Weinzweig 2010 4269.00
81355 Basic Surgical Techniques International Edition, 6th Kirk 2010 2185.00
Edition

82417 Handbook of Pediatric Surgery 2010 6399.00


82426 Illustrative Handbook of General Surgery Herbert Chen 2009 5664.00
82428 Colorectal Surgery: Living Pathology in the Operating Mark Killingback 2010 8576.00
Room
109947 KIRURŠKA PROPEDEUTIKA, FIZIKALNI ZNAKOVI 0DWLMD+RUåLü 2010 7700.00
36 od 116
110346 Hand Surgery Warwick, David; Dunn, 2009 6246.00
Roderick; Melikyan, Erman;
V
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLþNRWHUDSLMVNL 0LURVODY6DPDUGåLü 2010 1620.00
YRGLþ
111562 Reconstructive Foot and Ankle Surgery: Management Mark S. Myerson 2010 18056.00
of Complications ,2ed
111588 Endovascular Surgery, Wesley S. Moore 2010 19642.00
111593 Atlas of Thoracic Surgical Techniques, Joseph B. Zwischenberger 2010 19642.00
111644 Minimally Invasive Percutaneous Spinal Techniques, Daniel H. Kim 2010 13054.00
112160 SURGERY OF THE BREAST 3E CB SPEAR 2010 40016.00
112257 Textbook of Surgery 3e Tjandra JJ 2005 6099.00
112434 Kuerer's Breast Surgical Oncology Henry Kuerer 2010 18787.00
112507 Lange Current Procedures: Surgery Gerard M. Doherty 2010 7503.00
112643 TEXT MED SURG NURS 12E H/BK (INT ED) PB SMELTZER 2010 3233.00
112931 Aana Advanced Arthroscopy: The Wrist and Elbow, Felix H. Savoie 2010 18056.00
113210 Heart Valve Surgery: An Illustrated Guide Jan Dominik, Pavel Zacek 2010 18138.00
113425 Rapid Surgery 2e Baker CR 2010 2317.00
113761 Modern Surgical Neuropathology with Cd-Rom Miller 2009 15860.00
113944 Colorectal Surgery () MacKay, Graham J; 2010 5371.00
Dorrance, Helen R; Molloy,
Richa
114572 Surgical Instruments, Maryann Papanier Wells 2010 3659.00
115353 DEZINFEKCIJA, STERILIZACIJA I SKLADIŠTENJE -%UOMDN53XODQLü5 2010 840.00
FLEKSIBILNIH ENDOSKOPA I ENDOSKOPSKOG 2VWRMLü6.DOHQLü
PRIBORA
115424 Surgical Management of Spinal Deformities: Expert Thomas J. Errico 2008 19642.00
Consult: Online and Print (Expert Consult Title: Online
+ Print)
115452 Zollinger's Atlas of Surgical Operations 9e ISE Zollinger 2010 15493.00
115912 Barrett-ov jednjak : šezdeset godina kontroverze Peško, Predrag - autor 2010 2160.00
116053 Pelvic Floor Disorders for the Colorectal Surgeon Lindsey, Ian; Nugent, 2010 6246.00
Karen; Dixon, Tony
116140 Vascular and Endovascular Surgery, Jonathan D. Beard 2009 9149.00
116661 Atlas of General Surgery Volker Schumpelick 2009 14035.00
117222 TRANSPLANT INFECTIONS 3E CB BOWDEN 2010 16470.00
117233 Greenfield's Surgery: Scientific Principles & Practice, 5 MULHOLLAND 2010 15982.00
Ed
117452 ADVANCE SURGICAL PATH LUNG CANCER CB CAGLE 2010 10370.00
118437 Churchill's Pocketbook of Surgery, International Edition, Raftery, Delbridge & 2011 1463.00
4th Edition Wagstaff
118504 Ambulantna hirurgija 'UDJRYLü0LODQDXWRU 2006 1112.00
ilustrator
118526 Medical Surgical Nursing Single Vol 8ed Lewis 2011 4147.00
118792 Postgraduate Vascular Surgery Bhattacharya/Stansby 2011 4636.00
histologija i embriologija
986 An Atlas of Histology Zhang 1999 7932.00
6629 Color Atlas of Embryology Drews 1996 3775.00
6633 Pocket Atlas of Cytology, Histology and Microscopic Kuehnel 2003 3775.00
Anatomy, 4th edition
24615 Osnovi histologije, 11. edicija Luiz Carlos Junqueira, Jose 2005 2490.00
Carneiro
24923 *sp* Quality and Risk Management in the IVF Mortimer/Mortimer 2004 900.00
37 od 116
Laboratory
29615 Essentials of Oral Histology and Embryology, 3rd Avery 2006 5489.00
edition, 3rd Edition
30561 Wheater's Functional Histology 5e 2006 2458.00
35727 *sp* HIGH-YIELD EMBRYOLOGY 3E PB DUDEK 2006 600.00
36215 Netter's Atlas of Human Embryology-IE Cochard 2002 2731.00
36224 Color Textbook of Histology , 3rd edition With Leslie Gartner 2006 6099.00
STUDENT CONSULT Online Access
36669 BASIC HISTOLOGY: TEXT & ATLAS, 11 Ed - ISE JUNQUEIRA 2005 2385.00
43783 *sp* BRS: EMBRYOLOGY 4ED Ronald W Dudek 2007 800.00

47495 Netter's Essential Histology, William Ovalle 2007 5977.00


47575 Elsevier's Integrated Anatomy and Embryology Bruce Bogart 2007 3049.00
48526 Theory and Practice of Histological Techniques, 6th John Bancroft 2007 14640.00
edition
49007 Human Preimplantation Embryo Selection Cohen 2007 17690.00
49752 The Developing Human , 8th edition Keith Moore 2007 5855.00
49767 (PEULRORJLMDþRYHNDHG ,YDQ1LNROLüLVDUDGQLFL 2007 1790.00
55129 Histology: An Identification Manual, Robert Tallitsch 2008 4269.00
62321 Histološki atlas, 4 izdanje 9HVQD/DþNRYLü9ODGLPLU 2008 1990.00
%XPEDãLUHYLü
66262 Developing Human SC 8th Moore 2007 3825.00
67137 +LVWRORãNLDWODVWUHüH>RULJLQDOQR@L]GDQMH Berman, Irvin - autor 2006 2160.00
68855 Male Fertility and Infertility Glover/Barratt 2009 3415.00
68863 COLOR ATLAS OF HISTOLOGY 5E GARTNER 2009 4270.00
69017 Langman's Medical Embryology, 11E - IE SADLER 2009 3050.00
69263 Atlas histopatologija %DVWD-RYDQRYLü*RUGDQD 2009 4320.00
autor
69437 Modern Immunohistochemistry Chu 2009 11590.00
71066 Netter's Histology Flash Cards, William K. Ovalle 2007 2927.00
71860 Histology Barry Mitchell 2009 3049.00
An Illustrated Colour Text

76760 Junqueira's Basic Histology: Text and Atlas 12ed ISE MESCHER 2010 2782.00

77853 Embryology, Barry Mitchell 2009 3049.00


77909 Wheater's Review of Histology & Basic Pathology, Kate M. Baldwin 2009 3049.00
83061 Diagnostic Cytopathology, 3 Ed Winifred Gray 2010 26840.00
Expert Consult: Online and Print
109411 EMBRYOLOGY 5E PB BRS (DUDEK) 2010 3044.00
109540 (PEULRORJLMDþRYHNDHG ,YDQ1LNROLüLVDUDGQLFL 2010 1890.00
109702 Histology: A Text and Atlas: With Correlated Cell and ROSS # 2010 4757.00
Molecular Biology, 6/e, International Edition
109884 W.THOMAS SADLER 2009 5460.00
Langmanova medicinska embriologija,10. izdanje
111720 Concise Histology, Leslie P. Gartner 2010 3659.00
112391 Deja Review Histology & Cell Biology, Second Edition Jae W. Song 2010 1585.00
112392 Histology and Cell Biology: Examination and Board Douglas F. Paulsen 2010 3781.00
Review, Fifth Edition (Lange Basic Science)
113215 Osnove nanomedicine : embriologija, farmakologija, 0LOHQD3DSLü2EUDGRYLü 2009 2160.00
nanotehnologija 6X]DQD0LOMNRYLü/LGLMD0
113447 Atlas of Endometrial Histopathology Gisela Dallenbach-Hellweg, 2010 14736.00
Dietmar Schmidt, Friede
38 od 116
Dietmar Schmidt, Friede
114148 Histology and Cell Biology: Examination and Board PAULSEN 2010 3026.00
Review
114322 LWW ILLUS Q&A REV ANATOMY EMBRYOLOGY LAMBERT 2010 3410.00
PB
115237 Osnovi oralne histologije i embriologije James K. Avery, Daniel J 0.00
Chiego
115238 Osnovna i oralna histologija i embriologija 9HVQD/DþNRYLü,YDQ 0.00
1LNROLü9HUD7RGRURYLü
116133 ATLAS HISTOLOGY FUNC CLINICAL CORR PB CUI 2010 5978.00
117235 CELL BIOLOGY & HISTOLOGY 6E PB BRS (GARTNER) 2010 3044.00
imunologija
6627 Color Atlas of Immunology Burmester 2003 1939.00
7213 Immunology at a Glance-IE Playfair 2001 590.00
10357 *sp* Liver Immunology Gershwin; Vierling 2003 5074.00
18941 Imunološko prepoznavanje 0DWNR0DUXãLü 812.00
23608 *sp* Immunobiology Ed6 Janeway/Travers/Walport 0 990.00
25153 IMUNOLOGIJA, 6. dopunjeno i obnovljeno izdanje ,JRU$QGUHLV'UDJR%DWLQLü 2004 4900.00
)LOLSýXOR'DQND*Uþ
30064 Basic Immunology 2 ed - IE Abbas 2006 2868.00
31583 Immunology with STUDENT CONSULT Access, 7th Roitt 2006 3005.00
edition-IE
34609 Immune System E2 Parham 2004 4270.00
35310 Diagnostic Immunohistochemistry, 2nd edition David Dabbs 2006 26718.00
36522 Oxford Handbook of Clinical Immunology and Allergy Spickett, Gavin 2006 2875.00
(2/e)
36651 APPLETON & LANGE OUTLINE REVIEW OF YOTIS 2005 1707.00
MICROBIOLOGY & IMMUNOLOGY, 4 ED - IE
43654 Cellular and Molecular Immunology, 6th Edition Abbas 2007 3415.00
With STUDENT CONSULT Online Access -IE

43781 LIPPINCOTT'S ILLUSTARTED REVIEW: DOAN 2007 2440.00


IMMUNOLOGY

43986 IMMUNOLOGY FOR MEDICAL STUDENTS 2E Nairn 2007 3825.00

47459 USMLE ROAD MAP: IMMUNOLOGY ISE PARMLEY 2006 1299.00

50389 Rapid Review Microbiology and Immunology, Ken Rosenthal 2007 3171.00
55115 Basic Immunology,3 Ed Abul Abbas 2008 5123.00
55740 Neuroendokrinoimunologija 2000 649.00
56891 Insect Immunology, Nancy Beckage 2008 6953.00
59963 Immunology & Serology in Laboratory Medicine, Mary Louise Turgeon 2008 5611.00
60774 Medical Immunology 2007 9150.00
62069 Osnovna imunologija Trece izdanje Abul K. Abbas, Andrew H. 2008 1890.00
Lichtman
66066 Psihoneuroimunologija 0LOLYRM%RUDQLü 2008 3113.00
69437 Modern Immunohistochemistry Chu 2009 11590.00
71064 Medical Microbiology and Immunology Flash Cards, Ken S. Rosenthal 2008 2927.00
Updated Edition,
71796 Basic and Clinical Immunology, 2nd Edition Mark Peakman 2009 4757.00
with STUDENT CONSULT access

74185 Illustrated Dictionary of Immunology 3ed Cruse 2009 7441.00

39 od 116
74190 The Immune System, 3 Ed Parham 2009 5002.00
75971 Cellular and Molecular Immunology,Updated Edition, Abul K. Abbas 2009 3688.00
International Edition, 6th
76886 How the Immune System Works 3e Sompayrac L 2008 2439.00
80568 Basic Immunology Updated Edition, 3rd Edition Abul K. Abbas 2010 5123.00
Functions and Disorders of the Immune System With
STUDENT CONSULT Online Access
81183 IMUNOLOGIJA, 7. obnovljeno i dopunjeno izdanje Milan Taradi 2009 5320.00
109774 REVIEW OF MEDICAL MICROBIOLOGY AND LEVINSON 2010 2751.00
IMMUNOLOGY IE- 11 Ed
111731 Rapid Review Microbiology and Immunology,3ed Ken S. Rosenthal 2010 3171.00
114841 Immunology Hall, Angela; Yates, 2010 3250.00
Christine
115484 ZBIRKA TEST PITANJA IZ FIZIOLOGIJE I 0DWNR0DUXãLü'DQND 2005 1750.00
IMUNOLOGIJE *UþHYLü
116063 Atlas of Immunology, Third Edition Cruse 2010 9393.00
117713 Alergijske i imunološke bolesti -/LSR]HQþLüLVXUDGQLFL 2010 5180.00
119298 Deja Review Microbiology & Immunology, Second Eric Chen, Sanjay Kasturi 2010 1951.00
Edition
119870 Imunobiologija genitalnog trakta žena : karakteristike Kataranovski, Milena - autor 2011 1620.00
LPXQVNRJVLVWHPDL]QDþDMXRGEUDQLRGLQIHNFLMD
infektivne bolesti
239 *sp* The Medical Management of AIDS 6 Ed Sande Sande 1999 900.00
4118 *sp* The Johns Hopkins Hospital 2002 Guide to John G. Bartlett 2001 400.00
Medical Care of Patients with HIV Infection
18865 Sterilizacija i dezinfekcija u medicini 9ODWND%RMLü7XUþLü 1994 700.00
24338 Tuberculosis and Nontuberculosis Mycobacterial Schlossberg 2005 7320.00
Infections
26092 Manual Of Clinical Problems In Infectious Disease, 5 Nelson M. GantziNelson 2005 4209.00
Ed-IE Murray Gantz
26615 1(852,1)(.&,-(3ULUXþQLN Ivan Soldo, Jasmina 2005 1400.00
Timarac

30616 Oxford Handbook of Genitourinary Medicine, HIV and Pattman, Richard 2005 2750.00
AIDS
30826 Hepatitis B Tobias Heintges 2006 2695.00
32282 The Nobel Prize Winning Discoveries in Infectious David Rifkind, Geraldine 2005 3171.00
Diseases Freeman
36277 Colour Atlas of Infectious Diseases, 4th edition Ronald T. Emond 2003 5001.00
55708 Virusne osipne bolesti (OHRQRUD*YR]GHQRYLüL 2001 1272.00
saradnici
55711 ZOONOZE $QWRQLMHYLü%RåLGDU 2001 649.00
55730 Virusni hepatitisi 'UDJDQ'HOLü3UHGUDJ 1998 779.00
1LNROLü0LOHQD%RåLü
59847 Oxford Handbook of Tropical Medicine (3/e) Eddleston, Michael; 2008 2500.00
Davidson, Robert; Brent,
Andre
59850 Oxford Handbook of Expedition and Wilderness Johnson, Chris; Anderson, 2008 3000.00
Medicine Sarah; Dallimore, Jon; W
59949 Feigin and Cherry's Textbook of Pediatric Infectious Ralph D. Feigin, James 2008 32696.00
Diseases: Expert Consult: Online and Print, 2-Volume Cherry, Gail J. Demmler-
Set (Textbook of Pediatric Infectious Disease (Feigin)) Har
62026 Topley and Wilson's Microbiology and Microbial Stefan H E Kaufmann 2007 25498.00
Infections 10e: Immunology
62027 Topley and Wilson's Microbiology and Microbial Brian W J Mahy 2006 127978.00
40 od 116
Infections 10ed Cd Rom
62063 Topley and Wilson's Microbiology and Microbial Brian W J Mahy 2007 38430.00
Infections 10e: Virology 2-Volume Set (incl free Cd)
63673 Manson's Tropical Diseases, International Edition, 22nd 2008 4918.00
Edition
67661 Oxford Handbook of Infectious Diseases and Torok, Estee; Moran, Ed; 2009 3250.00
Microbiology Cooke, Fiona
70089 $OJRULWPLVDYUHPHQHGLMDJQRVWLNHLOHþHQMDLQIHNWLYQLK %UNLü6QHåDQDDXWRU 2009 972.00
EROHVWLXWUXGQRüL
71712 Infection Control and Management of Hazardous Chris H. Miller 2009 4269.00
Materials for the Dental Team, 4th Edition

72989 Mandell, Douglas, and Bennett's Principles and Gerald L. Mandell 2009 32696.00
Practice of Infectious Diseases,7 Ed
76959 .OLQLþNDLQIHNWRORJLMDRGDEUDQDSRJODYOMD]DVWXGHQWH /MLOMDQD.RQVWDQWLQRYLü 2001 648.00
medicine i stomatologije
77129 KOŽNE I SPOLNO PRENOSIVE BOLESTI (VPD+DOHSRYLüĈHþHYLü 2009 1575.00
80990 An Introduction to Infectious Disease Modelling Vynnycky, Emilia; White, 2010 3745.00
Richard
81025 Infectious Diseases: Expert Consult: Online and Print - Jonathan Cohen 2010 22570.00
2 Volume Set
81200 Diagnostic Pathology of Infectious Disease, Richard L. Kradin 2010 15250.00
82011 Case Studies in Pediatric Infectious Diseases Berkowitz 2007 4514.00
82081 Pediatric Practice: Infectious Disease Shah 2009 6221.00
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman, 2010 3495.00
Sexual Health Richard; Handy, Pauline;
110362 Harrison's Infectious Diseases Dennis L. Kasper, Anthony 2010 7563.00
S. Fauci
110417 ,QYD]LYQHJOMLYLþQHEROHVWLXKXPDQRMSRSXODFLML 2009 648.00
110529 +HPRUDJLþQDJUR]QLFDVDEXEUHåQLPVLQGURPRP =RUDQ.RYDþHYLü'UDJDQ 2008 540.00
-RYDQRYLü
111870 Insect Infection and Immunity Rolff, Jens; Reynolds, 2009 4996.00
Stuart
113373 Microbial Zoonoses and Sapronoses Zdenek Hubálek, Ivo Rudolf 2010 17004.00
117222 TRANSPLANT INFECTIONS 3E CB BOWDEN 2010 16470.00
118525 Tuberculosis Schaaf 2009 4391.00
interna medicina
798 *sp* TNM Supplement: A Commentary on Uniform Use, Wittekind, Henson 2001 1784.00
2 Ed
14493 Hypertension Management for the Primary Care 2003 7688.00
Clinician
18823 Beskrvna medicina J.Slipac 2003 2100.00
18880 ,QWHUQLVWLþNDRQNRORJLMD =ULQND0UãLü.UPSRWLü 2004 4900.00
19828 *sp* Practical Guide to Abdominal and Pelvic MRI Leyendecker, John R. 2004 4000.00
20718 *sp* Interactions of Blood and the Pulmonary E. Kenneth Weir,Helen L. 2002 900.00
Circulation (American Heart Association Monograph Reeve,John T. Reeves
Series.)
22073 *sp* Diagnosis of Endometrial Biopsies and Curettings: Kurman, Robert J. 2005 4816.00
A Practical Approach, 2 Ed
24338 Tuberculosis and Nontuberculosis Mycobacterial Schlossberg 2005 7320.00
Infections
24374 Step by Step Wound Healing Sylvie MeaumeiLuc Teot 2005 2195.00
24932 Oxford Handbook of Clinical and Laboratory Drew Provan 2005 2875.00
Investigation (Oxford Handbooks S.)
41 od 116
27218 Interna medicina l i ll (grupa autora, 5.izdanje urednik Dragoljub 2009 5346.00
0DQRMORYLü
27422 Osteoporosis in Focus Neil Ferguson 2004 3837.00
27886 Medical Imaging Renton 2004 3049.00
31731 +DUULVRQRYPHGLFLQVNLSULUXþQLNL]GDQMH Kasper, Braunwald, Fauci, 2005 2700.00
Hauser, Longo, Jameson
34577 Differential Diagnosis in Ultrasound Gunter Schmidt 2005 18355.00
34610 *sp* Oxford Handbook of Clinical Medicine, 7 Ed Longmore, Murray 2007 1500.00
34668 Current Diagnosis and Treatment: Pain - ISE Von Roenn 2006 3715.00

35261 BOARDS & WARDS REVIEW USMLE STEP AYALA 2006 2434.00
35390 Siegenthaler`s Differential Diagnosis in Internal Siegenthaler 2006 11875.00
Medicine - from Symptom to Diagnosis
36290 Cost Effective Diagnostic Imaging, 4th edition Zachary Grossman 2006 4757.00
39625 *sp* Primary Care Medicine: Office Evaluation and GOROLL 2005 2500.00
Management of the Adult Patient,5 Ed
39628 DISEASES 4E SPRINGHOUSE 2005 3288.00
39721 LIPPIN NURSING DRUG GUIDE 2007 KARCH 2006 2190.00
40872 Cecil Essentials of Medicine 7/e sc ISE Andreoli 2007 3688.00
42394 The Osler Medical Handbook, 2nd edition Johns Hopkins Hospital 2006 4513.00
43524 *sp* WASH MAN MEDICAL THERAPEUTICS 32E WASH UNIVERSITY 2007 1200.00
PB
43784 ESSENTIALS OF FAMILY MEDICINE 5E SLOANE 2007 3288.00
43988 Pocket Essentials of Clinical Medicine, International Ballinger & Patchett 2007 1775.00
Edition, 4th Edition
43989 Hutchison's Clinical Methods, 22 Ed - IE Swash 2007 2322.00
43997 Clinical Chemistry Made Easy IE Hughes 2007 955.00
43999 MEDICAL SCIENCES -with STUDENTCONSULT Naish 2009 2731.00
access-IE

47388 FAMILY MEDICINE CERTIFICATION RE LIPSKY 2007 3904.00


47389 Saint Frances Guide Clinical Clerkship in Outpatient BENT 2007 2434.00
Med
47419 Medicine Recall James D. Bergin 2007 1952.00
47420 Taylor's Manual of Family Medicine (Spiral Manual) PAULMAN 2007 2745.00
47463 Last Minute Internal Medicine ISE Miksad, Rebeka 2008 2428.00
47669 Cecil Textbook of Medicine: Expert Consult - Online Goldman 2007 8744.00
and Print, 23 Ed-IE
47836 Oxford Handbook of Clinical Medicine and Oxford Longmore, Murray; 2007 4996.00
Handbook of Medical Sciences Pack Wilkinson, Ian; Turmezei,
Tom; C
48336 Underground Clinical Vignettes Step 2: Internal Sandra I. Kim, Todd A. 2007 2135.00
Medicine I - Cardiology, Endocrinology, Swanson
Gastroenterology, Hematology/oncology (Underground
Clinical Vignettes)
48337 Underground Clinical Vignettes Step 2: Internal Sandra I. Kim, Todd A. 2007 2135.00
Medicine II - Dermatology, Infectious Disease, Swanson
Nephrology, Urology, Pulmonary, Rheumatology,
Allergy (Underground Clinical Vignettes)
49006 Mayo Clinic Internal Medicine Concise Textbook Habermann Thomas M 2007 6710.00
50386 Ultrasound. A Practical Arrroach to Clinical Problems Edward I. Bluth, Peter H. 2007 18355.00
Arger, Carol B. Benson
52986 *sp* Harrison's Principles of Internal Medicine, 17th Anthony S. Fauci, Eugene 2008 7550.00
Edition (Single Vol.) Braunwald, Dennis L. Kasp
42 od 116
53894 *sp* Harrison's Principles of Internal Medicine 17 Rev 2008 8950.00
ed c((2v.))
55098 Physical Exam Health Assesment 5ed IE Jarvis 2008 3278.00

55714 Propedevtika interne medicine ɆɚɧɨʁɥɨɜɢʄȾɪɚɝɨʂɭɛ 2009 950.00


56137 Underground Clinical Vignettes Step 2 Bundle, 4e KIM 2008 10126.00
57312 Netter's Internal Medicine, 2nd Edition Marschall Runge 2008 7929.00
58081 Salivary Diagnostics Wong D 2008 9150.00
59885 Evidence-Based Medical Consultation Daniel Steinberg, Jennifer 2007 4269.00
S. Myers, Chitra Komal
59977 Early Diagnosis and Treatment of Cancer Series: Head Wayne Koch 2008 10979.00
and Neck Cancers (Early Diagnosis in Cancer)
59998 Clinical Examination: With STUDENT CONSULT Owen Epstein, G. David 2008 5733.00
Access Perkin, John Cookson
60735 Mayo Clinic Internal Medicine Review: Eighth Edition 2008 6100.00
(MAYO INTERNAL MEDICINE BOARD REVIEW)
61533 Textbook of Clinical Hemodynamics Michael Ragosta 2008 7807.00
61809 INTERNA MEDICINA, 4 Ed Božidar Vrhovac, Branimir 2008 14700.00
-DNãLüäHOMNR5HLQHU%
62037 Making Sense of Clinical Examination of the Adult Douglas Model 2006 2195.00
Patient: a Hands on Guide
62041 A Textbook of General Practice Second Edition Dr Anne Stephenson 2004 2561.00
62083 ,QWHUQDSURSHGHYWLND)L]LþNDGLMDJQRVWLND $QWLü5DWRPLUDXWRU 2008 1080.00
63505 Klinische Pneumologie Matthys, H.; Seeger, W. 2008 13675.00
(Hrsg.)
64905 INTERNA MEDICINA 'XEUDYNR3HWUDþLVXUDGQLFL 2008 4200.00
65236 Repetitorijum iz interne medicine : podsetnik za ispit Stajic 2005 675.00
65241 Interna medicina : za studente stomatologije %UDQND'DSþHYLüLVDUDGQLFL 2006 1080.00
66272 Kumar and Clark's Clinical Medicine, 7 Ed-IE Kumar 2009 3688.00
66285 Davidson's Essentials of Medicine Innes 2009 1775.00
66411 DEJA REVIEW: INTERNAL MEDICINE -ISE SAADAT 2008 1556.00
66412 HARRISON'S PRINCIPLES OF INTERNAL WIENER 2008 1964.00
MEDICINE, SELF-ASSESSMENT AND BOARD
REVIEW -ISE
66473 A Pocket Manual of Differential Diagnosis 5E PB ADLER 2008 3477.00
66477 Washington Manual General Internal Medicine WASHINGTON UNIV 2008 2867.00
Subspecialty Consult, 2 Ed-ISE
66481 Oxford Handbook of Clinical Medicine and Longmore, Murray; 2008 4996.00
Emergencies in Clinical Medicine Pack Wilkinson, Ian; Turmezei,
Tom; C
66484 Oxford Handbook of Clinical Specialties (8/e) Collier, Judith; Longmore, 2009 2500.00
Murray; Turmezei, Tom;
66485 Oxford Handbook of Clinical Diagnosis (2/e) Llewelyn, Huw; Ang, Hock 2009 2750.00
Aun; Lewis, Keir E; Al-Ab
66488 Davidson's Clinical Cases-IE Mark Strachan 2008 1502.00
66499 Crash Course: History and Examination, John Brain 2008 2927.00
66978 Bates' Guide to Physical Examination and History BICKLEY # 2008 4331.00
Taking
67228 Textbook of Physical Diagnosis with DVD: History and Mark Swartz 2009 7563.00
Examination With STUDENT CONSULT Online
Access, 6 Ed
69019 Ferri's Best Test, Fred F. Ferri 2009 3171.00
69027 Oxford Handbook of Critical Care (3/e)- IE Singer, Mervyn; Webb, 2009 2750.00
Andrew
43 od 116
71281 Macleod s Clinical Examination 12th SC IE Douglas 2009 2185.00
71570 Churchill's Pocketbook of Clinical Practical Procedures Patel & Knight 2009 2805.00
for Junior Doctors
71668 Ferri's Clinical Advisor 2010 Fred Ferri 2009 8295.00
5 Books in 1, Expert Consult - Online and Print

71820 Palliative Medicine-Expert Consult: Online and Print T. Declan Walsh 2008 15372.00

71865 Davidson's Foundations of Clinical Practice, Hazel R. Scott 2009 3415.00


71867 Medical Communication Skills and Law Made Easy, Tsong Kwong 2009 2073.00
71900 Introduction to Renal Therapeutics - First Edition C. Ashley and C. Morlidge 2008 3837.00
72304 Oxford Handbook of Key Clinical Evidence, 1 Ed Harrison, James; Kulkarni, 2009 3250.00
Kunal; Baguneid, Mohame
72311 Oxford Handbook of Gastrointestinal Nursing Norton 2008 2375.00
72434 Interna medicina 6WHYDQ,OLü 2009 3240.00
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed Woodward, Sue; 2009 2870.00
Waterhouse, Catheryne
73011 New Liver Anatomy: Portal Segmentation and the Munemasa Ryu, Akihiro 2009 17571.00
Drainage Vein Cho, Hiroshi Yamamoto
73112 ECG Interpretation: An Incredibly Visual! Pocket Guide SPRINGHOUSE 2009 2434.00
73119 CLINICAL PRACTICE EMERGENCY MED 5E CB WOLFSON 2009 18544.00
73240 BATES POCKET GUIDE PHYS 6E ( INT ED ) PB BICKLEY 2009 2135.00
73321 Case Files: Internal Medicine, 3 Ed - ISE TOY 2009 1732.00

73334 HANDBOOK OF SIGNS & SYMPTOMS 4E PB SPRINGHOUSE 2009 3782.00


74183 Oxford Handbook of Clinical Medicine PDA and Book Longmore, Murray; 2007 4751.00
Pack (7/e) Wilkinson, Ian; Turmezei,
Tom; C
74366 Oxford Handbook of Musculoskeletal Nursing Oliver, Susan 2009 2870.00
74691 CLINICAL CASES IN FLUID AND ELECTROLYTE Geoffrey Couser, Justin 2009 2683.00
BALANCE Walls
76889 Cosmetic Dermatology: Products and Procedures, 1 Ed Draelos Z 2010 18178.00
77017 Mosby's Diagnostic and Laboratory Test Reference,9 Kathleen Deska Pagana 2008 3903.00
Ed
77577 Mosby's Manual of Diagnostic and Laboratory Tests,4 Kathleen Deska Pagana 2009 4147.00
Ed
79276 Davidson's Principles and Practice of Medicine Colledge, Walker & Ralston 2010 3415.00
International Edition, 21st Edition-With STUDENT
CONSULT Online Access

79375 Churchill's Pocketbook of Differential Diagnosis By Raftery, Lim & Ostor 2009 1502.00
International Edition, 3rd Edition

80758 Oxford Handbook of Clinical Medicine (8/e) Longmore, Murray; 2010 2625.00
Wilkinson, Ian; Davidson,
Edward
80840 8OWUD]YXþQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D Guenter Schmidt 2010 7990.00
atlas
81102 Oxford Handbook of Clinical Specialties - Mini edition Collier, Judith; Longmore, 2010 3120.00
(8/e) Murray; Turmezei, Tom;
81239 Mosby's Guide to Physical Examination, Henry M. Seidel 2010 6587.00
81244 Andreoli and Carpenter's Cecil Essentials of Medicine, Thomas E. Andreoli 2010 6343.00
8th Ed, With STUDENT CONSULT Online Access

81354 Andreoli and Carpenter's Cecil Essentials of Medicine, Andreoli, Benjamin, Griggs 2010 4371.00
44 od 116
International Edition, 8th Edition & Wing

81554 8YRGXNOLQLþNXSUDNVXXGåEHQLN]DRVQRYQXQDVWDYX 9HOMNRYLü0LRGUDJDXWRU 2007 1165.00


[za predmet fizikalna medicina i rehabilitacija]
82782 CONCISE REVIEW CLIN LAB SCIENCE 2E PB HUBBARD 2009 4270.00
109326 Clinical Exemination Talley 2010 4371.00
109682 THE ICU BOOK 3E (INT ED) CB MARINO 2010 6094.00
110886 MANUAL LAB DIAGNOST TESTS 8E (INT ED) PB FISCHBACH 2010 2928.00
111707 Atlas of Essential Procedures, Michael Tuggy 2010 7807.00
111767 Ferri's Differential Diagnosis,2ed Fred F. Ferri 2010 2073.00
112350 CURRENT Diagnosis & Treatment in Family Medicine, Jeannette South-Paul, 2011 3659.00
Third Edition (Lange Current Series) Samuel C. Matheny, Evelyn
L.
112551 Laboratory Medicine: The Diagnosis of Disease in the Michael Laposata 2010 5245.00
Clinical Laboratory (Lange Basic Science)
113862 SAPIRAS ART & SCIENCE BEDSIDE DIAG 4E CB ORIENT 2010 8906.00
114161 CURRENT Medical Diagnosis and Treatment 2011 Stephen J. Mcphee, Maxine 2010 6953.00
(Lange Current Series) A. Papadakis, Michael W.
114242 5 MINUTE CLINCAL CONSULT 2011 PACKAGE DOMINO 2010 7564.00
114495 Mosby's Physical Examination Handbook, Henry M. Seidel 2010 3659.00
114593 Mosby's Diagnostic and Laboratory Test Reference, Kathleen Deska Pagana 2010 3903.00
114686 Professional Guide to Signs and Symptoms, 6e SPRINGHOUSE 2010 4331.00
115211 WASH MAN MEDICAL THERAPEUTICS 33E PB WASH UNIVERSITY 2010 3654.00
115218 Comprehensive Pocket Atlas of Hysteroscopy Fried 2010 6465.00
115236 +DULVRQRYSULUXþQLNPHGLFLQH Fauci 0.00
115351 ALGORITMI U GASTROINTESTINALNOJ R. PulaniÊ i suradnici 2010 2100.00
ENDOSKOPIJI I ENDOSKOPSKOM ULTRAZVUKU
115371 NEUROSONOLOGIJA VIDA DEMARIN I DRUGI 5496.00

115483 Médecine interne Johannes-Martin Hahn, 2009 7425.00


Collectif
116058 Examination Medicine, Nicholas J. Talley 2010 5611.00
118440 Evidence-Based Medicine, Sharon E. Straus 2010 3659.00
118676 General Practice Companion Handbook, 5 Ed John Murtagh 2011 6587.00
ishrana
270 *sp* Mini Nutritional Assessment (MNA):Research and Ed Vellas, Garry 1999 6320.00
Practice in the Elderly, vol1
625 Pocket Guide to Micronutrients in Health and Disease Zimmermann 2001 3775.00
807 Burgerstein`s Handbook of Nutrition Zimmermann 2001 7015.00
4206 Molecular Basis of Human Nutri Sanders 2003 3293.00
5001 *sp* Dimesions of Food, 5 Ed Vaclavik Vick 2002 2013.00
10720 Vitamins and Minerals Jane Higdon 2003 5935.00
18845 Kava,droga ili lijek 5RNRäLYNRYLü 1998 1400.00
18850 Dijetetika 5RNRäLYNRYLü 2002 2800.00
19588 VITAMINI I MINERALI 0DULFD0HGLüâDULü 2001 3500.00
21742 Environmentally Friendly Technologies for Agricultural Shimshon Ben-Yehoshua 2005 11834.00
Produce Quality
25371 ADVANCED SPORTS NUTRITION BENARDOT, D 2006 1829.00
25490 Pocket Atlas of Nutrition Hans K. BiesalskiiPeter 2005 3775.00
Grimm
29675 *sp* Food Irradiation Research and Technology Sommers 2006 5795.00
30516 Disordered Eating Among Athletes Beals, Katherine A. 2004 3721.00
45 od 116
36181 Handbook of Clinical Nutrition, 4th edition Douglas Heimburger 2006 4025.00
36188 Williams' Essentials of Nutrition & Diet Therapy, 9th Eleanor Schlenker 2006 6221.00
edition
36520 Oxford Handbook of Nutrition and Dietetics Webster-Gandy, Joan 2006 2500.00
43514 An Evidence-Based Approach to Dietary Jane Higdon 2006 5395.00
Phytochemicals
47956 A Dictionary of Food and Nutrition (2/e) Bender, David A. 2005 1499.00
48436 Nutraceuticals, 2 Ed Brian Lockwood 2007 5118.00
49884 ýXGRWYRUQDKUDQD]DGMHFXVWU 1628.00
50825 Food Allergy Maleki 2006 9455.00
51228 Krause's Food Nutrition & Diet Therapy 12th IE Mahan, L. Kathleen, Escott- 2008 5054.00
Stump, Sylvia
54487 Food and Beverage Management, Bernard Davis 2008 2434.00
54970 Essentials in Food Science (Food Science Text) Vickie A. Vaclavik, 2008 6005.00
Elizabeth W. Christian,
Dennis
59952 Williams' Basic Nutrition & Diet Therapy, 13 ed Staci Nix 2008 4879.00
59953 Mosby's Pocket Guide to Nutritional Assessment and Mary Courtney Moore 2008 3049.00
Care
60539 Eat Well & Keep Moving 2nd Edition Lilian Cheung et al 2007 3909.00
60578 Contemporary Nutrition Gordon M. Wardlaw, Anne 2008 5245.00
M Smith
68988 Introduction to Human Nutrition 2e Gibney M 2009 4575.00
69084 Mycotoxins in Fruits and Vegetables, R. Barkai-Golan 2008 8539.00
69087 Practical Design, Construction and Operation of Food J. Peter Clark 2008 12200.00
Facilities,
70625 ONO SI STO JEDES GILLIAN MCKEITH 2006 1607.00
72460 Chinese Nutrition Therapy: Dietetics in Traditional Joerg Kastner 2009 5395.00
Chinese Medicine (TCM)
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch 2008 1939.00
X. Mayr Intestinal Therapy from Europe
73005 Nutrition and Metabolism: Underlying Mechanisms and 2009 9860.00
Clinical Consequences (Nutrition and Health)
73122 HANDBOOK OF NUTRITION AND KIDNEY 6E PB MITCH 2009 4026.00
73134 Fluids and Electrolytes: An Incredibly Easy! Pocket LWW 2009 2434.00
Guide, 2 Ed
74452 The Cancer Prevention Diet 3rd Ed Kushi, M/Jack,a 2009 1829.00
74508 Nutrition for Health, Fitness & Sport Melvin H Williams 2009 5611.00
76958 Dijetetika = (Nutrition and Dietetics) 0DMD1LNROLü 2008 648.00
80837 Napredna sportska ishrana Dan Benardot 2010 1595.00
81494 Kako lakše i duže živeti sa obolelim srcem : mali 9XþLQLü0LKDLORDXWRU 2010 160.00
SULUXþQLN]DEROHVQLNHLVYHRQHNRMLWRQHåHOHGD
postanu
82392 Nutrition: Science and Applications with Booklet Lori A. Smolin, Mary B. 2010 6465.00
Package, 2 Ed Grosvenor
110363 Clinical Sports Nutrition Louise Burke 2010 5489.00
110870 %LRWHKQRORãNLUHþQLN]DKUDQXLSROMRSULYUHGX A. Zaid, H.G.Hughes, 2007 648.00
E.Porceddu, F.Nicholas, M.
Pl
113528 Nutritional Strategies for the Very Low Birthweight Adamkin 2009 3293.00
Infant
113953 EXERCISE NUTRITION SPECIAL POPULATION PB WILLIAMSON 2010 4209.00
114488 Advancing Dietetics and Clinical Nutrition, Anne Payne 2010 4879.00

46 od 116
114576 Williams' Essentials of Nutrition and Diet Therapy, Eleanor Schlenker 2010 6221.00
114900 Human Nutrition Text and Evolve ebooks Package, Catherine Geissler 2010 5977.00
115474 Manuel de diététique : En pratique médicale courante Albert-François Creff, 2004 5940.00
Daniel Layani
116009 Nutrition and the Cancer Patient Del Fabbro, Egidio; Bruera, 2010 9379.00
Eduardo; Demark-Wahnef
kardiologija i kardiovaskularna medicina
9943 *sp* Clinical Recognition of Congenital Heart Disease, Perloff 2003 11017.00
5th Edition
14493 Hypertension Management for the Primary Care 2003 7688.00
Clinician
17836 *sp* Atlas of Three-Dimensional Echocardiography Nanda 2002 5795.00
18132 Principles Of Exercise Testing and Interpretation WASSERMAN 2004 8540.00
Includig Pathophysiology and Clinical Applications, 4/e

18870 Fibrilacija atrije 'XEURYNR3HWUDþ 1996 1400.00


18877 Pedijatrijska kardiologija,2.dio ,YDQ0DOþLü 2003 3500.00
18878 Pedijatrijska kardiologija ,YDQ0DOþLü 2001 2100.00
18879 .OLQLþNDNDUGLRORJLMD )HGRUýXVWRYLü 1995 7000.00
19590 FETALNA EHOKARDIOGRAFIJA Prenatalna Mladen Miljan 1991 546.00
GLMDJQRVWLNDSULURGQLKVUþDQLKJUHãDND
20574 Introduction to Vascular Ultrasonography,5 Ed William J. Zwiebel 2004 9759.00
20715 *sp* Cardiogenic Shock Hollenberg, Steven M. 2002 5636.00
23632 *sp* Vascular Surgery,6 Ed Robert Rutherford 2005 20411.00
24837 Innovative Management of Atrial Fibrillation David Schwartzman 2005 4819.00
25307 *sp* Cardiology John P. DiMarco,Walter J. 2003 2450.00
Paulus,Michael H. Crawfo
26032 Churchill's Pocketbook of Cardiology 2ed- IE Grubb 2006 1775.00

26086 High-yield Systems: Heart,IE Ronald W. Dudek 2005 1580.00


26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA 67HåDN',YDQþHYLü' 2005 2800.00
'RGLJ,ýLNHã
29595 *sp* Braunwald's Heart Disease Review and Leonard Lilly 2006 1250.00
Assessment, 7th edition
30833 Pocket Atlas of Echocardiography Boehmeke, Doliva 2005 4315.00
31326 Pediatric Cardiology Vetter 2006 6221.00
34745 ECG Complete - IE Bowbrick 2006 1092.00
35705 Mastering Endovascular Techniques: A Guide to LANZER 2006 9760.00
Excellence
36170 Clinical Electrocardiography, 7th edition Ary Goldberger 2006 5611.00
36203 Cardiovascular Physiology, 9th edition Matthew Levy 2006 3415.00
38952 *sp* Hypocretins: Integrators of Physiological Signals 2005 6234.00
40859 Mayo Clinic Cardiology Concise Textbook Third Edition Murphy Joseph G 2006 10370.00
43523 PRACTICAL GUIDE CARDIAC PACING 6E PB MOSES 2007 6100.00
43798 THE HUMAN HEART 2E PHIBBS 2007 3654.00
47407 CARDIOPULMONARY BYPASS 3E Glenn P. Gravlee, Richard 2007 12566.00
F. Davis, Alfred H. Stam
48338 Moss and Adams' Heart Disease in Infants, Children ALLEN 2007 21716.00
and Adolescents: Including the Fetus and Young Adult,
2 Volume Set
48402 Practice of Clinical Echocardiography, 3rd edition Catherine Otto 2007 19642.00
48892 Atlas of Cardiac Nuclear Medicine Jain 2007 14640.00
48916 Cardiovascular Multidetector Ct Angiography Raman 2007 12078.00
47 od 116
48916 Cardiovascular Multidetector Ct Angiography Raman 2007 12078.00
48937 *sp* Cardiovascular Molecular Imaging Gropler Robert J 2007 18666.00
48961 3d Echocardiography Shiota 2007 10370.00
50089 Akutni infarkt miokarda 3URIGU9HOLERU2EUDGRYLü 2007 5500.00
50160 Braunwald's Heart Disease e-dition, 8th edition Peter Libby 2007 26718.00
50227 CLINICAL CARDIAC ELECTROPHYSIOLOGY 4E CB JOSEPHSON 2008 14518.00
51373 Cardiac Surgery in the Adult Lawrence H. Cohn 2007 25497.00
51725 Ultrasonography in Vascular Diseases: A Practical Edward I. Bluth, Philip W. 2007 5395.00
Approach to Clinical Problems Ralls, etc.
51801 Textbook of Interventional Cardiology with Dvd, 5 Ed Eric Topol 2007 21228.00
53765 3UDNWLþQDHOHNWURNDUGLRJUDILMD Mijo Bergovec 1997 3411.00
53854 Pedijatrsijka kardiologija 3 deo ,YDQ0DOþLüLVXUDGQLFL 2008 2100.00
55094 150 ECG problems 2ed IE Hampton 2008 1365.00
55095 The ECG Made Easy 7e IE Hampton 2008 1228.00

55096 The ECG in Practice 5th IE Hampton 2008 1502.00


55134 Braunwald's Heart Disease Review and Assessment, Leonard Lilly 2008 7197.00
56119 Diagnostic Imaging: Cardiovascular, Suhny Abbara 2008 22936.00
58250 Echocardiography Leeson, Paul; Mitchell, 2007 4370.00
Andrew RJ; Becher, Harald
58547 Easy ECG. Interpretation Differential Diagnoses Hans-Holger Ebert 2004 3235.00
59909 Essential Echocardiography Alisdair Ryding 2007 5367.00
59927 Drugs for the Heart, 7th Edition Lionel Opie 2008 5611.00
60137 Cardiovascular MRI: 150 Multiple-Choice Questions Peter G. Danias 2008 6231.00
and Answers (Contemporary Cardiology)
60138 Cardiovascular MRI in Practice: A Teaching File John D. Grizzard, Robert M. 2008 13035.00
Approach Judd, Raymond J. Kim
60402 Meyler's Side Effects of Cardiovascular Drugs (Meylers Jeffrey K. Aronson 2008 4879.00
Side Effects) (Meylers Side Effects)
60612 CARDIOVASCULAR MRI TEACHING MANUAL BIEDERMAN 2007 11834.00
60734 American Medical Association Guide to Preventing and AMA 2008 1707.00
Treating Heart Disease: Essential Information You and
Your Family Need to Know About Having a Healthy
Heart
60765 Mayo Clinic Cardiology Concise Textbook and Mayo Joseph G. Murphy, 2007 12200.00
Clinic Cardiology Board Review Questions & Answers: Margaret A. Lloyd
(Text and Q&A Set)
61533 Textbook of Clinical Hemodynamics Michael Ragosta 2008 7807.00
61719 Kardiomiopatije i disfunkcija srca. Invazivna 6WDPHQNRYLüäLYRMLQM 2008 1944.00
dijagnostika autor
61800 Echocardiographic Anatomy in the Fetus Enrico M. Chiappa, Andrew 2008 14736.00
C. Cook, Gianni Botta
62016 Leg Ulcers 3rd Edition Negus et al 2005 12810.00
62046 Women's Vascular Health Ian a Greer 2006 12078.00
62049 Hyperlipidaemia Third Edition Durrington, P.N. 2007 9150.00
62072 7URPER]DGXERNLKYHQDSURILODNVDLOHþHQMH 0DNVLPRYLüäLYDQ9 1996 149.00
autor
62145 -HGLQD(.*NQMLJDNRMDüHYDPLNDG]DWUHEDWL Malcolm S. Thaler 2009 890.00
62181 (.*SRGVMHWQLNYRGLþ]DLQWHUSUHWDFLMX(.*L DŽouns, Širli A. - autor 2006 1188.00
terapijske protokole
63275 Biomarkers in Heart Disease de Lemos J 2008 7685.00
63644 Atlas transezofagusne ehokardiografije Josip Vincelj 2003 5151.00
63759 Cardiac Pacing and ICDs 5e Ellenbogen K 2008 3903.00

48 od 116
64310 Cardiac Electrophysiology: From Cell to Bedside: Douglas P. Zipes 2009 24522.00
Expert Consult: Online and Print, 5 Ed
66278 Echo Made Easy 2ed IE Kaddoura 2009 1502.00
66477 Washington Manual General Internal Medicine WASHINGTON UNIV 2008 2867.00
Subspecialty Consult, 2 Ed-ISE
66494 Practical Cardiology, Tracey Baker 2008 6465.00
66725 The Washington Manual Cardiology Subspecialty WASHINGTON UNIV 2008 3233.00
Consult 2E -ISE
66729 HANDBK PATIENT CARE VASCULAR DIS 5E PB RASMUSSEN 2008 3782.00
66972 Clinical Arrhythmology and Electrophysiology: a Ziad Issa 2008 15738.00
Companion to Braunwald's Heart Disease,
67138 Kardiovaskularne bolesti,prirucnik )HGRUýXVWRYLü0LMR 2007 1459.00
%HUJRYHF/-LOMDQD%DQILü
68457 Emergencies in Cardiology 2/e Myerson, Saul G.; 2009 2745.00
Choudhury, Robin P.;
Mitchell, A
68819 Nuclear Cardiology: Technical Applications Gary V Heller, April Mann, 2009 6099.00
Robert C. Hendel
68824 Preventive Cardiology Jennings, Catriona; Mead, 2009 2745.00
Alison; Jones, Jennifer;
68852 Fetal Echocardiography Allan/Cook/Huggon 2009 11590.00
69630 Stres i srce 6YHWRPLU36WRåLQLü 2003 1080.00
69633 .OLQLþNDHOHNWURIL]LRORJLMDVUþDQLKDULWPLMDRGPROHNXOD /DPELü,YDQ6DXWRU 1998 2160.00
do postelje
69674 Current Diagnosis & Treatment in Cardiology, 3/e ISE Crawford 2009 3049.00
70822 Hurst's the Heart Manual of Cardiology 12ed ISE O'ROURKE 2009 2898.00

71138 Textbook of Clinical Echocardiography,4 Ed Catherine M. Otto 2009 13054.00


71352 Congenital Heart Disease in Adults, Joseph K. Perloff 2008 14152.00
71585 Cardiology Secrets,3 Ed Glenn N. Levine 2009 4025.00
71609 The Pediatric Cardiology Handbook, 4 Ed Myung K. Park 2009 4147.00
71660 Valvular Heart Disease: A Companion to Braunwald's Catherine M. Otto 2009 14152.00
Heart Disease, 3rd Edition
Expert Consult - Online and Print

71784 Vascular Ultrasound, Abigail Thrush 2009 5489.00


72396 Clinical Cardiac CT: Anatomy and Function Ethan Halpern 2008 12955.00
72473 Cardiac Imaging: A Multimodality Approach Manfred Thelen, Raimund 2009 16195.00
Erbel, Karl-Friedrich Krei
72474 Vascular Imaging (Direct Diagnosis in Radiology: DX- Karl J. Wolf 2009 4855.00
Direct!)
72511 BASIC & BEDSIDE ELECTROCARDIOGRAPHY PB BALTAZAR 2009 6466.00
72622 The ESC Textbook of Cardiovascular Medicine (2/e) Camm, A. John; Luscher, 2009 21884.00
Thomas F.; Serruys, Patric
72988 Paediatric Cardiology, 3rd Ed Expert Consult - Online Robert H. Anderson 2009 24766.00
and Print

72990 Comprehensive Vascular and Endovascular Surgery Hallett, John W. 2009 20618.00
73096 ELECTROPHYSIOLOGY OF ARRHYTHMIAS CB HO 2009 8052.00
73112 ECG Interpretation: An Incredibly Visual! Pocket Guide SPRINGHOUSE 2009 2434.00
73120 The Only EKG Book You'll Ever Need, 6 Ed THALER 2009 2745.00
73507 FEIGENBAUMS ECHOCARDIOGRAPHY 7E CB ARMSTRONG 2009 15982.00
73515 KAPLANS CLINICAL HYPERTENSION 10E CB KAPLAN 2009 8052.00
73537 DUPLEX SCANNING VASCULAR DISORD 4E CB ZIERLER 2009 14518.00
49 od 116
73537 DUPLEX SCANNING VASCULAR DISORD 4E CB ZIERLER 2009 14518.00
73561 PRACTICAL GUIDE FETAL ECHOCARDIO 2E PB ABUHAMAD 2009 10492.00
73630 AUSCULTATION SKILLS BREATH HEART 4E PB SPRINGHOUSE 2009 4514.00
74204 Oxford Handbook of Cardiology and Emergencies in Ramrakha, Punit; Hill, 2009 5621.00
Cardiology Pack (2/e) Jonathan; Myerson, Saul
G.;
74389 Neurovascular Medicine Maiese, Kenneth 2009 10879.00
74390 Adult Congenital Heart Disease Thorne, Sara; Clift, Paul 2009 4746.00
74392 Organ Donation and Transplantation after Cardiac Talbot, David; 2009 9379.00
Death D'Alessandro, Anthony
74695 LANGE Instant Access EKGs and Cardiac Studies Anil M. Patel 2009 2073.00
74697 Physical Examination of the Heart and Circulation Joseph K. Perloff 2009 7319.00
74720 Peripheral Arterial Disease Robert S Dieter, Jr., 2009 9759.00
Raymond A. Dieter, Iii,
Raym
74980 An Introduction to Cardiovascular Physiology Fifth J Rodney Levick 2009 3659.00
Edition
74993 Emergency Cardiology Second Edition Dr. Kareim Ratib 2010 2683.00
75323 Nadas' Pediatric Cardiology, John F. (Barry) Keane 2006 10247.00
75869 .DUGLRORJLMDXUDGXRSãWHPHGLFLQHSRURGLþQH 0LUMDQD/DSþHYLü'DQH 2005 1333.00
medicine äLJLü6X]DQD
6WDQNRYLü'UDJR
76169 .OLQLþNDNDUGLRYDVNXODUQDIDUPDNRORJLMD .DåLü 2009 2700.00
77851 Cases in Adult Congenital Heart Disease Expert Michael A. Gatzoulis 2009 13420.00
Consult: Online and Print,
77916 Fetal Echocardiography, Julia A. Drose 2009 7807.00
79008 Cardiovascular Magnetic Resonance,2ed Warren J. Manning 2010 11833.00
80313 6UþDQHDULWPLMHHOHNWURIL]LRORJLMDNOLQLþNH *UXMLü0LRGUDJDXWRU 2009 2700.00
NDUDNWHULVWLNHGLMDJQRVWLNDOHþHQMH
80793 Vaskularni ultrazvuk %RULV%UNOMDþLü 2010 4900.00
80985 Congenital Heart Defects Wyszynski, Diego; Graham, 2010 10629.00
Thomas; Correa-Villaseno
80987 Cardiovascular Magnetic Resonance Myerson, Saul G.; Francis, 2010 4996.00
Jane; Neubauer, Stefan
81029 Atlas of Cardiac Surgical Techniques, Frank Sellke 2009 20496.00
81289 Core Topics in Transesophageal Echocardiography Feneck/Kneeshaw/Ranucci 2010 8540.00
81361 The Cardiovascular System,2 Ed Alan Noble 2010 3049.00
81493 Oboljenja vena : šta treba znati o venama da bi lakše i 9XþLQLü0LKDLORDXWRU 2010 160.00
duže živeli
81494 Kako lakše i duže živeti sa obolelim srcem : mali 9XþLQLü0LKDLORDXWRU 2010 160.00
SULUXþQLN]DEROHVQLNHLVYHRQHNRMLWRQHåHOHGD
postanu
81821 Echocardiography Pocket Guide: The Transthoracic Bulwer 2010 4513.00
Examination
82415 Noninvasive Peripheral Arterial Diagnosis 2010 3396.00
109419 Knjiga o stresu 6WRåLQLü6YHWRPLU3DXWRU 2009 281.00
109686 Manual of Cardiovascular Medicine, 3e Griffin 2010 6099.00
109703 PATHOPHYS HEART DISEASE 5E (INT ED) PB LILLY 2010 3477.00
109995 Cardiac Anaesthesia Barnard, Matthew; Martin, 2010 4996.00
Bruce
109996 Cardiac Electrophysiology and Catheter Ablation Bashir, Yaver; Betts, 2010 4746.00
Timothy R.; Rajappan, Kim
110342 Pulmonary Arterial Hypertension Handler, Clive; Coghlan, 2010 1749.00
Gerry
110344 Oxford Textbook of Interventional Cardiology Redwood, Simon; Curzen, 2010 11880.00
50 od 116
Nick; Thomas, Martyn R.
110357 Harrison's Cardiovascular Medicine Joseph Loscalzo 2010 5245.00
110751 3UDNWLþQDHOHNWURNDUGLRJUDILMD ,OLü6WHYDQ1DXWRU 2009 1620.00
110875 Tumori srca Rafajlovski, Sašo - autor 2010 3456.00
111588 Endovascular Surgery, Wesley S. Moore 2010 19642.00
111623 Netter's Cardiology,2ed Marschall S. Runge 2010 7929.00
111630 Diagnosis and Management of Adult Congenital Heart Michael A. Gatzoulis 2010 14152.00
Disease,2ed
111645 Heart Failure: A Companion to Braunwald's Heart Douglas L. Mann 2010 12566.00
Disease: Expert Consult - Online and Print, 2 Ed
111647 Acute Coronary Syndromes: A Companion to Pierre Theroux 2010 12566.00
Braunwald's Heart Disease, 2nd Edition
Expert Consult - Online and Print
111722 Dynamic Echocardiography, Roberto M. Lang 2010 15738.00
111766 Cases in Interventional Cardiology, Michael Ragosta 2010 7807.00
112143 INTRODUCTORY GUIDE CARDIAC CATH 2E PB ASKARI / AVILES 2010 5124.00
112144 MANUAL PERIPHERAL VASCULAR INTERVENT CB CASSERLY 2010 10980.00
112373 $5,70,-(8/,-(ý1,ý.2-35$.6, MIJO BERGOVEC I DR 2010 1787.00
112747 Cardiac Imaging [With Access Code] (RadCases) 2010 4855.00
113210 Heart Valve Surgery: An Illustrated Guide Jan Dominik, Pavel Zacek 2010 18138.00
113211 Cardiovascular Critical Care Griffiths M 2010 9149.00
113454 Echocardiography 2009 14736.00
113935 Drugs in Cardiology Kaski, Juan Carlos; 2010 4996.00
Hayward, Carl; Mahida,
Saagar;
113936 Integrative Cardiology DeVries, Stephen; Dalen, 2010 3439.00
James
113937 Heart Disease Chenzbraun, Adrian 2010 1249.00
113938 Hitchhiker's Guide to Internal Medicine Qasim, Atif 2010 3439.00
114013 Practical Handbook of Echocardiography - 101 Case Sun JP 2010 9515.00
Studies
114020 Live/Real Time 3D Echocardiography Nanda NC 2010 20618.00
114024 Pediatric Cardiology 2e Johnson W 2008 5611.00
114350 CARDIOVASCULAR CARE MIE UK EDITION PB CARLINE 2010 3044.00
114590 Braunwald's Heart Disease: a Textbook of Robert O. Bonow 2011 19642.00
Cardiovascular Medicine, Single Volume,
114734 VALVULAR HEART DISEASE PB ANDRUS 2010 3654.00
114843 Hypertension Cheriyan, Joseph; 2009 4746.00
McEniery, Carmel;
Wilkinson, Ian
115018 Cardiac Biomarkers In Clinical Medi Januzzi 2009 5611.00
115063 Cardiology, Alexander Lyon 2010 2561.00
115215 Peripheral Vascular Disease Alonso 2010 2195.00
115222 The Ecg Criteria Book 2e O'keefe 2010 1951.00
115473 Mémo cardio en urgence Frédéric Lapostolle, Jean- 2010 2025.00
Pierre Torres
115580 The ESC Textbook of Intensive and Acute Cardiac Tubaro, Marco; Danchin, 2010 21884.00
Care () Nicolas; Filippatos, Geras
116140 Vascular and Endovascular Surgery, Jonathan D. Beard 2009 9149.00
117451 PRACTICAL CARDIOVASCULAR PATHOLOGY CB BURKE 2010 18422.00
117589 *sp* Braunwald's Heart Disease: A Textbook of Bonow, Mann, Zipes & 2011 9999.00
Cardiovascular Medicine, International Edition, 9th Libby
Edition
51 od 116
Edition
118792 Postgraduate Vascular Surgery Bhattacharya/Stansby 2011 4636.00
119695 Cerebrovaskularne bolesti 6YHWRPLU3,YDQRYLü 2010 7560.00
komplementarna medicina
3776 Massage Therapy: The evidence for practice Grant Jewell Rich 2002 4025.00
10717 Encyclopedia of Remedy Relationships in Abdur Rehman 2003 5935.00
Homoeopathy
10718 The ABC Clinical Guide to Herbs Mark Blumenthal 2003 7555.00
17506 Pocket Guide to Herbal Medicine Karin KraftiChristopher 2004 3775.00
Hobbs
25485 Imagine Homeopathy Kurz 2005 4315.00
26618 $.835(685$,/,356727,6$.3ULUXþQLN Vjenceslav Kiseljak 2005 1750.00
43921 ABC of Complementary Medicine Zollman, Catherine 2007 2439.00
48433 Homeopathic Prescribing Pocket Companion Kayne, Lee R.; Kayne, 2007 2812.00
Steven B.
49953 Velika knjiga prirodnih terapija, 285 str. 1628.00
52008 Complementary Therapies for Physical Therapy Judith Deutsch 2008 4879.00
53819 Homeopathic Practice Edited by Steven B Kayne 2008 4477.00
56142 Massage Therapist's Guide to Pathology WERNER 2008 3166.00
59849 Oxford Handbook of Complementary Medicine Ernst, Edzard; Pittler, Max 2008 3745.00
H; Wider, Barbara; Bod
60047 Color Atlas of Acupuncture: Body Points - Ear Points - Hans-Ulrich Hecker, 2008 3775.00
Trigger Points, 2 Ed (Complementary Medicine Angelika Steveling, Elmar
(Thieme)) Peuk
67763 7LEHWDQVNDPHGLFLQDHKRLVþH]OHFLYLOL]DFLMH 3HWURYLü6UHWHQDXWRU 2007 432.00
71702 Treating Autoimmune Disease with Chinese Medicine, Wanzhu Hou 2009 4879.00
71771 Pediatric Manual Medicine: An Osteopathic Approach Jane Carreiro 2009 4757.00

71778 An Osteopathic Approach to Children,2 Ed Jane Carreiro 2009 5611.00


71780 Botanical Medicine for Women's Health, Aviva Romm 2009 4147.00
71782 A Materia Medica for Chinese Medicine: plants, Carl-Herman Hempen 2009 6099.00
minerals and animal products
71815 The Complete Stems and Branches: Time and Space Roisin Golding 2008 5977.00
in Traditional Acupuncture
71816 Atlas of Shiatsu, Wilfried Rappenecker 2008 3903.00
71888 Complementary and Alternative Medicine (Second Edited by Steven B Kayne 2008 4477.00
edition)
72380 Pocket Atlas of Chinese Medicine Marnae C. Ergil, Kevin Ergil 2009 4315.00
72382 The Patient-Practitioner Relationship in Acupuncture Leon I. Hammer 2008 3235.00
(Complimentary Medicine)
72398 Trigger Points and Muscle Chains in Osteopathy Philipp Richter, Eric Hebgen 2008 7555.00
(Complementary Medicine (Thieme))
72461 Health through Inner Body Cleansing: The Famous F. Erich Rauch 2008 1939.00
X. Mayr Intestinal Therapy from Europe
72463 Lymphedema Management Joachim E. Zuther 2009 6475.00
72559 Introduction to Bioregulatory Medicine Alta Smit, Arturo O\\\'Byrne, 2009 7015.00
Bruno Van Brandt, Iv
73543 MEDICAL ACUPUNCTURE MUSCUL MEDICINE PB COOPER 2009 4026.00
81928 Elektromagnetno polje i biološki sistemi =HþHYLü/XNRYLü7DQMD 2008 1404.00
autor
108893 Lek za sve vrste kancera Klark, Hulda Reger - autor 2009 1296.00
108894 Lek za sve vrste uznapredovalih kancera Klark, Hulda Reger - autor 2009 1296.00
108895 Lek i prevencija za sve vrste kancera (sadrži i dvd) Nataša Koderman 2009 1620.00

52 od 116
110108 Acupuncture in Manual Therapy, Jennie Longbottom 2010 4391.00
111550 Palpation and Assessment Skills, Leon Chaitow 2010 4879.00
112726 The Art of Cupping (Complementary Medicine (Thieme Hedwig Manz 2008 4315.00
Paperback))
113216 Kvantno hologramska medicina : kroz prizmu -RYDQRYLü,JQMDWLü=ODWD 2010 2160.00
akupunkturnih i mikrotalasno rezonatnih (samo) autor
regulatorinih mehanizama
114594 Practice Handbook of Acupuncture, Gertrude Kubiena 2009 5123.00
114596 Chinese Herbal Formulas: Treatment Principles and Yifan Yang 2010 6099.00
Composition Strategies,
115040 Shiatsu Theory and Practice, Carola Beresford-Cooke 2010 6099.00
116651 Yamamoto New Scalp Acupuncture, w. DVD Richard A. Feely 2010 7015.00
119839 Lekovite gljive protiv raka i drugih oboljenja Georgiev, Georgi - autor 2009 432.00
120094 5DNPRåHELWLL]OHþHQVDDORMRPDUERUHVFHQV Nikolaj Kolev 2009 432.00
medicina rada
9932 *sp* Medical Ethics and Law: The Core Curriculum Hope 2003 400.00
18905 Medicinska sociologija Gordana Cerijan 2003 2100.00
18930 Medicina rada 'XQMD'HULWLü6WDKLOMDN 1260.00
19382 Medicina rada i okolisa 2002 7000.00
37823 95612û$0(',&,16.(6.5%, Reuben Eldar 1120.00
73919 Oxford Handbook of Occupational Health Smedley, Julia; Dick, Finlay; 2007 4120.00
Sadhra, Steve
74983 100 Cases in Clinical Ethics and Law Carolyn Johnston 2008 2439.00
PHGLFLQVNLUHþQLFL
8339 9HWHULQDUVNLUHþQLN Nevenka Bjelica 2002 1620.00
18816 5LMHþQLNODWLQVNRJLKUYDWVNRJPHGLFLQVNRJQD]LYOMD Vladimir Loknar 2003 7000.00
19616 HRVATSKO - ENGLESKI I ENGLESKO - HRVATSKI Vlasta Tanay 1999 3500.00
5-(ý1,.0(',&,16.2*1$=,9/-$6,=*292520
3UYLGYRMH]LþQLUMHþQLNPHGLFLQVNRJQD]LYOMD
44278 *sp* Dorland's Illustrated Medical Dictionary 31e Dorland 2007 1999.00
44873 LATINSKE I HRVATSKE MEDICINSKE IZREKE 2007 1750.00
47831 Oxford Dictionary of Sports Science and Medicine (3/e) Kent, Michael 2006 999.00
47956 A Dictionary of Food and Nutrition (2/e) Bender, David A. 2005 1499.00
55090 Dorland's Pocket Medical Dictionary 28e IE Dorland 2008 2185.00

59383 0HGLFLQVNLUHþQLNODWLQVNRVUSVNLLVUSVNRODWLQVNL 0LOH0HGLü 2005 702.00


59962 Medical Terminology: A Short Course Davi-Ellen Chabner 2008 2561.00
65238 More Medical Words You Need Arneri-Georgijev, Jelisaveta 2005 540.00
- autor
67240 Medicinske izreke i poslovice Jovica Lucanin, Budimir 2002 324.00
zdravlje u rukama coveka Pavlovic, Marija Doncev
67759 Engleski za zdravstvene radnike 'UDJRYLü5DGPLODDXWRU 2005 378.00
68283 1D]LYLEROHVWLLSRUHPHüDMDXHQJOHVNRPLVUSVNRP 0LüLü6RILMDDXWRU 2004 756.00
jeziku
68459 Medicinska terminologija - latinski jezik : za studente 0DWLü5DGPLODDXWRU 2006 1296.00
medicine
69090 Dictionary Of Virology Mahy, B 2008 2922.00
69705 9LãHMH]LþNLPHGLFLQVNLUHþQLN /H[LFRQPHGLFXP .RVWLü$OHNVDQGDUĈ 2009 9180.00
polyglottum autor
71645 Medical Terminology Online for Basic Medical Myrna Lafleur Brooks 2009 5123.00
Language (User Guide, Access Code, and Textbook
Package),

53 od 116
71647 Medical Terminology Online for Basic Medical LaFleur Brooks & LaFleur 2009 2805.00
Language (User Guide and Access Code), 3rd Edition Brooks
71653 Basic Medical Language, Myrna Lafleur Brooks 2009 3659.00
74184 Illustrated Dictionary of Biotechnology Arora 2009 4147.00
74185 Illustrated Dictionary of Immunology 3ed Cruse 2009 7441.00
74979 Radiological Sciences Dictionary: Keywords, names David Dowsett 2009 3659.00
and definitions
75828 (1*/(6.2+59$76.,0(',&,16.,5-(ý1,. BRANIMIR JERNEJ 2006 4690.00
SVEZAK I / A-L
(šifra 040214)
114496 Medical Language Instant Translator, Davi-Ellen Chabner 2010 1829.00
114688 Concise Colour Medical Dictionary (5/e) Martin, Elizabeth A. 2010 1749.00
mikrobiologija
4133 *sp* BRS MICROBIOLOGY IMMUNOLOGY 4/E JOHNSON 2001 500.00
4763 *sp* The Springer Index of Viruses Tidona, Darai 2001 15820.00
7215 Medical Microbiology and Infection at a Glance -IE Gillespie 2000 1342.00
7226 Basic Virology- 2 Ed -IE Wagner 2003 2928.00
9517 *sp* The Pathological Protein Yam 2003 2717.00
14468 *sp* Encyclopedia of Virology vol. I,II,III Allan Granoff,Robert G 1999 21197.00
Webster
15911 Molecular Microbiology Laboratory: A Writing-Intensive Ream 2003 2803.00
Course - IE
18825 Medicinska bakteriologija Henrik Weisglass 1994 1582.00
18922 Molekularna biologija u medicini Timothy M.Cox 2000 5600.00
19852 A Dictionary of Virology (3rd Edition) Brian W. J. MahyiBrian 2001 6221.00
Mahy
20889 Bergey's Manual of Systematic Bacteriology : Volume George Garrity 2005 14767.00
2: The Proteobacteria (Part C)
21562 Bergey's Manual of Systematic Bacteriology: Firmicutes 2009 24835.00
v. 3 (Bergey's Manual of Systematic Bacteriology
(Springer-Verlag))
25478 *sp* Bacterial Ion Channels and Their Eukaryotic Kubalski 2005 6618.00
Homologs
26097 Koneman's Color Atlas and Textbook of Diagnostic KONEMAN / WINN 2005 6710.00
Microbiology, 6 Ed
26824 Molecular Basis of Virus Evolution Gibbs/Calisher/Garcia 2005 5490.00
27426 Principles of Molecular Virology (Standard Edition), 4th Cann 2005 4757.00
edition
30874 *sp* Quasispecies: Concept and Implications for E. Domingo 2005 5950.00
Virology
31515 VIRUSNI HEPATITIS 3$/029,û'5$*$1 2004 2125.00
34775 Lecture Notes: Medical Microbiology, 4 Ed - IE Elliott 2006 1647.00
35391 Medical Microbiology Fritz H. Kayser, Kurt A. 2004 4315.00
Bienz, Johannes Eckert
35731 Lippincott's Illustrated Reviews: MICROBIOLOGY 2E CHAMPE/HARVEY 2006 3044.00
36651 APPLETON & LANGE OUTLINE REVIEW OF YOTIS 2005 1707.00
MICROBIOLOGY & IMMUNOLOGY, 4 ED - IE
43808 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
MICROBIOLOGY
43809 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
MICROBIOLOGY
43892 Prescott's Microbiology Willey, Joanne 2007 5489.00
43914 Foundations in Microbiology Talaro, Arthur 2006 4391.00

54 od 116
43984 Bailey & Scott's Diagnostic Microbiology 12E IE Forbes 2007 5054.00

44008 MEDICAL MICROBIOLOGY 17E IE Greenwood 2007 3005.00


48405 Mims' Medical Microbiology, 4th edition Richard Goering 2008 5367.00
48493 Microbial Life 2e Staley et al 2007 5611.00
50389 Rapid Review Microbiology and Immunology, Ken Rosenthal 2007 3171.00
53283 Biotechnology for Beginners Reinhard Renneberg 2007 2434.00
55222 Brock Biology of Microorganisms:International Edition Michael Madigan John 2008 5394.00
12ed Martinko Paul Dunlap David
Cl
55228 Microbiology with Diseases by Body Robert Bauman 2008 5826.00
System:International 2ed
55916 Microbiology: Principles and Explorations,7 Ed (WIE) Black JG 2008 5240.00
56373 Medicinska bakteriologija 0LOHQDâYDELü9ODKRYLü 2008 1188.00
56807 Therapeutic Microbiology: Probiotics and Related 2008 10248.00
Strategies
56877 Chemistry of Fungi 2008 7686.00
59919 Clinical Microbiology and Infectious Diseases: An W. John Spicer 2007 4147.00
Illustrated Colour Text
61379 Basic Virology 3e Wagner EK 2007 4269.00
62026 Topley and Wilson's Microbiology and Microbial Stefan H E Kaufmann 2007 25498.00
Infections 10e: Immunology
62027 Topley and Wilson's Microbiology and Microbial Brian W J Mahy 2006 127978.00
Infections 10ed Cd Rom
62063 Topley and Wilson's Microbiology and Microbial Brian W J Mahy 2007 38430.00
Infections 10e: Virology 2-Volume Set (incl free Cd)
62065 Topley and Wilson's Microbiology and Microbial 2007 610.00
Infections 10e: Cumulative Index
63443 Medical Microbiology, 6 Ed Patrick R. Murray 2008 6099.00
with STUDENT CONSULT Online Access

67661 Oxford Handbook of Infectious Diseases and Torok, Estee; Moran, Ed; 2009 3250.00
Microbiology Cooke, Fiona
69090 Dictionary Of Virology Mahy, B 2008 2922.00
70785 Microbiology:An Introduction: International Edition 10ed Gerard Tortora Berdell 2009 5476.00
Funke Christine Case
71064 Medical Microbiology and Immunology Flash Cards, Ken S. Rosenthal 2008 2927.00
Updated Edition,
73001 Fungi and Food Spoilage John I. Pitt, Ailsa D. 2009 11334.00
Hocking
73595 BRS: MICROBIOLOGY AND IMMUNOLOGY 5/E BRS (JOHNSON) 2009 2928.00

75559 Review of Medical Microbiology and Immunology, 10th Warren Levinson 2008 2439.00
Edition
76341 Sherris Medical Microbiology Ryan 2010 2745.00
76675 Molecular Biotechnology 4e - Principles and Glick BR 2010 10974.00
Applications of Recombinant
DNA
109695 BURTONS MICROBIO HEALTH SCI 9E INT ED PB ENGELKIRK 2010 3415.00
109774 REVIEW OF MEDICAL MICROBIOLOGY AND LEVINSON 2010 2751.00
IMMUNOLOGY IE- 11 Ed
110868 Textbook of Diagnostic Microbiology, 4th Edition Connie R. Mahon 2010 8661.00
111731 Rapid Review Microbiology and Immunology,3ed Ken S. Rosenthal 2010 3171.00
112429 LANGE Flash Cards: Microbiology and Infectious Kenneth D. Somers, 2010 3293.00
55 od 116
Diseases, Second Edition Stephen A. Morse
113314 Jawetz, Melnick & Adelberg's Medical Microbiology BROOKS 2010 2757.00
114776 Schaum's Outline of Microbiology Alcamo 2009 1463.00
116065 Molecular Detection of Human Viral Pathogens Liu 2010 15494.00
119298 Deja Review Microbiology & Immunology, Second Eric Chen, Sanjay Kasturi 2010 1951.00
Edition
molekularna medicina
18922 Molekularna biologija u medicini Timothy M.Cox 2000 5600.00
63445 Molecular Modelling for Beginners 2e Hinchliffe A 2008 4264.00
63497 Biochemistry and Molecular Biology (4/e) Elliott, William H.; Elliott, 2009 3000.00
Daphne C.
69594 ODABRANE METODE MOLEKULARNE BIOLOGIJE 1LYHV3HüLQDâODXVL 2009 1750.00
suradnici
nefrologija
5691 The Kidney at a Glance - IE O'Callaghan; Brenner 2000 1159.00
7235 Nephrology - IE RCP 2003 2440.00
14583 Kidneys, Ureters and Urinary Bladder (Netter Collection Frank H. Netter 2000 6460.00
of Medical Illustrations, Volume 6)
18871 Bubrežna osteodistrofija Ivan Laboš 2004 1836.00
35713 HIGH-YIELD SYSTEMS KIDNEY DUDEK 2006 1464.00
36491 Oxford Handbook of Nephrology and Hypertension Steddon, Simon 2006 2875.00
39734 *sp* DISEASES OF THE KIDNEY 8E SCHRIER 2006 22973.00
55082 Brenner and Rector's The Kidney, 8th Edition Barry Brenner 2007 36966.00
2-Volume Set
55700 Transplatacija bubrega 1307.00
55723 Bolesti bubrega 1999 779.00
60034 Kidney Transplantation: Principles and Practice Peter Morris, Stuart J. 2008 21350.00
Knechtle
61937 /HNDUVNLSULUXþQLNL]GHþMHQHIURORJLMH 3RSRYLü5RORYLü0LODQD 2001 540.00
autor
62170 Transplantacija bubrega 9LãQMD/HåDMLü/MXELFD 2004 1307.00
ĈXNDQRYLü
65971 Biohemijski markeri i diferencijalna dijagnostika u 9XNXãLü=YRQLPLUDXWRU 2008 648.00
QHIURORJLMLYRGLþNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHS
SURWRNROUHãDYDQMHGLMDJQRVWLþNLKGLOHPDSULPHQD
racionalne reanimacije
66437 LANGE INSTANT ACCESS: ACID-BASE, FLUIDS & Reilly 2008 1702.00
ELECTROLYTES
66475 The Washington Manual Nephrology Subspecialty WASHINGTON UNIV 2008 2867.00
Consult, 2Ed
66502 Oxford Handbook of Dialysis (3/e)- IE Levy, Jeremy; Brown, 2009 3000.00
Edwina; Daley, Christine;
Law
66723 MANUAL OF NEPHROLOGY 7E-ISE SCHRIER 2008 3904.00
66724 HANDBOOK NEPHROLOGY & HYPERTENSION 6E WILCOX 2008 3904.00
PB -ISE
70884 Current Essentials of Diagnosis & Treatment in Edger Lerma, Jeffrey Berns, 2009 3294.00
Nephrology & Hypertension 1ed ISE Allen Nissenson

71900 Introduction to Renal Therapeutics - First Edition C. Ashley and C. Morlidge 2008 3837.00
73122 HANDBOOK OF NUTRITION AND KIDNEY 6E PB MITCH 2009 4026.00
74207 Chronic Kidney Disease () El Nahas, Meguid; Levin, 2009 4996.00
Adeera

56 od 116
77448 Bolesti bubrega ĈXNDQRYLü/-XELFDDXWRU 2007 540.00
77867 Primer on Kidney Diseases,5 Ed Arthur Greenberg 2009 6831.00
81360 The Renal System,2 Ed Michael J. Field 2010 3049.00
81986 RENAL ELECTROLYTE DISORDERS 7E PB SCHRIER 2010 6466.00
82089 Harrison's Nephrology and Acid Based Disorders Jameson 2010 6343.00
83025 Pocket Companion to Brenner and Rector's The Michael R. Clarkson 2010 4635.00
Kidney,
110529 +HPRUDJLþQDJUR]QLFDVDEXEUHåQLPVLQGURPRP =RUDQ.RYDþHYLü'UDJDQ 2008 540.00
-RYDQRYLü
111656 Comprehensive Clinical Nephrology, Jurgen Floege 2010 17324.00
neurologija
4088 Handbook of Diagnostic and Therapeutical Spine Alan L. Williams 2002 6221.00
Procedures
4217 Color Atlas of Neuroscience Greenstein 1999 3775.00
4773 *sp* What Your Doctor May Not Tell You About Fox, Barry, Phd; Fox, 2001 400.00
Migraines: The Breakthrough Program That Can Help Barry; Mauskop, Alexander,
End Your Pain
5785 *sp* UCV - Neurology Bhushan 1999 400.00
7208 Neuroscience at a Glance, 2 Ed - IE Barker 2003 1342.00
7351 *sp* Spine Secrets Devlin 2003 1450.00
8538 Illustrated Atlas of the Techniques of Neural Therapy Dosch 2003 10692.00
with Local Anesthetics, 2 Ed
9517 *sp* The Pathological Protein Yam 2003 2717.00
11477 Color Atlas of Neurology Rohkamm 2003 4315.00
13499 The Cranial Nerves Doyon; Francke 2004 4264.00
14576 Nervous System: Anatomy and Physiology (Netter Frank H. Netter 2000 6460.00
Collection of Medical Illustrations, Volume 1, Part 1)
14577 Nervous System: Neurologic and Neuromuscular Frank H. Netter 2000 6460.00
Disorders (Netter Collection of Medical Illustrations,
Volume 1, Part 2)
16747 *sp* Manual of Neurological Therapeutics, 7 Ed - IE Samuels, Martin A. 2004 500.00
18043 *sp* Blood-Spinal Cord and Brain Barriers in Health Hari Shanker SharmaiJan 2003 900.00
and Disease Westman
18872 Osnove smrti moždanog debla Pallis 2002 1120.00
19596 NEUROTRANSMITORI U ZDRAVLJU I BOLESTI =GUDYNR/DFNRYLü 2212.00
20199 *sp* Principles Of Treatment In Parkinson's Disease Anthony H. V. SchapiraiC 2005 3568.00
Warren MD Olanow
20721 *sp* Russell and Rubinstein's Pathology of Tumours of Bigner 1998 900.00
the Central Nervous System 6edition, 2 Volume
23159 *sp* TREATMENT OF EPILEPSY 4E CB WYLLIE 2005 7564.00
24056 *sp* DeJong's the Neurologic Examination Campbell, William W. 2005 3904.00
24214 *sp* MERRITTS NEUROLOGY 11E, IE ROWLAND 2005 5124.00
26615 1(852,1)(.&,-(3ULUXþQLN Ivan Soldo, Jasmina 2005 1400.00
Timarac

27117 Pediatric Neurology, 4th edition Kenneth Swaiman 2006 36234.00


32123 Urgentna neurologija 5DGRMþLü%RULYRMH 2002 389.00
34674 Current Diagnosis and Treatment: Neurology - ISE Brust 2006 3166.00
36082 MERRITTS HANDBOOK OF NEUROLOGY 2 MAZZONI / ROWLAND 2006 3654.00
36216 Lancet Handbook of Treatment in Neurology Warlow 2006 1365.00
36234 Netter's Atlas of Human Neuroscience-IE Felten 2003 2595.00
36512 Oxford Handbook of Neurology Manji, Hadi 2006 3375.00

57 od 116
37592 NEUROTRAUMATOLOGIJA Krešimir Rotim i suradnici 2006 2100.00
38952 *sp* Hypocretins: Integrators of Physiological Signals 2005 6234.00
39726 PARKINSONS DISEASE MOVEMENT DISO JANKOVIC 2006 9150.00
43449 Practical Electrotherapy John Fox 2007 2927.00
43770 MGH MANUAL OF NEUROLOGY 2E FLAHERTY 2007 2928.00
43959 Functional and Molecular Imaging of Stroke and Tsunehiko Nishimura 2006 10799.00
Dementia: Updates in Diagnosis, Treatment, and
Monitoring
43980 Clinical Neuroanatomy and Neuroscience, With FitzGerald 2007 2731.00
STUDENT CONSULT online access,5 Ed - IE

47349 Atlas of Anatomy. Head and Neuroanatomy (Thieme Michael Schünke, Erik 2007 6475.00
Atlas of Anatomy) Schulte, Udo Schumacher
47359 Comprehensive Board Review in Neurology Mark K. Borsody 2006 7555.00
47390 High-yield Brain and Behavior: 4 (High-Yield Systems Barbara Fadem; Edward A. 2007 1281.00
Series): 4 (High-yield Systems) Monaco
47395 Clinical Neurology: From the Classroom to the Exam Jeffrey W. Clark 2007 2623.00
Room
47443 Epilepsy: A Comprehensive Textbook, three volumes Jerome Engel, Timothy A. 2007 28060.00
Pedley, Jean Aicardi
47466 First Exposure to Neurology ISE Kirshner, Howard S. 2007 1964.00
48350 Netter's Concise Neurology, Karl Misulis 2007 3415.00
48374 STROKE A PRACTICAL APPROACH GOMEZ 2007 9516.00
48400 Textbook of Clinical Neurology , 3rd edition Christopher Goetz 2007 14152.00
48895 Neurology Board Review An Illustrated Study Guide Mowzoon Nima 2007 10370.00
49009 Mayo Clinic Medical Neuroscience Fifth Edition Benarroch Eduardo E 2007 6100.00
Organized By Neuro
49902 0RåGDQLNUYRWRNNOLQLþNLSULVWXSVWU 1257.00
49939 Funkcijska anatomija lokomotornog sustava, 600 str. Predrag Keros, Marko 2007 5903.00
3HüLQD
50095 NEUROKIRURGIJA 9ODGLPLU-âLPXQRYLü 2007 5180.00
50827 Imaging of the Nervous System Richard Latchaw 2005 27694.00
51664 Fundamental Neuroscience, Larry R. Squire 2008 7075.00
54458 Cellular and Molecular Neurophysiology,3 Ed Constance Hammond 2008 5977.00
55091 Neurological Examination Made Easy 4e IE Fuller 2008 1775.00
55120 Neonatology: Questions and Controversies Series: Jeffrey Perlman 2008 6831.00
Neurology
55504 Rapid Review Neuroscience, James Weyhenmeyer 2006 3171.00
55718 ,VKHPLþNDEROHVWPR]JD äLYNRYLü0LURVODYDâWHUQLü 2000 714.00
1DGHåGD.RVWLü9ODG
55719 Infekcije nervnog sistema 2000 1103.00
55726 Osnovi neurohirurgije 0LURVODY6DPDUGåLü 1998 584.00
55733 (SLOHSVLMDLHSLOHSWLþNLVLQGURPL 519.00
55737 Povrede i oboljenja perifernih nerava 6DPDUGåLü0LURVODY 1998 584.00
56034 Principles and Practices of Unbiased Stereology Mouton 2002 3111.00
57998 Neurologija za stomatologe Demarin, Trkanjec 2008 2786.00
59049 Peripheral Nerve Blocks, A Color Atlas, 3e CHELLY 2008 6954.00
59941 Essentials of the Human Brain Jack Nolte 2009 3049.00
With STUDENT CONSULT Online Access

59964 Cerebrospinal Fluid in Clinical Practice David N. Irani 2008 12322.00


59974 Brain Imaging, Laurie A. Loevner 2008 4025.00

58 od 116
59991 Neurosurgery Practice Questions and Answers Mark Shaya, Remi Nader, 2005 1939.00
Anil Nanda
59992 Plastic Techniques in Neurosurgery James T. Goodrich, Kalmon 2004 9715.00
D. Post, Ravelo V. Argam
59994 Operative Neurosurgical Anatomy Damirez Fossett, Anthony J. 2002 10795.00
Caputy
60001 Neurosurgical Intensive Care: The Essentials Javed Siddiqi 2008 6475.00
60039 Atlas of Spine Trauma with CD-ROM: Adult & Pediatric Daniel H. Kim, Steven C. 2008 22082.00
Ludwig, Alexander R. Vacc
60548 BASIC CLINICAL NEUROSCIENCE 2E PB YOUNG 2007 2745.00
60617 WEINER AND LEVITTS NEUROLOGY 8E PB RAE-GRANT 2008 2928.00
60729 CLINICAL NEUROSURGERY VOL 54 CB MCKHANN 2007 6832.00
60758 Mayo Clinic Essential Neurology 2008 6100.00
61120 Greenfield's Neuropathology Eighth Edition 2-Volume Prof Seth Love 2008 35136.00
Set
61716 1HXURORãNLSUHJOHGLRVQRYLNOLQLþNHQHXURORJLMH 5DGRMLþLü%RULYRMH0 2006 1080.00
autor
61725 .OLQLþNDQHXURORJLMD 5DGRMLþLü%RULYRMH0 2006 1944.00
autor
61995 /HþHQMHHSLOHSVLMH 0DUWLQRYLüäDUNRDXWRU 2005 2268.00
62032 Computer Aided Tomography Case Histories of the Dr Karthikeyan 2005 10370.00
Brain
62034 Russell & Rubinstein's Pathology of Tumors of the Mclendon et al 2006 28060.00
Nervous System, 7th Edition
62042 Dementia 3rd Edition Alistair Burns 2005 19215.00
62051 Adams and Graham's Introduction to Neuropathology, Professor D I Graham 2006 7015.00
Third Edition
62057 Oppenheimer's Diagnostic Neuropathology 3rd Edition Margaret Esiri 2006 21350.00
63666 Stroke Part I: Basic and epidemiological aspects,92 Marc Fisher 2008 17324.00
63667 Stroke Part Ii: Clinical manifestations and Marc Fisher 2008 17324.00
pathogenesis,93
63668 Stroke Part Iii: Investigation and management,94 Marc Fisher 2008 17324.00
65427 EXPERT DIFF DIAG: BRAIN SPINE AMIRSYS CB OSBORN 2008 26718.00
65660 Sensation and Perception Wolfe et al J. 2009 5123.00
65922 .OLQLþNDQHXURRWRORJLMD Haralampiev, Kiril - autor 2007 4320.00
65934 Neurološki simptomi i sindromi u psihijatriji 9HOLþNRYLü$OHNVDQGDU 2007 972.00
autor
65984 Urgentna stanja u neurologiji 9HOLþNRYLü$OHNVDQGDU 2008 1080.00
autor
66066 Psihoneuroimunologija 0LOLYRM%RUDQLü 2008 3113.00
67028 PEDIJATRIJSKA NEUROLOGIJA 1LQD%DULãLüLVXUDGQLFL 2009 16800.00
68251 Multiplaskleroza $]UD.XUWRYLü$ODMEHJRYLü 2005 1512.00
68275 Cerebrovaskularne bolesti Milan Arbutina 2007 2160.00
68518 Adams and Victor's Principles of Neurology, 9 Ed - IE Allan H. Ropper, Martin A. 2009 7930.00
Samuels
68844 Community Treatment of Drug Misuse: More Than Seivewright 2009 4270.00
Methadone
68846 Fetal and Neonatal Brain Injury, 4 Ed Stevenson et al 2009 11590.00
68869 BLUEPRINTS NEUROLOGY 3E PB DRISLANE 2009 3111.00
69593 NEUROLOGIJA za medicinare Vesna Brinar i suradnici 2009 6860.00
69675 Clinical Neurology 7e ISE Simon 2009 2867.00
69930 The Human Brain, 6th Edition John Nolte 2008 5855.00
An Introduction to its Functional Anatomy With
59 od 116
STUDENT CONSULT Online Access

70092 .OLQLþNDHOHNWURPLRQHXURJUDILMD 3HULü=RUDQäDXWRU 2003 864.00


70096 Funkcionalna i topografska neuroanatomija 0DULQNRYLü6ORERGDQ 1998 1620.00
autor
70097 Diferencijalna dijagnoza u neurologiji 9UDQMHãHYLü'XãDQDXWRU 2004 2160.00
70098 Neurokutana oboljenja 9UDQMHãHYLü'XãDQDXWRU 1998 1296.00
70295 .OLQLþNDHOHNWURHQFHIDORJUDILMD 0DUWLQRYLüäDUNRDXWRU 2009 2484.00
70885 Case Files: Neuroscience 1ed ISE TOY 2009 2068.00

70895 Neurology: PreTest Self-Assessment & Review 7ed ANSCHEL 2009 1574.00
ISE

71001 Osnovi savremene neurologije /HYLü=YRQLPLUDXWRU 2009 1307.00


71572 Sleep Disorders Medicine, 3rd Edition Sudhansu Chokroverty 2009 15738.00
Basic Science, Technical Considerations, and Clinical
Aspects, Expert Consult - Online and Print

71596 Clinical Neurotoxicology: Syndromes, Substances, Michael R. Dobbs 2009 14762.00


Environments, Expert Consult - Online and Print

71610 Clinical Pediatric Neurology, 6th Ed- A Signs and Gerald Fenichel 2009 9393.00
Symptoms Approach: Expert Consult - Online and Print

71699 Headache, Orofacial Pain and Bruxism -Diagnosis and Peter Selvaratnam 2009 5367.00
multidisciplinary approaches to management
72401 Decision Making in Neurocritical Care Frontera, Jennifer A. 2009 5395.00
Frontera
72450 Intracranial Sterotactic Radiosurgery 2009 16195.00
72451 Neuro-Ophthalmology Illustrated Valerie Biousse, Biousse, 2009 7555.00
Valrie Biousse
72452 Movement Disorder Surgery: The Essentials Roy A. E. Bakay 2008 14035.00
72457 Functional Neurosurgery (Neurosurgical Operative Phillip A. Starr, Nicholas M. 2008 23755.00
Atlas) Barbaro, Paul S. Lar
72458 Photo Atlas of Skull Base Dissection: Techniques and Masahiko Wanibuchi, Allan 2008 22675.00
Operative Approaches H. Friedman, Takanori Fu
72476 Atlas of Brain Function William W. Orrison 2008 7555.00
72529 CLINICAL NEUROANATOMY FOR MEDICAL SNELL 2009 3294.00
STUDENTS, 7E-IE
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed Woodward, Sue; 2009 2870.00
Waterhouse, Catheryne
73128 ESSENTIAL FORENSIC NEUROPATHOLOGY CB TRONCOSO 2009 14518.00
73591 MERRITT'S NEUROLOGY 12E CB ROWLAND 2009 10614.00
74197 The Handbook of Clinical Neuropsychology (2/e) Gurd, Jennifer; Kischka, 2009 8128.00
Udo; Marshall, John
74206 Stroke Medicine Markus, Hugh; Pereira, 2009 5371.00
Anthony; Cloud, Geoffrey
74227 Migraine and Headache Mauskopp, Alex 2009 1749.00
74378 Epilepsy Alarcon, Gonzalo; Nashef, 2009 5621.00
Lina; Cross, Helen; Nigh
74389 Neurovascular Medicine Maiese, Kenneth 2009 10879.00
74391 Deep Brain Stimulation Bain, Peter; Aziz, Tipu; Liu, 2009 3120.00
Xuguang; Nandi, Dipa
74785 Manual of Neuro-Ophthalmology Amar Agarwal, Athiya 2009 5977.00
Agarwal
60 od 116
76724 Fiziologija centralnog nervnog sistema 0LODQRYLü=YH]GDQ 2009 1080.00
76960 1HXURORãNLSUHJOHG>SULUXþQLN]DUDGXQHXURORJLML@ 6WDPHQRYLü-HOHQDDXWRU 2008 378.00
L]GDYDþ
77296 MANUAL NEUROLOGIC THERAPEUTICS 8E PB SAMUELS 2010 4269.00
77880 Neurology Secrets,5ed Loren A. Rolak 2010 4025.00
80315 Kompjuterizovana tomografija centralnog nervnog 6DQMD6WRMDQRYLü 2007 3564.00
sistema
80998 Management of Early Parkinson's Disease Pahwa, Rajesh; Lyons, 2010 874.00
Kelly
81000 Parkinson's Disease Simuni, Tanya; Pahwa, 2010 2000.00
Rajesh
81927 Neuronauke : u susret novom milenijumu 2006 702.00
81996 Neuroradiology,3 Ed David M. Yousem 2010 7929.00
82082 Pediatric Practice: Neurology Carney 2010 7441.00
82697 NEUROLOGY FOR THE NON-NEUROLOGIST 6E PB WEINER 2010 5978.00
82789 Dijagnoza epilepsija Krämer, G. 2010 2205.00
83057 Movement Disorders in Childhood, Harvey S. Singer 0 7807.00
109944 DISPRAKSIJA Geoff Brookes 2010 1680.00
110083 Neurology, 3rd Edition Geraint Fuller 2010 3659.00
An Illustrated Colour Text
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLþNRWHUDSLMVNL 0LURVODY6DPDUGåLü 2010 1620.00
YRGLþ
110856 Harrison's Neurology in Clinical Medicine, Second Stephen Hauser, Scott 2010 5245.00
Edition Andrew Josephson
110871 Neuromuskularna sinapsa 'UDJLü6ORERGDQDXWRU 2009 648.00
L]GDYDþ
111208 Fundamentals of Computational Neuroscience (2/e) Trappenberg, Thomas 2009 4370.00
111560 Neuroanatomy, Alan R. Crossman 2010 3659.00
111638 Neuromuscular Disorders, Tulio E. Bertorini 2010 14884.00
111772 Neurology and Neurosurgery Illustrated, International Lindsay, Bone & Fuller 2010 2195.00
Edition, 5th Edition
112163 POCKET NEUROLOGY SP GREER 2010 4264.00
112430 Deja Review Neuroscience, Second Edition Matthew Tremblay 2010 1951.00
112695 *sp* SKRIVENA SNAGA Ljiljana Trkulja 2010 1008.00
112717 Spine and Spinal Cord Trauma: Evidence-Based Jerome Ed. Vaccaro 2010 19435.00
Management
113760 Transient Ischemic Attack and Stroke Pendlebury/Giles/Rothwell 2009 4636.00
113761 Modern Surgical Neuropathology with Cd-Rom Miller 2009 15860.00
114919 Functional Magnetic Resonance Imaging Huettel S. 2009 7075.00
114927 Sensation, Perception and ActionAn Evolutionary Zanker J. 2010 3049.00
Perspective
115208 TAJNE MOZGA Amir Muzur 2010 1820.00
115352 %2/X]URFLLOLMHþHQMH 0-XNLü90DMHULü.RJOHU 2010 4200.00
M. Fingler
115371 NEUROSONOLOGIJA VIDA DEMARIN I DRUGI 5496.00

117423 *ODYREROMHNODVLILNDFLMDLOHþHQMH 0DUWLQRYLüäDUNRDXWRU 2006 1620.00


118946 IKONOKLAST G. Berns 2010 2210.00
119695 Cerebrovaskularne bolesti 6YHWRPLU3,YDQRYLü 2010 7560.00
nuklearna medicina
10371 *sp* Nuclear Medicine Annual 2003 Leonard, M., Md. Freeman 2003 400.00
18937 .OLQLþNDQXNOHDUQDPHGLFLQD 'DUNR,YDQþHYLü 2240.00
61 od 116
26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA 67HåDN',YDQþHYLü' 2005 2800.00
'RGLJ,ýLNHã
35997 Practical Nuclear Medicine, 3 Ed P. F. Sharp, H. G. Gemmell, 2005 9066.00
A. D. Murray
43958 Diagnostic Imaging: Nuclear Medicine Kathryn Morton 2007 22936.00
48892 Atlas of Cardiac Nuclear Medicine Jain 2007 14640.00
50170 Clinical Nuclear Medicine Fourth Edition Gary J R Cook 2006 18605.00
68288 Nuklearna medicina : metodologija i klinika %RJLüHYLü0RPþLORDXWRU 2007 2160.00
81185 NUKLEARNA MEDICINA ''RGLJ'+XLü0 2009 1750.00
XGLMDJQRVWLFLLOLMHþHQMXEROHVWLNRVWLMXL]JORERYD Poropat; S. Težak
oftalmologija
827 *sp* Intraocular Lenses in Cataract & Refractive Azar 8241.00
Surgery
8169 *sp* Opthalmic Drug Delivery Systems (Drugs and the Ashim K. Mitra 2003 11993.00
Pharmaceutical Sciences, 130)
9739 *sp* Diseases of the Orbit: A Multidisciplinary Approach Jack, Md. Rootman 2002 8589.00
10438 .OLQLþNDRIWDOPRORJLMDHGLFLMDSUHYRG Jack J. Kanski 2004 10700.00
20124 Ophthalmology: Just the Facts John LoewensteiniScott 2003 4391.00
Lee
20720 *sp* Refractive Eye Surgery Bores, Leo D. 2001 6832.00
21718 *sp* Management of Cataracts and Glaucoma Anne Louise ColemaniJohn 2004 7533.00
Morrison
21741 *sp* Glaucoma Surgery TROPE 2005 8723.00
31334 *sp* THE MASSACHUSETTS EYE AND EAR JAGER 2005 3233.00
INFIRMARY REVIEW MANUAL FOR
OPHTHALMOLOGY 3E
35529 Pocket Atlas of Ophthalmology Torsten Schlote, Jens M. 2006 3775.00
Rohrbach, Matthias Grüb
35537 OPHTHALMOLOGY : A POCKET TEXTBOOK ATLAS Lang, Gerhard Klaus 2006 4315.00
2 Rev ed
36193 Contact Lenses, 5th edition Anthony Phillips 2006 18056.00
43655 Clinical Opthalmology 6th Kanski 2007 8334.00
43656 Essentials of Ophthalmology, Neil J. Friedman 2007 5123.00
43659 Eye Essentials: Rigid Gas-Permeable Lens Fitting, Andrew Franklin 2006 2683.00
43661 Roy and Fraunfelder's Current Ocular Therapy,, 6th F. Hampton Roy 2007 13786.00
Edition
43943 EVIDENCE BASED EYE CARE KERTES 2006 6466.00
45561 Clinical Ophthalmology , 6th edition Jack Kanski 2007 20008.00
48036 BASIC OPHTHALMOLOGY FOR MEDICAL BRADFORD 2004 4318.00
STUDENTS AND PRIMARY CARE RESIDENTS-8TH
ED
48371 Eyelid, Conjunctival, and Orbital Tumors and Jerry A. Shields, Carol L. 2007 27938.00
Intraocular Tumors: An Atlas and Text 2vol 2e Shields
48940 *sp* Age-Related Macular Degeneration Second Lim Jennifer I 2007 18666.00
Edition
52562 Clinical Ocular Pharmacology, 5th edition Jimmy Bartlett 2007 10979.00
53255 Pdr 2008 Pdr for Ophthalmic Medicines Pdr 2008 5124.00
55084 The Eye: Basic Sciences in Practice John Forrester 2007 10003.00
55717 'LMDEHWLþNDUHWLQRSDWLMD Misita R. Vasilije 2000 779.00
55728 Tumori oka /LWULþLQ2OJD 1998 779.00
55731 .OLQLþNDQHXURRIWDOPRORJLMD 6WHIDQRYLü%UDQNR3LãWHOMLü 1997 519.00
'XãDQ.UVWLü6WRMDGLQ
59907 Eye Essentials: Cataract: Assessment, Classification Raman Malhotra 2007 2683.00
62 od 116
and Management (Eye Essentials)
59911 Rapid Diagnosis in Ophthalmology Series: Retina Adam Rogers, Jay S. Duker 2007 6099.00
(Rapid Diagnoses in Ophthalmology)
59912 Rapid Diagnosis in Ophthalmology Series: Lens and Joel S. Schuman, Viki 2007 5611.00
Glaucoma (Rapid Diagnoses in Ophthalmology) Christopoulos, Deepinder K.
59917 Surgical Techniques in Ophthalmology Series: Teresa C. Chen 2007 11589.00
Glaucoma Surgery: Text with DVD (Surgical
Techniques in Ophthalmology)
59948 Eye Essentials: Environmental & Occupational Gordon Carson 2008 2683.00
Optometry (Eye Essentials)
59971 Ocular Pathology Text with DVD-ROM Myron Yanoff, Joseph 2008 27572.00
William Sassani
60033 Law and Ethics for the Eye Care Professional Barbara K. Pierscionek 2008 3415.00
61714 Oftalmologija univerzitet u Beogradu 2009 1080.00
medicinski fakulte
62129 +LUXUJLMDRþQHGXSOMH 5RQþHYLü5DGPLOR3 2003 1164.00
autor
63665 Ophthalmology, 3 Ed -IE Yanoff 2008 16533.00
67313 CLINICAL MANUAL OF CONTACT LENSES 3E PB BENNETT 2008 6954.00
68058 Oxford Handbook of Ophthalmology (2/e) Denniston, Alastair K. O.; 2009 4120.00
Murray, Philip I.
68831 Training in Ophthalmology Sundaram, Venki; Barsam, 2009 6246.00
Allon; Alwitry, Amar; Kha
71666 Ophthalmology, 3rd Edition Mark Batterbury 2009 3415.00
An Illustrated Colour Text

71785 Crash Course: Ophthalmology, Dermatology, Ent, Seau-Tak Cheung 2009 2927.00
72451 Neuro-Ophthalmology Illustrated Valerie Biousse, Biousse, 2009 7555.00
Valrie Biousse
72464 Ophthalmic Surgical Procedures Peter S. Hersh, Bruce M. 2009 12955.00
Zagelbaum, Sandra Lora Cr
74214 Diabetes and Ocular Disease (2/e) Scott, Ingrid U.; Flynn, 2009 6878.00
Harry W.; Smiddy, William
74785 Manual of Neuro-Ophthalmology Amar Agarwal, Athiya 2009 5977.00
Agarwal
74787 Atlas of Cataract Surgery K Ravi Kumar Reddy, P. 2009 11711.00
Satyavani
75868 Hirurgija katarakte %DERYLü6LQLãD 2009 1836.00
76753 Oculoplasty and Reconstructive Surgery (25 Natural Jes Mortensen, Essam El 2009 5977.00
Ways Series) Touhky, Ranjit S. Dhaliwa
76956 Fiziologija oka $QND6WDQRMHYLü3DRYLü 2008 2511.00
76957 Uveitisi $QND6WDQRMHYLü3DRYLü 2008 2997.00
77290 Surgical Techniques in Ophthalmology Series: John A. Long 2009 11467.00
Oculoplastic Surgery,
77874 The Massachusetts Eye and Ear Infirmary Illustrated Neil J. Friedman 2009 6587.00
Manual of Ophthalmology ,
80935 6XGVNRPHGLFLQVNRYHãWDþHQMHXRIWDOPRORJLML -RYDQRYLü0LORãDXWRU 2007 702.00
82024 Ocular Inflammatory Disease and Uveitis Manual: HUANG 2010 6100.00
Diagnosis and Treatment
83056 Uveitis, Robert B. Nussenblatt 2010 13664.00
83059 Ocular Disease: Mechanisms and Management, Leonard a Levin 2010 9637.00
108892 'LMDJQRVWLNDLSUDüHQMHEROHVWLPDNXOHPHWRGRPRSWLþNH 3DRYLü-HOHQDDXWRU 2008 3240.00
koherentne tomografije
109193 Zelena mrena : (glaucom) 3DMLü'XãDQDXWRU 2007 1728.00
L]GDYDþ
63 od 116
L]GDYDþ
109197 2þQRGQR IXQGXVRFXOL 3DMLü'XãDQDXWRU 2008 3240.00
L]GDYDþ
109692 Wills Eye Manual, 5e Ehlers/ Shah 2010 6094.00
111831 Fundoscopy Made Easy, International Edition Ghosh, Collier, Varikkara & 2010 1097.00
Palmer
112556 Lens Diseases (Instant Clinical Diagnosis in Gian Maria Cavallini, Arturo 2010 5977.00
Ophthalmology) Perez Arteaga, Boris
114486 Contact Lens Practice, Nathan Efron 2010 12078.00
114490 The Contact Lens Manual, Andrew Gasson 2010 7075.00
116739 $QDWRPLMDRNDVDSULORJRP]DDQDWRPLMXL]SRGUXþMD 3DMLü'XãDQDXWRU 2007 2700.00
neurooftalmologije L]GDYDþ
onkologija
7233 Haematology & Oncology- IE RCP 2003 2440.00
7652 *sp* Histopathology of Non-Hodgkin's Lymphomas Feller; Diebold 2004 14510.00
(Based on the Updated Kiel Classification)
8214 *sp* Carcinogenicity: Testing, Predicting, and Kirk T. Kitchin 1999 900.00
Interpreting Chemical Effects
10382 *sp* Radiotherapy for Head and Neck Cancer: Adam S., Md Garden, K. 2002 3500.00
Indications and Techniques Kian Ang, Gardem Adam S
16485 *sp* Benign Breast Diseases: Radiology-Pathology- Catherine N. Chinyama 2004 4816.00
Risk Assessment
18873 /LMHþHQMHUDNDMDMQLND Damir Eljuga 2003 2100.00
18880 ,QWHUQLVWLþNDRQNRORJLMD =ULQND0UãLü.UPSRWLü 2004 4900.00
18924 Karcinogeneza 0LOLYRM%RUDQLü 2916.00
19599 RAK PROSTATE Mirko Samija 2002 3500.00
20725 *sp* TUMORS SOFT TISSUES 2ed DASGUPTA DHURI 1998 900.00
21735 Atlas of Gynecologic Oncology J.Richard Smith,Guiseppe 2005 19520.00
Del Priore,John Curtin,Jo
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2004 3850.00
2 Ed
26609 GINEKOLOŠKA ONKOLOGIJA $QWHûRUXãLü'DPLU%DELü 2005 6300.00
Mirko Šamija, Hrvoje Šo
27336 Laparoscopic Surgical Oncology Pappas 2006 5245.00
30626 Oxford Handbook of Oncology, 2 Ed Jim Cassidy, Donald 2006 3375.00
Bissett, Roy Spence, and
Miran
30829 Complementary Oncology Adjunctive Methods in the BeuthiMoss 2005 8635.00
Treatment of Cancer
30836 Practical MR Mammography Uwe FischeriUlrich Brinck 2003 10692.00
30950 *sp* Oncology Alfred E. Chang,Patricia A. 2005 8502.00
Ganz,Daniel F. Hayes
31521 8/75$=98ý1,$7/$6'2-.(&'GLIHUHQFLMDOQD eva pichler 2005 3197.00
dijagnoza i interventne tehnike
32098 Melanom Sanda i Zdenko Stanec 2006 3500.00
35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New L. M. Portnoy 2006 4533.00
Outlook
35793 *sp* CANCER CHEMOTHERAPY & BIOTHERAPY CHABNER 2005 6527.00
35905 SURGERY OF THE BREAST 2E 2-VOL SPEAR 2005 26230.00
36719 Cancer Biology 3ed Roger King Mike Robins 2006 3952.00
37591 ./,1,ý.$21.2/2*,-$ Mirko Šamija, Eduard 2006 2800.00
Vrdoljak, Zdenko Krajina
37822 UROLOŠKA ONKOLOGIJA 5XÿHU1RYDN$QWXQ7XFDNL 1994 3500.00
suradnici

64 od 116
39622 *sp* CANCER PPO REVIEW OF ONCOLOGY GOVINDAN 2005 1500.00
43538 *sp* Advances in Nuclear Oncology: Bombardieri 2007 19673.00
43950 HANDBK CANCER CHEMOTHERAPY 7E SKEEL 2007 3416.00
43977 Clinical Gynecologic Oncology , 7th edition Philip DiSaia 2007 14396.00
47517 Harrison's Manual of Oncology Bruce Chabner, Dan L. 2008 5489.00
Longo
48342 The Washington Manual of Oncology: Department of Ramaswamy Govindan 2007 3965.00
Medicine, Division of Oncology, Washington University
School of Medicine, St. Louis, MO (Spiral Manual)
48347 CHEMOTHERAPY SOURCE BOOK 4E Michael C. Perry 2007 6466.00
48349 Perez and Brady's Principles and Practice of Radiation HALPERIN 2007 24278.00
Oncology, 5 Ed
48559 TUMORI DOJKE Mirko Šamija, Stjepan 2007 6300.00
-X]EDãLü9LNWRUâHSDURYLüL
48885 Atlas of Operative Laparoscopy and Hysteroscopy Donnez 2007 21838.00
48924 Gastrointestinal Oncology Evidence and Analysis Mcculloch Peter 2007 14030.00
48942 Image-Guided Radiotherapy of Lung Cancer Cox James D 2007 15860.00
50589 BOLESTI DOJKE -RVLS)DMGLüLVXUDGQLFL 1998 4104.00
51230 Enzinger and Weiss's Soft Tissue Tumors with Cd- Sharon Weiss 2007 29890.00
Rom,5 Ed
53847 PSIHOSOCIJALNA ONKOLOGIJA I REHABILITACIJA 0LURVODY3UVWDþLüL5XåD 2006 2100.00
Sabol

55132 Abeloff's Clinical Oncology , 4th Edition -Expert Consult Martin Abeloff 2008 23790.00
- Online and Print

55721 Maligne bolesti krvi 0LOLFD'ýRORYLü 1999 1298.00


56218 DeVita, Hellman & Rosenberg's Cancer : Principles and DEVITA 2008 22936.00
Practice of Oncology 8/e
(2 VOLUME )
56870 KIRURGIJA DOJKE MRVLSIDMGLüLYRGåHSLQD 2006 2479.00
59976 Early Diagnosis and Treatment of Cancer Series: Li-Ming Su 2009 10979.00
Prostate Cancer,
59977 Early Diagnosis and Treatment of Cancer Series: Head Wayne Koch 2008 10979.00
and Neck Cancers (Early Diagnosis in Cancer)
59987 Breast Cancer Imaging: A Multidisciplinary, Marie Tartar, Chris E. 2008 13054.00
Multimodality Approach Comstock, Michael S.
Kipper
60143 Cancer Neurology in Clinical Practice: Neurologic 2008 15303.00
Complications of Cancer and Its Treatment (Current
Clinical Oncology)
60144 Sensitization of Cancer Cells for Chemo/immuno/Radio 2008 14169.00
-therapy (Cancer Drug Discovery & Development)
60146 Targeted Cancer Therapy (Current Clinical Oncology) 2008 15303.00
60276 PHARMACOECONOMICS AN INTRODUCTION PB RASCATI 2008 3904.00
60403 Meyler's Side Effects of Drugs in Cancer and 2008 4879.00
Immunology (Meylers Side Effects)
60859 UNDERSTANDING BREAST CANCER 2E PL1.5 ACC 2006 1037.00
61721 Lokalizovani karcinom prostate Jovan Hadzi-Djokic 2052.00
62003 )LEURFLVWLþQHSURPHQHGRMNHPRUIRORJLMDGLMDJQRVWLND 2006 432.00
- terapija
62023 Tumor Diagnosis: Practical Approach & Pattern Awatif Al-Nafussi 2005 29280.00
Analysis 2nd Edition
65676 Practical Clinical Oncology Hanna/Crosby/Macbeth 2008 6100.00

65 od 116
66474 The Washington Manual Hematology and Oncology WASHINGTON UNIV 2008 2867.00
Subspecialty Consult The Washington Manual
Hematology and Oncology Subspecialty Consult, 2 Ed
68850 Pancreatic Cancer Heiken 2008 5490.00
68851 Prostate Cancer Hricak/Scardino 2008 5490.00
69440 Oxford American Handbook of Oncology Lyman, Gary H 2009 3752.00
69441 Oxford Handbook of Oncology and Emergencies in Cassidy, Jim; Bissett, 2008 5621.00
Oncology Pack Donald; Spence, Roy;
Payne,
70600 AJCC Cancer Staging Handbook: From the AJCC 2009 3963.00
Cancer Staging Manual
70672 AJCC Cancer Staging Manual (Edge, AJCC Cancer 2009 5664.00
Staging Manual)
71683 Oncology of Infancy and Childhood,Expert Consult - Stuart H. Orkin 2009 16348.00
Online and Print

71855 Hughes, Mansel & Webster's Benign Disorders and Robert E. Mansel 2009 10735.00
Diseases of the Breast, 3rd Edition

71866 2VQRYLNOLQLþNHRQNRORJLMH 6ODÿDQD)LOLSRYLü 2009 1944.00


72459 PET and PET/CT: A clinical guide Eugene C. Lin, Abass Alavi 2009 7555.00
73101 Principles and Practice of Gynecologic Oncology, 5 Ed BARAKAT 2009 18666.00
73102 DEVITA'S CANCER ONCOLOGY REVIEW 2E PB GOVINDAN 2009 6466.00
73124 BETHESDA HANDBK CLINICAL ONCOLOGY 3E PB ABRAHAM 2009 3050.00
73150 Wintrobe's Clinical Hematology,2 vol. set GREER 2008 24278.00

74226 Surgical Oncology Chaudry, M Asif; Winslet, 2009 5621.00


Marc Christopher
77128 DERMATOLOŠKA ONKOLOGIJA -DVQD/LSR]HQþLü$LGD 2009 2520.00
3DãLüLVXUDGQLFL
77447 Karcinom prostate 0DUNRYLü9HOLERU6DXWRU 2007 1296.00
80991 Antibacterial Chemotherapy Amyes, Sebastian 2009 749.00
81001 Oxford Handbook of Oncology (3/e) Cassidy, Jim; Bissett, 2010 4120.00
Donald; Spence, Roy;
Payne,
81027 Oral Complications of Cancer and its Management Davies, Andrew; Epstein, 2010 6246.00
Joel
81186 PEDIJATRIJSKA ONKOLOGIJA Josip Konja 2009 2520.00
81293 Breast Cancer Michell 2010 6710.00
82003 Handbook for Principles and Practice of Gynecologic LEVINE 2010 3166.00
Oncology
108893 Lek za sve vrste kancera Klark, Hulda Reger - autor 2009 1296.00
108894 Lek za sve vrste uznapredovalih kancera Klark, Hulda Reger - autor 2009 1296.00
108895 Lek i prevencija za sve vrste kancera (sadrži i dvd) Nataša Koderman 2009 1620.00
109338 Bone Cancer , Dominique Heymann 2009 10370.00
109690 Manual of Clinical Oncology, 6e Casciato 2010 3654.00
110396 Rak prostate Mirko Šamija i suradnici 2010 5648.00
110530 /LPIHGHPUXNHSRVOHOHþHQMDUDNDGRMNH Goldner, Branislav - autor - 2005 648.00
L]GDYDþ
111826 Early Diagnosis and Treatment of Cancer Series: Susan Gearhart 2010 10979.00
Colorectal Cancer,
112434 Kuerer's Breast Surgical Oncology Henry Kuerer 2010 18787.00
112435 Manual of Psycho-Social Oncology James D. Duffy, Alan 2011 6709.00
Valentine
66 od 116
112436 Herb-Drug Interactions in Oncology Barrie Cassileth, K.Simon 2010 6343.00
Yeung, Jyothirmai Gubili
112437 Ovarian Cancer: Comprehensive and Contemporary K Chitrathara, Shalini 2010 14395.00
Management Rajaram, Amita
Maheshwari
114571 Leibel and Phillips Textbook of Radiation Oncology, Richard Md Hoppe 2010 22814.00
114689 CANCER CHEMOTHERAPY & BIOTHERAPY 5E CB CHABNER 2010 19154.00
115224 Dx/Rx: Pancreatic Cancer Lowery 2010 1829.00
115225 Dx/Rx: Gynecologic Cancer Dizon 2010 1951.00
115359 32732512,3$/,-$7,912/,-(ý(1-( M. Šamija, D. Nemet i 2010 6160.00
ONKOLOŠKIH BOLESNIKA suradnici
116009 Nutrition and the Cancer Patient Del Fabbro, Egidio; Bruera, 2010 9379.00
Eduardo; Demark-Wahnef
116010 Children With Cancer (Rev/Upd ed) Munn Bracken, Jeanne 2010 2375.00
116015 Cancer and its Management 6e Tobias J 2010 6094.00
117711 Kirurška onkologija M. Stanec, V. Vrdoljak, M. 2010 6300.00
TuriÊ
119871 +HPLRWHUDSLMVNLSULUXþQLN 0DUMDQRYLü6ORERGDQ 2010 1620.00
autor
opšta medicina
8544 Checkliste XXL Hans-Joachim Seidel 2002 7555.00
9698 Travel Health Goodyer 2003 3837.00
9932 *sp* Medical Ethics and Law: The Core Curriculum Hope 2003 400.00
10368 *sp* A Practical Approach to Occupational and Robert J. McCunney, Paul 2003 3422.00
Environmental Medicine P. Rountree, Jeffrey L.
18814 Medicina za pomorce 5RVDQGD0XOLü'DUNR 2002 2800.00
Ropac
18837 Medicinska informatika ĈXUR'HåHOLü 1997 1512.00
18876 .URQLþQDERO 9MHQþHVODY.LVHOMDN 1400.00
18891 Temelji vojnobrodske i podvodne medicine sa zaštitom 6WUDüLPLU*RãRYLü 2484.00
dišnog sustava
18893 Kako sastaviti,objaviti i ocjeniti znanstveno djelo 9ODWNR6LOREUþLü 2003 1750.00
18910 Organizacija i upravljanje u zdravstvenoj zaštiti /XND.RODü 3500.00
19617 35$.7,.80/,-(ý(1-$.521,ý1(%2/, Vjenceslav Kiseljak 2002 1400.00

20549 Strategic Medicines Management Martin Stephens 2005 4484.00


24246 *sp* Willard and Spackman's Occupational Therapy 10 CREPEAU 2003 1500.00
Ed
26620 80,-(û(0(',&,16.(1$67$9(3ULUXþQLN äHOLPLUMDNãLü1LNãD 2005 3500.00
izdanje Pokrajac, Anton Šmalcelj,
Ml
26988 *sp* Oxford Handbook of Clinical Specialties, 7 Ed Collier, Judith 2006 690.00
29566 The Merck Manual 18th Edition Mark H. Beers 2006 5245.00
30055 Lange Outline Review, USMLE Step 1 Goldberg, Joel S. 2006 2927.00
30057 Lange Outline Review: USMLE Step 3 Goldberg, Joel S. 2006 2927.00
30559 Oxford Handbook of Medical Sciences Cross 2006 2375.00
30623 Oxford Handbook of Public Health Practice (2/e) Pencheon, David; Guest, 2006 3495.00
Charles; Melzer, David; Gr
30686 Osnove obiteljske medicine Robert E.Rakel 2005 10060.00
31528 MEDICINA IZNUTRA 0DWNR0DUXãLü 2006 1750.00
31530 359$3202û'2.75,1$,35$.6$%LEOLRWHND Alen Sekelj i suradnici 2006 5600.00
SULUXþQLFL]DRQHNRMLåHOH]QDWLYLãHL]D
SROXSURIHVLRQDOQHHNLSHSUYHSRPRüL
67 od 116
34610 *sp* Oxford Handbook of Clinical Medicine, 7 Ed Longmore, Murray 2007 1500.00
34789 Evidence-Based Medicine in Sherlock Holmes' Nordenstrom 2006 1585.00
Footsteps
34939 Lange Practice Tests for the USMLE Step 2 ISE GOLDBERG 2006 2073.00
35261 BOARDS & WARDS REVIEW USMLE STEP AYALA 2006 2434.00
36066 BOARD BUSTER STEP 1 ZASLAU 2006 2867.00
36078 REVIEW FOR USMLE STEP 3 2E NMS (ROSNER) 2006 2928.00
36239 Essential Family Medicine, 3rd edition Robert Rakel 2006 5245.00
36856 DEJA REVIEW: USMLE STEP 1 ESSENTIALS-ISE Naheedy, John H. 2005 1341.00
36859 LANGE Q&A: USMLE STEP 3 -ISE, 3Rev Ed edition BRISCOE 2005 1824.00
36884 LANGE PRACTISE TESTS FOR THE USMLE 3 GOLDBERG 2005 2195.00
36885 LANGE Q&A FOR THE USMLE STEP 2 2006 2135.00
37816 DIJETE, ŠKOLA, RODITELJ Zdenka Gruden i Vladimir 2006 2100.00
Gruden

40504 The New Primary Care Dowling, Bernard 2003 2439.00


43779 The Test - Saleslogix - The AAMT RMT Review Guide AAMT 2006 3654.00
43807 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
BIOCHEMISTRY
43808 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
MICROBIOLOGY
43809 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
MICROBIOLOGY
43813 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
PATHOPHYSIO 5
43814 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00
PHARMACOLOGY
43989 Hutchison's Clinical Methods, 22 Ed - IE Swash 2007 2322.00
43991 Medicine & Surgery an Integrated Textbook Lim 2007 6694.00
44872 TERORIZAM I MEDICINA Medicinski aspekti Joshua Shemer i Yehuda 2007 4200.00
biološkoga, kemijskoga i radiološkoga terorizma Shoenfeld
47784 Current Occupational and Environmental Medicine 4 Ladou, Joseph 2007 4635.00
Rev ed (Lange Medical Books)
48112 MURTAGH'S GENERAL PRACTICE : COMPANION Murtagh, John 2007 3903.00
HANDBOOK Australian ed
48366 Adolescent Health Care: A Practical Guide (Adolescent Lawrence S. Neinstein, 2007 7198.00
Healthcare: A Practical Guide (Neinstein)) 5e Catherine Gordon, Debra
Kat
50583 3RYLMHVWPHGLFLQH]DSUDNWLþDUH Ante Škrobonja,Amir 2003 1900.00
Muzur,Vlasta Rotschild
50585 ýXGDPRGHUQHPHGLFLQH .UHãLPLU3DYHOLü 1900.00
51161 *sp* Rethinking Informed Consent in Bioethics Manson/O'neill 2007 1097.00
52561 Biomedical Ethics Glannon, Walter 2004 1249.00
55149 Usmle Step 1 Secrets, Thomas Brown 0 3171.00
55843 Medical Malpractice Survival Handbook ACLM 2007 6099.00
56134 Rapid Review USMLE Step 2 (Rapid Review) Michael W. Lawlor 2006 3171.00
56819 Textbook Men's Health & Aging Lunenfeld 2007 17690.00
57681 Crush Step 3: The Ultimate USMLE Step 3 Review Adam Brochert 2008 3049.00
(Secrets)
58845 Kontrola infekcije u stomatološkim ustanovama 9DQMD9XþLüHYLü%RUDV 2008 840.00
60030 Managing Clinical Processes Roslyn Sorensen, Rick 2008 4025.00
Iedema
61047 Oxford Handbook for the Foundation Programme (2/e) Hurley, Nathalie; Dawson, 2008 2250.00
68 od 116
James; Sanders, Stephan;
61123 Making Sense of Medical Ethics: a hands-on guide Alan G. Johnson 2006 2195.00
62036 Making Sense of your Medical Career: your strategic Riaz Agha 2005 2195.00
guide to success
62041 A Textbook of General Practice Second Edition Dr Anne Stephenson 2004 2561.00
62047 Public Health Practice and the School-Age Population Prof Diane Debell 2007 2439.00
62060 Towards Mrcpch Part Ii (Theory) Examination Tapabrata Chatterjee 2005 1829.00
64904 .$7$/2*',-$*1267,ý.,+/$%25$725,-6.,+ -DGUDQND6HUWLüLVXUDGQLFL 2008 3500.00
PRETRAGA
65455 Family Medicine: Ambulatory Care and Prevention, Mark B. Mengel, L. Peter 2009 4147.00
Fifth Edition: Ambulatory Care and Prevention (Lange Schwiebert
Clinical Medicine)
65978 ,VWRULMDPHGLFLQHKURQRORJLMDQDM]QDþDMQLMLKRWNULüDX 7LPRWLü%UDQLYRMHDXWRU 2008 648.00
oblasti medicine, stomatologije i farmacije
66493 Merck Manual of Patient Symptoms, Merck 2008 1829.00
69224 Oxford Handbook of General Practice (3/e) Simon, Chantal; Everitt, 2009 2625.00
Hazel; van Dorp, Francois
69598 POVIJEST KIRURGIJE 9LOMDP%LOLü 2009 2800.00
69619 ZAUZMITE SE ZA SVOJE ZDRAVLJE Donald M. Vickery, James 2008 1820.00
F. Fries
70829 The Common Sympton Guide 6ed ISE WASSON 2009 1707.00

70830 First Aid A&A for the NBDE Part I 1ed ISE Steinbacher 2009 2190.00

70831 First Aid for the ABSITE 1ed ISE LAFEMINA 2009 2190.00

70832 First Aid for the Basic Sciences: General Principles LE 2009 2800.00
1ed ISE
70833 First Aid for the Basic Sciences: Organ Systems 1ed LE 2009 2800.00
ISE

70834 First Aid for the Surgery Clerkship 2ed ISE KAUFMAN 2009 1707.00

70835 First Aid for the Wards 4ed ISE LE 2009 2927.00

70893 Emergency Medicine: PreTest Self-Assessment & ROSH 2009 1574.00


Review 2ed ISE

70894 Medicine: PreTest Self-Assessment & Review 12ed URBAN 2009 1574.00
ISE

70896 Obstetrics & Gynecology: PreTest Self-Assessment & SCHNEIDER 2009 1951.00
Review 12ed ISE

70900 Psychiatry: PreTest Self-Assessment & Review 12ed KLAMEN 2009 1951.00
ISE

70904 First Aid Cases for the USMLE Step 1 2ed ISE LE 2009 1707.00

70906 First Aid Q&A for the USMLE Step 1 2ed ISE LE 2009 1829.00

71000 Higijena .RFLMDQþLü 2009 1188.00


71648 Step-by-Step Medical Coding 2009 Edition, Carol J. Buck 2009 5367.00
71649 Workbook for Step-by-Step Medical Coding 2009 Carol J. Buck 2009 2317.00
Edition,

69 od 116
71668 Ferri's Clinical Advisor 2010 Fred Ferri 2009 8295.00
5 Books in 1, Expert Consult - Online and Print

71899 Healthcare Communiction Bruce Hugman 2009 3837.00


72527 BLUEPRINTS MEDICINE 5E PB YOUNG 2009 2562.00
73598 REVIEW FOR USMLE STEP 3 3E PB NMS (ROSNER) 2009 3654.00
74361 Textbook of Family Medicine (3/e) McWhinney, Ian R; 2009 3500.00
Freeman, Thomas
74729 Case Files Family Medicine, Second Edition (Lange Eugene C. Toy, Donald 2009 2805.00
Case Files) Briscoe, Bal Reddy
74792 Family Medicine PreTest Self-Assessment & Review, Doug Knutson 2009 2439.00
Second Edition (Pretest Clinical Medicine)
75803 2SãWDPHGLFLQDSRURGLþQDPHGLFLQD7RPL ɀɢɝɢʄɅɚɩɱɟɜɢʄ 2006 7143.00
ɂɜɚɧɤɨɜɢʄɉɨɩɨɜɢʄ
75869 .DUGLRORJLMDXUDGXRSãWHPHGLFLQHSRURGLþQH 0LUMDQD/DSþHYLü'DQH 2005 1333.00
medicine äLJLü6X]DQD
6WDQNRYLü'UDJR
75872 0HWRGRORJLMDQDXþQRJLVWUDåLYDQMDXPHGLFLQVNRMSUDNVL 'DQHäLJLü'UDJROMXE 2006 667.00
,YDQNRYLü/MXELQâXNULHY
76722 Zdravstveni menadžment : menadžment zdravstvenog 0LüRYLü3UHGUDJ0DXWRU 2008 1296.00
sistema i zdravstvenih ustanova
80840 8OWUD]YXþQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D Guenter Schmidt 2010 7990.00
atlas
81006 Oxford Handbook of General Practice and Simon, Chantal; Everitt, 2010 5621.00
Emergencies in Primary Care Pack Hazel; Van Dorp, Francois
81241 Usmle Step 2 Secrets, Theodore X. O'connell 2010 3171.00
81288 Quality and Risk Management in the Ivf Laboratory Mortimer/Mortimer 2008 3293.00
81933 Sakupljanje, organizacija i evaluacija informacija ĈXNLü/-LOMDQD&DXWRU 2009 1123.00
81934 'REUDSUDNVDXUDGXHWLþNLKRGERUD 6ORERGDQ-DQNRYLü 2009 702.00
81936 Komunikacija u biomedicinskim naukama /MXERPLU7RGRURYLü/MLOMDQD 2008 1123.00
9XþNRYLü'HNLü
81940 Socijalna medicina : udžbenik za redovnu i ĈRNLü'UDJROMXEDXWRU 2007 913.00
postdiplomsku nastavu
109306 Diferencijalna dijagnostika urinarnog nalaza =YRQLPLU9XNXãLü 2010 378.00
110395 /DWLQVNLLKUYDWVNLQD]LYL]DQDMþHãüHEROHVWLLVWDQMDVD -RãNR%XEOLüL1HGD$EHUOH 2010 1042.00
šiframa prema MKB 10
111726 Ferri's Clinical Advisor 2011, Fred F. Ferri 2010 7929.00
112182 Evidence-based Health Promotion Perkins ER 1999 7319.00
112272 Lange Q&A Physician Assistant Examination, Sixth Anthony A. Miller, Albert F. 2010 5001.00
Edition Simon, Rachel Carlson
112350 CURRENT Diagnosis & Treatment in Family Medicine, Jeannette South-Paul, 2011 3659.00
Third Edition (Lange Current Series) Samuel C. Matheny, Evelyn
L.
112357 First Aid for the USMLE Step 2 CK, Seventh Edition: A Tao Le, Vikas Bhushan, 2009 3903.00
Student to Student Guide (First Aid USMLE) Herman Singh Bagga
112358 First Aid for the USMLE Step 2 CS, Third Edition (First Tao Le, Vikas Bhushan, 2009 4269.00
Aid USMLE) Mae Sheikh-Ali
112361 First Aid Q&A for the NBDE Part II (First Aid Series) Jason E. Portnof, Timothy 2010 4757.00
Leung
114667 Oxford Textbook of Medicine (5/e) Warrell, David A.; Cox, 2010 36890.00
Timothy M.; Firth, John D.
114864 Current Essentials of Medicine, 4 Ed- IE Lawrence M. Tierney 2010 1928.00
115357 0.)PHÿXQDURGQD M. Strnad, T. Benjak 2010 2100.00
klasifikacija funkcioniranja, onesposobljenosti i zdravlja
115466 Médecine générale Pierre-Louis Druais, 2009 4995.00
70 od 116
Bernard Gay, Marie-France
Le
115467 80 gestes techniques en médecine générale : Guide Bernard Gay 2005 6210.00
des bonnes pratiques
116127 BLUEPRINTS FAMILY MEDICINE 3E PB LIPSKY 2010 2989.00
116139 'LMDJQRVWLþNLYRGLü]DHYDOXDFLMXQDMþHãüLKVLPSWRPD John H. Wasson 2010 972.00
kod odraslih i dece
116375 Detaljan glosar : definicije termina, pojmova i stavovi iz 0LüRYLü3UHGUDJ0DXWRU 1123.00
zdravstvene zaštite i menadžmenta zdravstvenog
sistema
116445 Komunikacijske vještine u zdravstvu /XþDQLQ''HVSRW 2010 2646.00
/XþDQLQ-
117633 General Practice, Kerryn Phelps 2011 9759.00
118676 General Practice Companion Handbook, 5 Ed John Murtagh 2011 6587.00
ortopedija
14586 Musculoskeletal System: Developmental Disorders, Frank H. Netter 1990 6460.00
Tumors, Rheumatic Diseases, and Joint Replacement
(Netter Collection of Medical Illustrations, Volume 8,
Part 2)
14587 Musculoskeletal System: Trauma, Evaluation, and Frank H. Netter 1993 6460.00
Management (Netter Collection of Medical Illustrations,
Volume 8, Part 3)
15208 Netter Concise Orthopedics 7929.00
18849 Ultrazvuk sustava za kretanje 1LNRODýLþDN 2003 2800.00
18903 Imobilizacija -DQNR+DQþHYLü 2001 1750.00
24291 Orthopaedic Clinical Examination An Evidence Based Cleland, Josh 2005 5855.00
Approach
26094 MANUAL OF ORTHOPAEDICS 6E-IE SWIONTKOWSKI 2006 3660.00
30078 *sp* Rockwood and Green's Fractures in Adults, 6 Ed BUCHOLZ 2005 15000.00
31050 *sp* Lovell and Winter's Pediatric Orthopaedics (2 MORRISSY 2005 9089.00
Volume Set)
31792 *sp* Orthopaedic Biomechanics:Mechanics and Design Donald Bartel 2006 5270.00
in Musculoskeletal
34667 Current Diagnosis and Treatment: Orthopedics, 4 Ed - Skinner 2006 2073.00
ISE
34754 Pocketbook of Orthopaedics and Fractures, 2nd Ronald Mcrae 2006 1341.00
International Edition,
43987 ADAMS' OUTLINE OF FRACTURES 12E IE Hamblen 2007 2322.00
47365 Spinal Deformities. The Essentials Heary, Albert 2007 10795.00
47468 CURRENT DIAGNOSIS & TREATMENT IN SKINNER 2007 2073.00
ORTHOPEDICS ISE
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo 2007 14518.00
48382 Master Techniques in Orthopaedic Surgery: Relevant MORREY 2007 15128.00
Surgical Exposures
49172 Pocketbook of Orthopaedics and Fractures, Ronald Mcrae 2006 2927.00
49748 Campbell's Operative Orthopaedics 4 volumena 11e Canale 2007 31427.00
50169 Orthopedic Physical Assessment, 5th edition David Magee 2007 7319.00
51233 Tachdjian's Pediatric Orthopaedics, 4th edition John Herring 2007 41724.00
59932 Delee & Drez's Orthopaedic Sports Medicine: Jesse Delee 2008 32696.00
Principles and Practice (Hardcover)
59970 Gowned and Gloved Orthopaedics: Introduction to Neil P. Sheth, Jess H. 2008 3171.00
Common Procedures (Gowned and Gloved) Lonner
60041 Textbook of Orthopaedics, Trauma and Rheumatology: 2008 4391.00
With STUDENT CONSULT Access
71 od 116
60043 Clinical Tests for the Musculoskeletal System, 2 Ed Buckup 2008 4315.00
60306 Practical Fracture Treatment 5e IE McRae 2008 2185.00
61723 Artroza - stop-program : oboljenje zglobova : osloboditi Fišer, Jirgen - autor 2006 702.00
VHERODLRVWDWLSRNUHWDQQDMEROMHYHåEHLSUDNWLþQL
saveti eksperata
61724 2EROMHQMDNLþPHQRJGLVND Oldenkot, Paul T. - autor 2005 810.00
61958 Bolesti kostiju. [Knj.] 1 9XNDGLQRYLü6WHYDQDXWRU 1080.00
66276 Essential Orthopaedics and Trauma, International Dandy 2009 3005.00
Edition, 5th Edition
With STUDENT CONSULT Online Access

68455 Emergencies in Trauma and Orthopaedics Bhangu, Aneel; Lee, 2009 2495.00
Caroline; Porter, Keith
68936 Surgical Exposures in Orthopaedics: The Anatomic HOPPENFELD 2009 18666.00
Approach, 4 Ed
69408 3RYUHGHLREROMHQMDVWRSDODLVNRþQRJ]JORED %XWNRYLü,YDQDXWRU 2009 4320.00
70626 TRAUMATOLOGIJA %5$1,0,560,/-$1,û 2003 2345.00

71194 Arthritis and Arthroplasty: The Hip (Expert Consult - Thomas E. Brown 2009 18178.00
Online, Print and DVD)

71196 Arthritis and Arthroplasty: The Shoulder (Expert David Dines 2009 18056.00
Consult - Online, Print and DVD)

71273 Adams's Outline of Orthopaedics, 14th Ed -IE Adams 2009 2185.00

71397 Adams's Outline of Orthopaedics, 14th Edition David L. Hamblen 2009 4757.00

71608 Essential Orthopaedics (Expert Consult - Online and Mark D. Miller 2009 11467.00
Print)

71642 Illustrated Dictionary of Podiatry and Foot Science, Jean Mooney 2009 3659.00
71695 Orthopaedic Physical Therapy, 4th Edition Robert Donatelli 2009 8051.00

71775 Orthopedic Massage: Theory and Technique, 2 Ed Whitney Lowe 2009 3903.00

72479 An Illustrated Handbook of Flap-Raising Techniques Kartik G. Krishnan 2008 8635.00


73581 ROCKWOOD FRACTURES IN CHILDREN 7E CB BEATY 2009 19032.00
73582 ROCKWOOD FRACTURES IN ADULTS 7E CB BUCHOLZ 2009 34526.00
74733 First Aid for the Orthopaedic Boards, Second Edition Robert A. Malinzak, Mark J. 2009 5367.00
(First Aid Specialty Boards) Albritton, Trevor R Pi
75942 Povrede meniskoligamentarnog aparata kolena 1LNROLü'UDJDQDXWRU 2006 2160.00
L]GDYDþLOXVWUDWRUI
76316 Hirurgija ramena 'LNOLü,YDQDXWRU 2009 6156.00
76931 3RYUHGHHNVWUHPLWHWDOHþHQMHLPHGLFLQVND 1LNROLüäDUNRDXWRU 2009 2160.00
rehabilitacija
76962 Dijagnoza i terapija reaktivnog artritisa Ljiljana Pavlica,Milica 2008 756.00
Prostran
79857 Oxford Handbook of Orthopaedics and Trauma Bowden, Gavin; McNally, 2010 4120.00
Martin; Thomas, Simon; Gib
80936 Pseudoartroze i defekti kostiju : metod Ilizarova 7RPLü6ODYNR0 2001 3780.00
81195 High Yield Orthopaedics, Javad Parvizi 2010 5367.00
82029 HANDBOOK OF FRACTURES 4E PB EGOL/KOVAL 2010 4880.00
72 od 116
83023 Netter's Orthopaedic Clinical Examination , Joshua Cleland 2010 5855.00
83028 A Practical Approach to Orthopaedic Medicine, Elaine Atkins 2010 5611.00
109322 Clinical Orthopaedic Exam 6e IE McRae 2010 2731.00
109897 Hirurški pristupi u ortopediji Predrag Grubor 2010 3240.00
110100 Operative Techniques: Orthopaedic Trauma Surgery, Emil Schemitsch 2010 18056.00
111562 Reconstructive Foot and Ankle Surgery: Management Mark S. Myerson 2010 18056.00
of Complications ,2ed
111600 Aana Advanced Arthroscopy: The Foot and Ankle, Ned Amendola 2010 18056.00
111603 Aana Advanced Arthroscopy: The Knee, Robert E. Hunter 2010 18056.00
111604 Aana Advanced Arthroscopy: The Hip, J.W. Thomas Byrd 2010 18056.00
111626 Fractures of the Proximal Femur: Improving Outcomes, James P. Waddell 2010 18910.00
111878 Orthopaedics and Rheumatology In Focus, Ariane L. Herrick 2009 2195.00
112707 Shoulder Rehabilitation: Non-Operative Treatment Todd S. Ellenbecker 2006 4315.00
112716 The Scaphoid 2010 22927.00
112930 Green's Operative Hand Surgery, Scott W. Wolfe 0 29890.00
112931 Aana Advanced Arthroscopy: The Wrist and Elbow, Felix H. Savoie 2010 18056.00
114595 Orthopaedic Pathology, Peter G. Bullough 2009 19764.00
115039 Neale's Disorders of the Foot Clinical Companion, Paul Frowen 2010 3049.00
115424 Surgical Management of Spinal Deformities: Expert Thomas J. Errico 2008 19642.00
Consult: Online and Print (Expert Consult Title: Online
+ Print)
116130 FAMILY MEDICINE BOARD REVIEW 4E PB BRATTON 2010 6222.00
otorinolaringologija
21816 3ULUXþQLNRUDOQLKEROHVWL 99%RUDV$QÿD5DLþ 2005 2800.00
31334 *sp* THE MASSACHUSETTS EYE AND EAR JAGER 2005 3233.00
INFIRMARY REVIEW MANUAL FOR
OPHTHALMOLOGY 3E
34626 Oxford Handbook of ENT and Head and Neck Surgery Corbridge, Rogan; 2006 3120.00
Steventon, Nicholas
37962 Otorinolaringologija äHOMNR%XPEHU9.DWLü 2003 5252.00
B.Pegan
43962 Head & Neck Imaging, 2nd edition David Yousem 2006 4025.00
47361 Audiology - Diagnosis Ross J. Roeser, Michael 2007 7555.00
Valente, Holly Hosford-Dun
48925 *sp* Soft-Tissue Surgery of the Craniofacial Region Persing John 2007 18666.00
51232 Primary Rhinoplasty with Dvd, John Tebbetts 2007 30012.00
56573 Illustrated Lecture Notes in Oral and Maxillofacial George Dimitroulis 2008 13176.00
Surgery
59968 Oral and Maxillofacial Surgery: 3-Volume Set Fonseca, Turvey, Marciani 2008 49532.00
61061 Otolaryngology and Head and Neck Surgery Warner, Giles; Corbridge, 2008 5371.00
Rogan; Martinez-Devesa,
62057 Oppenheimer's Diagnostic Neuropathology 3rd Edition Margaret Esiri 2006 21350.00
62067 .OLQLþNLDWODVSRUHPHüDMDJODVDWHRULMDLSUDNVD 0LOXWLQRYLü=RUDQDXWRU 1997 519.00
65240 Otorinolaringologija : udžbenik za studente Dergenc, Ranko - autor 2007 1080.00
stomatologije
65922 .OLQLþNDQHXURRWRORJLMD Haralampiev, Kiril - autor 2007 4320.00
71785 Crash Course: Ophthalmology, Dermatology, Ent, Seau-Tak Cheung 2009 2927.00
72391 Digital Hearing AIDS Arthur Schaub 2008 4315.00
72392 Essentials of Audiology Stanley A. Gelfand 2009 6475.00
72467 Ear, Nose, and Throat Diseases: With Head and Neck Hans Behrbohm, Oliver 2009 5395.00
Surgery, 3 Ed Kaschke, Nawka, Tadeus
72468 Clinical Voice Disorders [With DVD ROM] Arnold Elvin Aronson, Diane 2009 7555.00
73 od 116
M. Bless
72555 Color Atlas of ENT Diagnosis, 5 Ed Tony R. Bull, John S. 2009 4315.00
Almeyda
73029 Diagnosis in Otorhinolaryngology: An Illustrated Guide Metin Önerci 2009 15870.00
76227 OTORINOLARINGOLOGIJA I KIRURGIJA GLAVE I 9ODGLPLU.DWLü'UDJR 2009 4428.00
VRATA Prgomet i suradnici
109699 HANDBOOK CLINICAL AUDIOL 6E (INT ED) CB KATZ 2010 7808.00
109949 GLUHI I ZNAKOVNO MEDICINSKO NAZIVLJE - Kako 2010 2229.00
komunicirati s gluhim pacijentom
110874 +URQLþQLULQRVLQX]LWLVGLMDJQR]DLWUHWPDQ %HOLü%UDQLVODYDXWRU 2009 2700.00
112039 Otolaryngology Cummings 2010 28304.00
patofiziologija
21815 PATOFIZIOLOGIJA za VMŠ 6WMHSDQ*DPXOLQ$QÿD 2005 2800.00
5DLþ
26252 Pathophysiology, 5th Edition Kathryn L. Mccance 2005 8539.00
The Biologic Basis for Disease in Adults and Children

43813 Underground Clinical Vignettes STEP 1 SWANSON 2007 1336.00


PATHOPHYSIO 5
48378 Fundamentals of Molecular Diagnostics David Bruns 2007 5245.00
50024 Opšta patološka fiziologija Bogdan Beleslin, Branimir 2007 990.00
-RYDQRYLü9ODGLPLU1HGH
50048 :LOPVRYWXPRUQDVWDQDNGLMDJQRVWLNDOHþHQMHL GU6ODYLãDĈXULþLü 2007 350.00
prognoza
50097 PATOLOGIJA Damjanov 2008 11900.00
55699 Atlas neurološke patofiziologije %UDQLVODYý3HãLü 2003 5108.00
55705 Patološka fiziologija-praktikum 891.00
56714 Specijalna patološka fiziologija,drugo izdanje Bogdan Beleslin 2008 1790.00
71347 Pathophysiology, 6th Edition Kathryn L. Mccance 2009 8905.00
The Biologic Basis for Disease in Adults and Children

72784 Color Atlas of Pathophysiology, 2 Ed Stefan Silbernagl, Florian 2009 3775.00


Lang
73143 Pathophysiology: An Incredibly Easy! Pocket Guide, 2 LWW 2009 2434.00
Ed
73311 PATHOPHYSIOLOGY OF DISEASE: AN MCPHEE 2009 2745.00
INTRODUCTION TO CLINICAL MEDICINE, 6 ED - ISE

76264 Pathophysiology, 4th Edition Lee-Ellen C. Copstead-Kir 2009 7807.00


110481 HEART FAILURE 2E KATZ 2008 8052.00
110892 ESSENTIALS PATHOPHYSIOLOGY 3E ( INT ) PB PORTH 2010 4025.00
114055 PATOLOGIJA I PATOFIZIOLOGIJA Ivan Damjanov, Valerija 2010 1526.00
%ODåLþHYLü
patologija i sudska medicina
4342 Color (Pocket) Atlas of Pathology Riede 2003 5395.00
7652 *sp* Histopathology of Non-Hodgkin's Lymphomas Feller; Diebold 2004 14510.00
(Based on the Updated Kiel Classification)
8250 *sp* Alcoholic Liver Disease: Pathology and Pauline Hall, Nancy Coffelt 1995 900.00
Pathogenesis
18887 2SüDSDWRORJLMD 6WDQNR-XNLü 2002 4900.00
19600 SPECIJALNA PATOLOGIJA Ivan Damjanov i Stanko 2004 7000.00
-XNLü
19601 $7/$623û(3$72/2*,-( Ivan Damjanov i Stanko 2004 3500.00
-XNLü
74 od 116
-XNLü
19609 SUDSKA MEDICINA I DEONTOLOGIJA 'XãDQ=HþHYLüLVXUDGQLFL 2004 5600.00
20721 *sp* Russell and Rubinstein's Pathology of Tumours of Bigner 1998 900.00
the Central Nervous System 6edition, 2 Volume
21319 Osnove patologije Kumar,Cotran,Robbins 2000 6370.00
21813 )25(1=,ý.$36,+,-$75,-$GUXJRL]GDQMH 'UDJLFD.R]DULü.RYDþLü 2005 3500.00
0LUMDQD*UXELãLü,OLü$QÿD
22073 *sp* Diagnosis of Endometrial Biopsies and Curettings: Kurman, Robert J. 2005 4816.00
A Practical Approach, 2 Ed
22309 Atlas of Head and Neck Pathology, 2nd edition Wenig 2006 28792.00
25208 The Bethesda System for Reporting Cervical Cytology, Solomon, Diane 2004 3850.00
2 Ed
25544 *sp* Principles of Bloodstain Pattern Analysis Theory James Stuart 2005 6404.00
and Practice
26098 Obdukcijska dijagnostika Mladen Belicza, Davor 2005 2100.00
Tomas
31472 Forensic Neuropathology Whitwell, Helen 2005 16775.00
31910 MOLECULAR GENETIC TESTING IN DIAGNOSTIC PFEIFER 2006 10492.00
SURGICAL PATHOLOGY
32798 Diagnostic Histopathology of Tumors, 3rd edition Christopher Fletcher 2007 35014.00
34640 Pathology of the Human Placenta, 5 Ed Kurt Benirschke, Peter 2006 18138.00
Kaufmann, Rebecca N.
Baerge
36212 Netter's Illustrated Human Pathology IE L Buja 2004 3415.00
36889 Case Files PATHOLOGY TOY, EUGENE C 2005 1806.00
43521 Rubin's Pathology: Clinicopathologic Foundations of RUBIN 2007 7137.00
Medicine, 5e
47499 Robbins Basic Pathology, IE, 8th Ed,With Student Kumar 2007 3551.00
Consult Online Access
48526 Theory and Practice of Histological Techniques, 6th John Bancroft 2007 14640.00
edition
49954 Trzajna ozljeda, riješena enigma!, 8861.00
49963 Essentials of Rubin's Pathology, 5 Ed RUBIN Emanuel 2008 3654.00
50143 Robbins i Cotran: Atlas patologije Edward C. Klatt 2007 3490.00
51727 Forensic Neuropathology, Hideo H. Itabashi, Md 2007 17080.00
56142 Massage Therapist's Guide to Pathology WERNER 2008 3166.00
56368 Lymph Nodes Weiss 2008 8540.00
56898 Salivary Gland Cytopathology ( Essentials in 2008 5324.00
Cytopathology)
57992 $QDOL]D'1$XVXGVNRMPHGLFLQLLSUDYRVXÿX Dragan Primorac 2008 2800.00
58571 892'80(',&,16.29-(â7$ý(1-( äLYNR*QMLGLü5DQNR%LOLüL 2008 2800.00
suradnici
59056 Ioachim's Lymph Node Pathology, 4e IOACHIM 2008 15128.00
59057 ROSENS BREAST PATHOLOGY 3E CB ROSEN 2008 24278.00
59922 Atlas of Gynecologic Surgical Pathology (Atlas Of...) Philip B. Clement, Robert H. 2008 20496.00
Young
60663 Forensic Science: An Introduction to Scientific and James 2009 4513.00
Investigative Techniques, Third Edition
61120 Greenfield's Neuropathology Eighth Edition 2-Volume Prof Seth Love 2008 35136.00
Set
62023 Tumor Diagnosis: Practical Approach & Pattern Awatif Al-Nafussi 2005 29280.00
Analysis 2nd Edition
62034 Russell & Rubinstein's Pathology of Tumors of the Mclendon et al 2006 28060.00
Nervous System, 7th Edition
62039 Personality Disorder and Serious Offending Newrith 2006 12078.00
75 od 116
62039 Personality Disorder and Serious Offending Newrith 2006 12078.00
62051 Adams and Graham's Introduction to Neuropathology, Professor D I Graham 2006 7015.00
Third Edition
62434 Patologija - prvo Srpsko izdanje Damjanov, Lukic, Nola 2008 12600.00
62435 Core pathology IE Alan Stevens 2008 3005.00
62603 Comprehensive Cytopathology, 3 Ed -Expert Consult: Marluce Bibbo 2008 29524.00
Online and Print

63018 Sternberg's Diagnostic Surgical Pathology, 5 Ed MILLS 2009 34892.00


65620 Pathology Secrets,3ed Ivan Damjanov 2009 3171.00
65810 Robinsove osnove patologije V. Kumar, A.B. Abbas, N. 2010 5990.00
Fausto, R.N. Mitchell
66253 General and Systematic Pathology, International Underwood 2009 3551.00
Edition, 5th Edition
with STUDENT CONSULT Access

66274 Robbins & Cotran Pathologic Basis of Disease,With Kumar 2009 6831.00
STUDENT CONSULT Online Access, 8 Ed -IE
68814 CT and MRI Pathology: A Pocket Atlas Michael L Grey, Jagan 2003 1787.00
Mohan Ailinani
69023 Gynecologic Pathology, Marisa Nucci 2009 13542.00
69095 Understanding Forensic Digital Imaging, Herbert L. Blitzer 2008 7441.00
69263 Atlas histopatologija %DVWD-RYDQRYLü*RUGDQD 2009 4320.00
autor
69435 Robbins and Cotran Pathologic Basis of Disease, Vinay Kumar 2009 12566.00
Professional Edition, 8 Ed
Expert Consult - Online and Print

71063 Lange High Yield Pathology Flash Cards, Second Suzanne Baron, 2009 3171.00
Edition (Lange Flashcards) Christopher Lee
71085 Robbins and Cotran Pathology Flash Cards, Edward C. Klatt 2009 2927.00
71200 Robbins and Cotran Review of Pathology,3 Ed Edward C. Klatt 2009 4025.00
71201 Robbins and Cotran Atlas of Pathology,2 Ed Edward C. Klatt 2009 4513.00
71309 Wheater's Basic Pathology: A Text, Atlas and Review Young 2010 2731.00
of Histopathology, International Edition, 5th Edition
With STUDENT CONSULT Online Access
IE

71602 Modern Surgical Pathology,2 Ed, 2-Volume Set, Expert Noel Weidner 2009 37576.00
Consult - Online & Print

71871 Rapid Review Pathology,3 Ed Edward F. Goljan 2009 3659.00


72532 Diagnostic Surgical Pathology and Molecular Genetics NIKIFOROV 2009 16226.00
of the Thyroid

72562 Diagnostic Atlas of Melanocytic Pathology Phillip H. Mckee 2009 17202.00


Expert Consult: Online and Print

73015 Dermatopathology: The Basics Bruce R. Smoller, Kim M. 2009 5664.00


Hiatt
73150 Wintrobe's Clinical Hematology,2 vol. set GREER 2008 24278.00

73190 BRS PATHOLOGY 4/E BRS (SCHNEIDER) 2009 2196.00

73577 BIOPSY INTERP THYROID PARATHYROID CB BOERNER 2009 12078.00


73707 Bone Marrow Pathology 4e Bain BJ 2009 14639.00

76 od 116
74701 Dermatopathology, Third Edition Raymond L. Barnhill, A. Neil 2010 28669.00
Crowson, Cynthia M. M
76961 8WYUÿLYDQMHVPUWLSUHJOHGXPUOLKVXGVNRPHGLFLQVND 'XQMLü'XãDQ-DXWRU 2004 702.00
obdukcija
77909 Wheater's Review of Histology & Basic Pathology, Kate M. Baldwin 2009 3049.00
81359 Essential Concepts in Molecular Pathology, William B. Coleman 2010 5245.00
83024 Scheuer's Liver Biopsy Interpretation,8ed Jay H. Lefkowitch 2010 11590.00
109210 Ekspertizna medicina 'XQMLü'XãDQ-DXWRU 2008 4860.00
109321 Robbins & Cotran Atlas of Pathology 2nd Klatt 2009 3278.00
109412 Lippincott's Illustrated Review of Rubin's Pathology 2E FENDERSON 2010 3776.00

109546 Patologija -DNLü5D]XPRYLü 2010 3234.00


-DVPLQNDâDUþHYLü
Božena,Sven Seiw
111703 Diagnostic Gynecologic and Obstetric Pathology,2ed Christopher P. Crum 2010 21960.00
111711 Atlas of Liver Pathology,3ed Gary C. Kanel 2010 19642.00
112025 .,585â.$3$72/2*,-$ SULMHYRGDPHULþNRJ ROSAI, ACKERMAN 2010 40839.00
izdanja)
112159 Breast Pathology: Diagnosis by Needle Core Biopsy, ROSEN 2010 15982.00
3e
113305 Pathology for the Health Professions, Ivan Damjanov 2010 6587.00
113391 Thyroid Cytopathology: 8 (Essentials in Cytopathology) Douglas P. Clark, William 2010 7563.00
C. Faquin
113552 Blaustein's Pathology of the Female Genital Tract: 2 2010 19272.00
113761 Modern Surgical Neuropathology with Cd-Rom Miller 2009 15860.00
114055 PATOLOGIJA I PATOFIZIOLOGIJA Ivan Damjanov, Valerija 2010 1526.00
%ODåLþHYLü
114595 Orthopaedic Pathology, Peter G. Bullough 2009 19764.00
114836 Cytopathology Shambayati, Behdad 2011 3750.00
116062 Pathology PreTest Self-Assessment and Review BROWN 2010 1891.00

116137 DIAG PATHOLOGY GENITOURINARY AMIRSYS CB AMIN 2010 26718.00


116138 BIOPSY INTERPRETATION BLADDER 2E CB EPSTEIN 2010 11468.00
117228 BIOPSY INTERPRET OF SOFT TISSUE TUMOR CB FISHER 2010 12078.00
117229 PATHOLOGY EXAM REVIEW PB AHMED 2009 12078.00
117446 STOCKERS PEDIATRIC PATHOLOGY 3E CB STOCKER / DEHNER 2011 28060.00
117451 PRACTICAL CARDIOVASCULAR PATHOLOGY CB BURKE 2010 18422.00
117452 ADVANCE SURGICAL PATH LUNG CANCER CB CAGLE 2010 10370.00
117802 Dermatopathology, Nooshin K. Brinster 2011 15738.00
118794 Atlas of Forensic Histopathology Cummings/Trelka/Springer 2010 8540.00
pedijatrija i neonatologija
729 *sp* Caring for Your Premature Baby Klein 1998 400.00
7205 Paediatrics at a Glance -IE Miall 2002 1464.00
7247 Maternal Newborn Nursing Care Plans - IE Green 2003 1951.00
12415 '0DUGHãLü3HGLMDWULMD 0DUGHãLüLVDUDGQLFL 2003 6059.00
18877 Pedijatrijska kardiologija,2.dio ,YDQ0DOþLü 2003 3500.00
18878 Pedijatrijska kardiologija ,YDQ0DOþLü 2001 2100.00
18925 Od simptoma do dijagnoze u pedijatriji Vlado Oberiter 1999 3500.00
20140 *sp* Essential Pediatric Cardiology Peter Koenig 2004 2988.00
24350 Essentials of Adolescent Medicine Donald Greyanus 2005 3537.00
26068 Nelson Essentials of Pediatrics 5th,IE Kleigman 2005 4781.00

77 od 116
26432 *sp* Pediatric Surgery, 4th edition Ashcraft 2005 17385.00
26898 Prenatal Diagnosis Evans, Mark I. 2007 10980.00
27117 Pediatric Neurology, 4th edition Kenneth Swaiman 2006 36234.00
31050 *sp* Lovell and Winter's Pediatric Orthopaedics (2 MORRISSY 2005 9089.00
Volume Set)
31324 Manual of Pediatric Nutrition, 4th edition Kristy Hendricks 2006 4747.00
31326 Pediatric Cardiology Vetter 2006 6221.00
31344 Oxford Textbook of Palliative Care for Children Goldman, Ann 2006 10629.00
36288 Handbook of Neonatal Intensive Care, 6th edition Gerald Merenstein 2006 5611.00
36470 Oski's Solution: Oski's Pediatrics - Principles and MCMILLAN 2006 9760.00
Practice: Plus Intergrated Content Website, 4 Ed
37091 'HþMDJDVWRHQWHURORJLMD )LOLSRYLü'REULYRMH 1995 648.00
37816 DIJETE, ŠKOLA, RODITELJ Zdenka Gruden i Vladimir 2006 2100.00
Gruden

37964 Larousse Enciklopedija za roditelje 3750.00


43774 Lewis's Child and Adolescent Psychiatry: A LEWIS 2007 13054.00
Comprehensive Textbook, 4 Ed
43981 PEDIATRIC CLIN EXAM MADE EASY 5E IE Gill 2007 1092.00

43990 IE Illustrated Textbook of Paediatrics 3E Lissauer 2007 3005.00


44005 Nelson Textbook of Pediatrics, 18th edition,IE Kliegman 2007 7787.00
47451 Manual of Pediatric Therapeutics (Spiral Manual) John W. Graef, Joseph I. 2007 3233.00
Wolfsdorf, David S. Green
47518 Lange Q & A: Pediatrics Jackson, Mary Anne; 2009 3171.00
Viessman, Sara
47621 Practical Paediatrics, 6th edition Don Roberton 2007 7075.00
48360 Pediatric Body CT Marilyn J. Siegel 2007 13054.00
48366 Adolescent Health Care: A Practical Guide (Adolescent Lawrence S. Neinstein, 2007 7198.00
Healthcare: A Practical Guide (Neinstein)) 5e Catherine Gordon, Debra
Kat
48379 Pediatrics (Master Techniques in Orthopaedic Surgery) Vernon T Tolo 2007 14518.00
49844 *sp* Childhood Obesity Prevention and Treatment Parizkova Jana 2005 2263.00
Second Edition
49908 2þHPXPRMHGLMHWHUD]PLãOMDVWU 1849.00
49918 Pedijatrijska gastroenterologija, 632 str. )HGRUUDLü$QD9RWDYD 2002 3684.00
5DLü
49957 8PLULWHVYRMHGLMHWHQDSULURGDQQDþLQVWU 1464.00
51233 Tachdjian's Pediatric Orthopaedics, 4th edition John Herring 2007 41724.00
51671 Pediatrics Bauchner/Vinci/Kim 2007 4514.00
51804 Nelson Textbook of Pediatrics e-dition, 18th edition Robert Kliegman 2007 19154.00
55099 The Harriet Lane Handbook 18th ed IE Johns Hopkins 2008 3141.00
55101 Forfar and Arneil's Textbook of Pediatrics 7th IE McIntosh 2008 12023.00

55120 Neonatology: Questions and Controversies Series: Jeffrey Perlman 2008 6831.00
Neurology
58729 PDR Concise Drug Guide for Pediatrics PDR 2008 3659.00
59846 Oxford Handbook of Paediatrics Tasker, Robert C; McClure, 2008 2500.00
Robert J; Acerini, Carl
59921 Nutrition in Pediatrics Christopher Duggan, John 2008 12687.00
B. Watkins, W. Allan Walk
59949 Feigin and Cherry's Textbook of Pediatric Infectious Ralph D. Feigin, James 2008 32696.00
Diseases: Expert Consult: Online and Print, 2-Volume Cherry, Gail J. Demmler-

78 od 116
Set (Textbook of Pediatric Infectious Disease (Feigin)) Har
60039 Atlas of Spine Trauma with CD-ROM: Adult & Pediatric Daniel H. Kim, Steven C. 2008 22082.00
Ludwig, Alexander R. Vacc
61067 Paediatric gastroenterology, hepatology and nutrition Beattie, Mark; Dhawan, 2008 4746.00
Anil; Puntis, John WL
61069 Paediatric Respiratory Medicine Hull, Jeremy; Forton, Julian; 2008 4370.00
Thomson, Anne
61937 /HNDUVNLSULUXþQLNL]GHþMHQHIURORJLMH 3RSRYLü5RORYLü0LODQD 2001 540.00
autor
61943 8UJHQWQDQHXURORãNDLQHXURPHWDEROLþNDVWDQMDNRG 0DUMDQRYLü%RULYRM' 2006 1960.00
dece autor
62014 Brain and Spinal Tumours of Childhood Walker 2004 16165.00
62033 Practical Paediatric Problems Beattie, J 2005 5429.00
a Textbook for Mrcpch
62054 Operative Endoscopy and Endoscopic Surgery in Najmaldin, a 2005 21838.00
Infants and Children
62060 Towards Mrcpch Part Ii (Theory) Examination Tapabrata Chatterjee 2005 1829.00
62130 Akutna limfoblastna leukemija kod dece .RVWLü*RUGDQDDXWRU 2005 432.00
62395 Comprehensive Pediatric Nephrology Geary & Schaefer 2008 14884.00
Text with CD-ROM

63633 Current Pediatric Diagnosis and Treatment IE Hay 2008 3550.00


65803 Pediatric Heart Sounds Michael E. McConnell 2008 9066.00
66413 Pediatric Endocrinology and Inborn Errors of Kyriakie Sarafoglou, Georg 2009 6587.00
Metabolism F. Hoffmann, Karl S. Ro
66731 Child and Adolescent Psychiatry Coghill, David; Bonnar, 2009 4370.00
Sally; Duke, Sandra; Graha
67028 PEDIJATRIJSKA NEUROLOGIJA 1LQD%DULãLüLVXUDGQLFL 2009 16800.00
68526 Oxford Handbook of Neonatology Fox, Grenville; Hoque, 2009 2750.00
Nicholas; Watts, Timothy
68559 Principles and Practice of Pediatric Infectious Disease Sarah Long 2009 20496.00
Revised Reprint,
68837 Congenital Malformations: Evidence-Based Evaluation Praveen Kumar, Barbara 2007 4879.00
and Management K. Burton
68846 Fetal and Neonatal Brain Injury, 4 Ed Stevenson et al 2009 11590.00
68852 Fetal Echocardiography Allan/Cook/Huggon 2009 11590.00
68870 BLUEPRINTS PEDIATRICS 5E PB MARINO 2008 2684.00
69024 Paediatric Radiology Johnson, Karl; Williams, 2009 4746.00
Helen; Foster, Katharine;
70615 HITNA STANJA U DJECE /-,/-$1$$8'<.2/$5,û 2001 2804.00
I SURADNICI

70887 Neonatology: Management, Procedures, On Call GOMELLA 2009 2763.00


Problems, Diseases and Drugs 6ed ISE

70899 Pediatrics: PreTest Self-Assessment & Review 12ed YETMAN 2009 1951.00
ISE

71443 Nelson udžbenik pedijatrije. Knj. 1, 17. izdanje 2008 7560.00


71575 Pulmonary Manifestations of Pediatric Diseases, Nelson L. Turcios 2009 7807.00
71609 The Pediatric Cardiology Handbook, 4 Ed Myung K. Park 2009 4147.00
71610 Clinical Pediatric Neurology, 6th Ed- A Signs and Gerald Fenichel 2009 9393.00
79 od 116
Symptoms Approach: Expert Consult - Online and Print

71635 Primary Care of the Child With a Chronic Condition, 5th Jackson Allen, Vessey & 2009 6587.00
Edition Schapiro

71771 Pediatric Manual Medicine: An Osteopathic Approach Jane Carreiro 2009 4757.00

71778 An Osteopathic Approach to Children,2 Ed Jane Carreiro 2009 5611.00


71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Frank Hinman 2008 25132.00
Edition

72354 Oxford Handbook of Children's and Young People's Glasper 2006 2375.00
Nursing
72471 Pediatric Imaging: Rapid-fire Questions and Answers Frank L. Quattromani 2008 4315.00
72988 Paediatric Cardiology, 3rd Ed Expert Consult - Online Robert H. Anderson 2009 24766.00
and Print

73314 COLOR ATLAS AND SYNOPSIS OF PEDIATRIC KANE 2009 4331.00


DERMATOLOGY, 2 ED -ISE

73325 Case Files: Pediatrics, 3 Ed -ISE Toy 2009 1732.00

73561 PRACTICAL GUIDE FETAL ECHOCARDIO 2E PB ABUHAMAD 2009 10492.00


73588 FETAL MONITORING INTERPRETATION 2E CB CABANISS 2009 8052.00
74208 Paediatric Haematology and Oncology Bailey, Simon; Skinner, 2009 4746.00
Roderick
74376 Paediatric Surgery Davenport, Mark; Pierro, 2009 5621.00
Agostino
74726 Pediatric Emergency Medicine: Third Edition (Strange, Gary R. Strange, William F 2009 11590.00
Pediatric Emergency Medicine) Ahrens, Robert W. Schaf
74801 Cases in Pediatric Radiology Ammar Haouimi 2009 6831.00
75323 Nadas' Pediatric Cardiology, John F. (Barry) Keane 2006 10247.00
76747 Pediatric Practice Endocrinology Michael S. Kappy, David B. 2009 7319.00
Allen, Mitchell E. Ge
77058 Oxford Handbook of Paediatrics and Emergencies in Tasker, Robert C; McClure, 2009 4996.00
Paediatrics Pack Rob; Acerini, Carlo L;
77584 PEDIATRIC SONOGRAPHY 4E CB SIEGEL 2010 17568.00
77916 Fetal Echocardiography, Julia A. Drose 2009 7807.00
77954 Pediatric Endocrinology, Mark A. Sperling 2008 9393.00
77955 Neurology of the Newborn, 5th Edition Joseph J. Volpe 2008 12688.00

77956 Hemodynamics and Cardiology: Neonatology Charles S. Kleinman 2008 6831.00


Questions and Controversies with Expert Consult Print
and Online,
78009 NAPREDNO ODRŽAVANJE ŽIVOTA DJECE I Hrvatsko društvo za 2007 2100.00
129252Ĉ(1ý$', reanimatologiju Hrvatskoga
lij
80819 Neonatal Emergencies Hansmann 2009 6100.00
80823 Neonatal and Infant Emergencies Sharieff/Mccollough 2008 6710.00
80833 Pedijatrija i zdravlje deteta Mary Rudolf, Malcolm 0.00
Levene
80997 The Ethics of Pediatric Research Wendler, David 2010 3752.00
81002 Handbook of Pediatric Physical Diagnosis (2/e) Barness, Lewis A; Gilbert- 2010 2814.00
Barness, Enid
81003 Paediatric Dermatology Lewis-Jones, Sue 2010 5621.00
80 od 116
81004 Paediatric Intensive Care Barry, Peter; Morris, Kevin; 2010 5621.00
Ali, Tariq
81020 Emotions in Child Psychotherapy Barish, Kenneth 2010 2500.00
81186 PEDIJATRIJSKA ONKOLOGIJA Josip Konja 2009 2520.00
81204 Ashcraft's Pediatric Surgery,5 Ed George W. Holcomb 2010 23546.00
81207 Manual of Pediatric Anesthesia, Jerrold Lerman 2010 5855.00
81218 Merenstein & Gardner's Handbook of Neonatal Sandra Lee Gardner 2010 5611.00
Intensive Care,
82011 Case Studies in Pediatric Infectious Diseases Berkowitz 2007 4514.00
82077 Pediatric Practice: Sports Medicine Patel 2009 6221.00
82079 Manual of Neonatal Surgical Intensive Care Hansen 2009 5245.00
82081 Pediatric Practice: Infectious Disease Shah 2009 6221.00
82082 Pediatric Practice: Neurology Carney 2010 7441.00
82110 Essentials of Pediatric Radiology Daldrup-Link/Gooding 2010 7930.00
82416 Pediatric Anesthesiology Review: Clinical Cases for Robert Holzman, Thomas J. 2010 8961.00
Self-Assessment Mancuso, Navil F. Sethna
82417 Handbook of Pediatric Surgery 2010 6399.00
82430 Nelson Essentials of Pediatrics, International Edition, Marcdante 2010 4269.00
6th Edition
With STUDENT CONSULT Online Access
82706 VISUAL DIAGNOSIS IN PEDIATRICS 2E CB CHUNG 2010 10614.00
83060 Pediatric Ultrasound, Rose de Bruyn 2010 5489.00
109691 Manual of Neonatal Care, 6e Cloherty 2010 3654.00
109944 DISPRAKSIJA Geoff Brookes 2010 1680.00
110086 Nelson Essentials of Pediatrics, 6th Edition Karen Marcdante 2010 5733.00
With STUDENT CONSULT Online Access
110748 POCKET PEDIATRICS MGH HANDBOOK SP PRASAD 2009 4026.00
111549 The Teaching Files: Pediatric, Sarah Milla 2010 10247.00
111714 Fanaroff and Martin's Neonatal-Perinatal Medicine, 9th Richard J. Martin 2010 22082.00
Edition, Diseases of the Fetus and Infant (Expert
Consult - Online and Print) (2-Volume Set)
111819 Neonatal Nutrition and Metabolism Thureen/Hay 2006 21594.00
111836 Assisted Ventilation of the Neonate, Jay P. Goldsmith 2010 7563.00
111838 Pediatric Secrets,5ed Richard A. Polin 2010 3171.00
111839 Pediatric Allergy,2ed Donald Y. M. Leung 2010 9881.00
112546 CURRENT Diagnosis and Treatment Pediatrics, William W. Hay, Myron J. 2010 6953.00
Twentieth Edition (Lange Current Series) Levin, Robin R Deterding
112743 Pediatric Imaging (RadCases) Richard Gunderman, Lisa 2010 4482.00
Delaney
113528 Nutritional Strategies for the Very Low Birthweight Adamkin 2009 3293.00
Infant
113529 Case Studies in Pediatric Critical Care Murphy/Marriage/Davis 2009 4636.00
113530 Neonatology Polin/Lorenz 2008 4392.00
113532 Ethical Dilemmas in Pediatrics Frankel et al 2009 2805.00
113533 Neonatal Cerebral Investigation Rennie/Hagmann/Robertso 2008 13908.00
n
113535 Practical Neonatal Endocrinology Ogilvy-Stuart/Midgley 2006 5002.00
113536 Neonatal Hematology de Alarcon/Werner/Naiman 2005 14640.00
113537 Pediatric and Adolescent Psychopharmacology Greydanus/Calles, Jr/Pate 2008 4392.00
113539 Neurodevelopmental Outcomes of Preterm Birth Nosarti/Murray/Hack 2010 7320.00
113865 PEDIATRIC FACTS MADE INCRED QUICK 2E SP SPRINGHOUSE 2010 1946.00
114024 Pediatric Cardiology 2e Johnson W 2008 5611.00
81 od 116
114336 TEXT PEDIATRIC EMERGENCY MEDICINE 6E CB FLEISHER 2010 17568.00
114447 Neofax 2010 23e PDR 2010 2927.00
114840 Handbook of Paediatrics 7e (7/e) Motala, Cassim; Fugaji, 2010 5002.00
Anthony; Davidson, Alan; L
114842 Paediatric Palliative Medicine Hain, Richard D. W.; Jassal, 2010 4370.00
Satbir Singh
115209 PSIHOTERAPIJSKA PEDAGOGIJA Zdenka Gruden 2010 1890.00
115478 Urgences pédiatriques Antoine Bourrillon, Gérard 2005 5940.00
Chéron
115481 Pédiatrie collectif, Antoine Bourrillon, 2009 5265.00
Grégoire Benoist
116010 Children With Cancer (Rev/Upd ed) Munn Bracken, Jeanne 2010 2375.00
116057 .OLQLþNDSXOPRORJLMDXSHGLMDWULML 1LNROLü3DVNDODXWRU 1997 260.00
116281 Neonatology at a Glance 2e Lissauer T 2011 3171.00
117446 STOCKERS PEDIATRIC PATHOLOGY 3E CB STOCKER / DEHNER 2011 28060.00
118476 Odabrana poglavlja iz pedijatrijske dermatologije Šitum, M., (ur.) 2010 2205.00
118910 Examination Paediatrics, Wayne Harris 2011 5855.00
SODVWLþQDKLUXUJLMD
24290 *sp* Psychological Aspects of Reconstructive and SARWER 2005 4880.00
Cosmetic Plastic Surgery: Clinical, Empirical and
Ethical Perspectives
37819 35$.7,ý1$3/$67,ý1$.,585*,-$ Neven Olivari 2006 19600.00
48890 Textbook of Liposuction Hanke 2007 15860.00
48925 *sp* Soft-Tissue Surgery of the Craniofacial Region Persing John 2007 18666.00
59956 Plastic Surgery: Indications and Practice: Expert Bahman Guyuron, Elof 2008 49044.00
Consult Premium Edition: Enhanced Online Features, Eriksson, John A. Persing
Print, and DVD, 2-Volume Set (Expert Consult 2 Vol
Set & DVD)
61062 Plastic and Reconstructive Surgery Giele, Henk; Cassell, Oliver 2008 5371.00
62021 Facial Plastic Surgery Vuyk, H.D. 2006 21045.00
63655 General Reconstructive Surgery with Dvd, Gregory Evans 2008 11955.00
63657 Atlas of Abdominoplasty with Dvd, Joseph Hunstad 2008 11833.00
63659 Atlas of Cosmetic Surgery with Dvd, Michael Kaminer 2008 18544.00
63661 Cosmetic and Reconstructive Breast Surgery with Dvd, Maurice Nahabedian 2008 11955.00
71202 Oncoplastic Surgery of the Breast with Dvd, Maurice Nahabedian 2009 11955.00
71787 Techniques in Aesthetic Plastic Surgery Series: Facial Steven Cohen 2009 13298.00
Rejuvenation with Fillers with Dvd,
71788 Techniques in Aesthetic Plastic Surgery Series: Louis Bucky 2009 13298.00
Aesthetic Breast Surgery with Dvd,
72395 Plastic and Reconstrutive Surgery of the Breast: A Christian J. Gabka, Heinz 2008 19435.00
Surgical Atlas Bohmert, Philip Blondeel
72447 Facial Plastic and Reconstructive Surgery Ira D. Papel 2008 22675.00
72479 An Illustrated Handbook of Flap-Raising Techniques Kartik G. Krishnan 2008 8635.00
72568 7DMQHHVWHWVNHKLUXUJLMHþLQMHQLFHLIDVFLQDFLMH Panfilov, Dimitrije E. - autor 2700.00
PRJXüQRVWLLJUDQLFH
posteri
14592 Male Reproductive System, Poster 1458.00
15428 Anatomy of the Ear Chart, Poster Frank H. Netter 2003 1458.00
18036 Gastrointestinal System 1458.00
59060 Dangers of Alcohol Anatomical Chart, 2e - Paper ACC 2008 482.00
59061 Dangers of Alcohol Anatomical Chart, 2e - Laminated ACC 2008 1037.00
60857 THE BRAIN Poster ACC 9920PU 2001 482.00
82 od 116
61447 DIGESTIVE SYSTEM PU ACC 9859PU 2001 482.00
psihijatrija
18840 Zakon o zaštiti osoba s duševnim smetnjama Miroslav Goreta 2000 2240.00
18931 Govor snova %UDQND-DNHOMLü 2002 2100.00
18934 Grupna analiza Eduard Klajn 2008 1680.00
18936 Psihoanaliza žalovanja Ivan Buzov 546.00
19604 SNOVI U PSIHOTERAPIJI Ivan Buzov 1993 840.00
19605 FORENSIC PSYCHIATRY, PSYCHOANALYSIS AND Miroslav Goreta 2004 2800.00
CRIMINAL LAW
21813 )25(1=,ý.$36,+,-$75,-$GUXJRL]GDQMH 'UDJLFD.R]DULü.RYDþLü 2005 3500.00
0LUMDQD*UXELãLü,OLü$QÿD
26619 NUSPOJAVE PSIHOFARMAKA Uzun, Kozumplik, Mimica 2005 1750.00
30640 *sp* Rapid Review Behavioral Science Stevens 2003 1250.00
37593 PRIMIJENJENA PSIHOTERAPIJA Vladimir Gruden, ml., 2006 3500.00
Zdenka Gruden, Vladimir
Grud
37594 Psihijatrija Ljubomir Hotujac i suradnici 2006 1750.00
37937 Journey into the Heart of Bipolarity Philippe Nuss with Marie 2005 5832.00
Sellier and Jean-Paul Bat
41818 GRUPNA PSIHOTERAPIJA za medicinske sestre i Eduard Klain, Rudolf 2007 1750.00
WHKQLþDUH Gregurek i suradnici
43774 Lewis's Child and Adolescent Psychiatry: A LEWIS 2007 13054.00
Comprehensive Textbook, 4 Ed
43791 Kaplan and Sadock's Study Guide and Self- Benjamin J Sadock, Virginia 2007 3904.00
Examination Review in Psychiatry A Sadock, Ze'ev Levin
43795 NMS: PSYCHIATRY 5/E NMS (THORNHILL) 2007 2928.00

47279 Stahl's Essential Psychopharmacology Stahl/Muntner 2008 3660.00


47507 PSYCHIATRY : AN OXFORD CORE TEXT 3 Rev ed Geddes, John; Gelder, 2005 2750.00
(Oxford Core Texts) Michael G.; Mayou, Richard
48560 36,+,ý.(326/-(',&(75$80( 0ODGHQ/RQþDU1HYHQ 2007 2100.00
Henigsberg i suradnici
54185 CONCISE TEXTBK CLINICAL PSYCHIATRY 3E PB SADOCK 2008 4874.00
56123 Depression and Bipolar Disorder Stahl 2008 3050.00
56133 Rapid Review Behavioral Science (Rapid Review) Vivian M. Stevens, Susan 2007 3171.00
(Rapid Review) K. Redwood, Jackie L. Nee
56321 Antipsychotics and Mood Stabilizers Stahl 2008 3050.00
58572 PSIHOTERAPIJSKA SUPERVIZIJA Maria C. Gilbert, Kenneth 2008 2100.00
Evans
59985 Psychiatry (Crash Course - UK) Julius Bourke, Matthew 2008 2927.00
Castle
61053 Emergencies in Psychiatry Puri, Basant; Treasaden, 2008 2745.00
Ian
61135 Overcoming Postnatal Depression: a Five Areas Dr. Christopher Williams 2008 2805.00
Approach
62013 Maintaining Control: An Introduction to the Effective John Edward Gillett 2003 2805.00
Management of Violence and Aggression
62017 Mrcpsych Part I: Passing the Osce Dr Justin Sauer 2005 2683.00
62024 The Complete Mrcpsych Part I: a Comprehensive Ashok Patel 2006 2683.00
Guide to the examination
62028 The Complete Mrcpsych Part Ii: a Comprehensive Ashok Patel 2006 3293.00
Guide to the examination
62029 Culture and Mental Health: a comprehensive textbook Kamaldeep Bhui 2007 12078.00
62039 Personality Disorder and Serious Offending Newrith 2006 12078.00
83 od 116
62039 Personality Disorder and Serious Offending Newrith 2006 12078.00
62042 Dementia 3rd Edition Alistair Burns 2005 19215.00
62059 MRCPsych: Part 1 - 2: Individual Statements and EMI Justin Sauer 2005 2683.00
Practice Exams
62747 *5831$$1$/,=$DQDOLWLþNDJUXSQDSVLKRWHUDSLMD Eduard Klain i suradnici 2008 4200.00
izdanje
65811 Psihijatrija Michael Gelder 2009 1490.00
65923 8YRGXNOLQLþNXSVLKRSDWRORJLMX RGVLPSWRPDGR Munjiza, Marko - autor 2008 2268.00
dijagnoze u psihijatriji)
65928 Delirijum i akutno konfuzno stanje u psihijatriji, Munjiza, Marko - autor 2006 540.00
neurologiji i somatskoj medicini
65930 $NXWQHLKURQLþQHSVLKR]HXSULPDUQRM]GUDYVWYHQRM Munjiza, Marko - autor 2005 540.00
zaštiti
65931 3UYLLQWHUYMXXNOLQLþNRMSUDNVL Munjiza, Marko - autor 2007 756.00
65934 Neurološki simptomi i sindromi u psihijatriji 9HOLþNRYLü$OHNVDQGDU 2007 972.00
autor
66731 Child and Adolescent Psychiatry Coghill, David; Bonnar, 2009 4370.00
Sally; Duke, Sandra; Graha
66917 Psihofarmakoterapija ,YDQD7LPRWLMHYLü 2008 1188.00
66918 /LWLMXPLDIHNWLYQLSRUHPHüDML 7LPRWLMHYLü,YDQDDXWRU 2007 972.00
67751 3VLKRDQDOLWLþNDSVLKRWHUDSLMDGHFHLPODGLK 7DGLü1HYHQNDDXWRU 2004 1620.00
67753 Psihijatrija detinjstva i mladosti 7DGLü1HYHQNDDXWRU 2006 1080.00
67754 2VHüDMQRLVD]QDMQR 7DGLü1HYHQNDDXWRU 2007 540.00
67761 Budite sebi psihoterapeut Rejnvoter, DŽenet - autor 2003 432.00
67762 ,VWRþQMDþNHSULþHXSVLKRWHUDSLML Peseškijan, Nosrat - autor 2008 432.00
68059 Oxford Handbook of Psychiatry (2/e)- IE Semple, David; Smyth, 2009 3495.00
Roger
68249 .OLQLþNDSVLKLMDWULMD 0DULü-RYDQDXWRU 2005 810.00
L]GDYDþ
68295 Bez straha o strahu, panici i fobiji 6WDUþHYLü9ODGDQDXWRU 2008 756.00
68296 3DQLþQLSRUHPHüDMIDUPDNRWHUDSLMD NRJQLWLYQR %DWLQLü%RUMDQNDDXWRU 2009 648.00
bihejvioralna terapija
68297 3VLKLMDWULMDXNULWLþNRPRJOHGDOX .HFPDQRYLü'XãDQDXWRU 2008 972.00
68567 Kaplan and Sadock's Comprehensive Textbook of SADOCK 2009 24278.00
Psychiatry (2 Volume Set, 9 Ed
68747 Fuga za bajamama od Dinare do Avale : (autobiografija Munjiza, Marko - autor 2008 756.00
o spoznaji sebe i duše psihijatrije)
68812 Psychiatry Board Review: Pearls of Wisdom, Third Rebecca A. Schmidt 2009 5855.00
Edition (Pearls of Wisdom Medicine)
68822 Old Age Psychiatry Sheehan, Bart; Karim, 2009 4370.00
Salman; Burns, Alistair
68825 Philosophy, Psychoanalysis and the A-rational Mind Brakel, Linda A W 2009 3745.00
68826 Psychiatry PRN: Principles, Reality, Next Steps Stringer, Sarah; Church, 2009 2250.00
Laurence; Davison, Susan;
68827 Oxford Textbook of Suicidology and Suicide Prevention Wasserman, Danuta; 2009 9379.00
Wasserman, Camilla
68838 The Prescriber's Guide, 3 Ed Stahl 2009 5246.00
68839 The Prescriber's Guide, Antipsychotics and Mood Stahl 2009 2683.00
Stabilizers
68840 The Prescriber's Guide, Antidepressants Stahl 2009 2805.00
68841 Antidepressants Stahl 2009 3049.00
68842 Stahl's Illustrated Antipsychotics Stahl 2009 3049.00
68843 Stahl's Illustrated Mood Stabilizers Stahl 2009 3049.00
68844 Community Treatment of Drug Misuse: More Than Seivewright 2009 4270.00
84 od 116
Methadone
68854 Bipolar Disorder in Young People Macneil et al 2009 3659.00
68866 Kaplan and Sadock's Concise Textbook of Child and SADOCK 2008 4874.00
Adolescent Psychiatry
69310 Current Diagnosis and Treatment Psychiatry ISE Ebert 2008 3038.00
69618 Psihosomatska medicina i konsultativna psihijatrija : $GDPRYLü9ODGLPLUDXWRU 2005 1350.00
SULUXþQLN]DNOLQLþNXSUDNVX
69620 3VLKRGLQDPLþNDSVLKLMDWULMD7RP7HRULMHVWUDKDL /-XERPLU(ULü 2009 1566.00
stanja straha
69621 3VLKRGLQDPLþNDSVLKLMDWULMD7RP,VWRULMDRVQRYQL /-XERPLU(ULü 2008 1512.00
principi, teorije
69631 Stres : zdravlje - bolest 3UHGUDJ.DOLþDQLQ6YHWRPLU 2001 1080.00
6WRåLQLü1LNRODM3DOH
70104 Emocije : psihoterapija i razumevanje emocija =RUDQ0LOLYRMHYLü 2008 2268.00
70105 Formule ljubavi : kako ne upropastiti sopstveni život 0LOLYRMHYLü=RUDQDXWRU 2009 1296.00
WUDåHüLSUDYXOMXEDY
70685 ZLOUPORABA DROGA I OVISNOST O 0$-672529,û0,âý,1 2001 836.00
DROGAMA,BIBLIOGRAF.RADOVA

70900 Psychiatry: PreTest Self-Assessment & Review 12ed KLAMEN 2009 1951.00
ISE

70924 Bolesti zavisnosti : pušenje, alkoholizam i narkomanija : 1LNROLü'UDJRVODYDXWRU 2007 648.00


knjiga za svaku porodicu
70925 Akcioni program primarne prevencije bolesti zavisnosti 'UDJRVODY1LNROLü 2007 324.00
pušenja, alkoholizma i narkomanije : knjiga za svaku
porodicu
71818 Mental Health: From Policy to Practice Charles Brooker 2008 3659.00

71819 Mental Health Nursing, 2 Ed Rob Newell 2008 3171.00

71828 Psychiatric Drugs Explained, 5th Edition David Healy 2008 2561.00

72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen 2009 2495.00
Nursing, 1 Ed
73203 Lippincott's Manual of Psychiatric Nursing Care Plans SCHULTZ 2008 3294.00
8/e

73327 Case Files: Psychiatry, 3 Ed -ISE Toy 2009 1732.00

74215 Attention-Deficit Hyperactivity Disorder and Banaschewski, Tobias; 2009 749.00


Hyperkinetic Disorder Coghill, David; Danckaerts,
74997 Overcoming Anxiety, Stress and Panic Dr Chris Williams 2009 2805.00
a Five Areas Approach
Second Edition
76212 Ono i mi 6YLþHYLü5DGRVODYDXWRU 816.00
77130 PSIHIJATRIJA 7)UDQþLãNRYLü/M0RURL 2009 3780.00
suradnici
80462 Social Cognition and Developmental Psychopathology Sharp, Carla; Fonagy, 2008 4746.00
Peter; Goodyer, Ian
80826 Stahl's Illustrated Chronic Pain and Fibromyalgia Stahl/Muntner/Ball 2009 3049.00
80830 Stahl's Illustrated Attention Deficit Hyperactivity Stahl/Mignon 2009 3049.00
Disorder
81019 Depression in Later Life Baldwin, Robert 2010 749.00
81020 Emotions in Child Psychotherapy Barish, Kenneth 2010 2500.00
85 od 116
81020 Emotions in Child Psychotherapy Barish, Kenneth 2010 2500.00
81021 Severe Depression McIntyre, Roger; 2010 749.00
Nathanson, Jay
81187 SIMBOLI PROMJENE analiza predigre jedne Carl Gustav Jung Marijan 2009 4900.00
shizofrenije Cipra
81189 6895(0(1$36,+2$1$/,7,ý.$36,+27(5$3,-$ 0LUNRýRUOXNLü 2009 2800.00
relacijska sinteza
81994 3ULUXþQLN]DSUHYD]LODåHQMHDQNVLR]QRVWLLIRELMD Born, Edmund - autor 2008 1620.00
82099 HANDBOOK OF PSYCHIATRIC DRUGS 6E PB ROSENBAUM 2009 3660.00
82703 Kaplan and Sadock's Pocket Handbook of Clinical SADOCK 2010 4575.00
Psychiatry, 5 Ed
109192 Tajni prsten : Frojdov uži krug saradnika i politika Groskurt, Filis - autor 2009 1296.00
psihoanalize
109194 Kompletan uvod u psihoanalizu Frojd, Sigmund - autor 2006 1944.00
109681 Kaplan and Sadock's Synopsis of Psychiatry, 10e Sadock 2010 4880.00
110397 Tretman seksualnih delikvenata i zaštita zajednice /DQD0XåLQLü/MLOMDQD 2010 3270.00
Vukota
112545 Destruktivnost i autodestruktivnost mladih 9RMLVODYûXUþLü 2010 864.00
113762 Personal Recovery and Mental Illness Slade 2009 4270.00
113940 Managing Social Anxiety,Therapist Guide, 2nd Edition Hope, Debra A.; Heimberg, 2010 3439.00
() Richard G.; Turk, Cynthi
115386 ,QVWUXPHQWLNOLQLþNHSURFHQHXSVLKLMDWULML 7LPRWLMHYLü,YDQDDXWRU 2010 810.00
115866 Single Case Experimental Designs:Strategies for David Barlow Matthew Nock 2008 5489.00
Studyin 3ed Michael Hersen
116309 6WUHVSURFMHQDLVXRþDYDQMH Lazarus, Richard S. , 2004 4704.00
Folkman, Susan
117232 Designing and Conducting Mixed Methods Research Creswell,John W;Clark,Vicki 2010 3537.00
L Plano
118463 $QNVLR]QLSRUHPHüDML Hollander, E., D. Simeon 2006 2646.00
118468 3DQLþQLSRUHPHüDMLLDJRUDIRELMDWHUDSLMVNLYRGLþ Latas, Milan - autor 2010 756.00
118475 Neuropsihologijska procjena, Testovi i tehnike, 2. *DOLü6ODYND 2009 4704.00
izdanje
118796 Antipsychotics and their Side Effects Gardner/Teehan/Baldessari 2010 4270.00
119691 7XPDþHQMHQHXUR]DOHþHQMHLVDPRSRPRü =GUDYNRYLü-H]GLPLUDXWRU 2010 648.00
psihologija
4215 The Heart of Listening, Vol. 1 MILNE 3559.00
9232 *sp* Biographical Dictionary of Psychology Sheehy; Chapman 2002 1220.00
18841 Osnove obiteljske terapije 6WDQLãD1LNROLü 1996 1680.00
18844 Samoubojstvo mladih ,YLFD6WDQLü 1999 1400.00
18848 3RVWWUDXPDWVNLVWUHVQLSRUHPHüDM Rudolf Gregurek 2000 2100.00
18928 Psihoterapijska pedagogija Zdenka Gruden 1994 1680.00
18946 Susret kao Lijek Milan Košuta 1120.00
20931 Psihologija u menadžmentu Abraham Maslov 2004 1836.00
21561 RAZUMIJEVANJE EMOCIJA Keith Oatley, Jennifer 2007 4116.00
Jenkins
21731 Transformative Relationships: The Control-Mastery George Silberschatz 2005 2683.00
Theory of Psychotherapy
23231 Medicinska psihologija sa osnovama psihopatologije 'HVLPLURYLü 1997 648.00
24403 Research Methods in Psychology Shaughnessy, John J. 2005 3781.00
24456 Psychology Updated with In-Psych Plus Student CD- Santrock 2004 3960.00
ROM and PowerWeb
25849 *sp* Ise: Research Methods in Psychology 8e Elmes 2005 3953.00
26286 SOCIJALNA PSIHOLOGIJA Elliot Aronson, Timothy D. 2005 5010.00
86 od 116
Wilson, Robin Akert,
28161 Motivacija Rheinberg Falko 2004 2352.00
31232 Methods in Behavioral Research: WITH Powerweb Paul C. Cozby 2006 4269.00
34842 Life Would Be Easy If It Weren't for Other People Connie Podesta, Vicki 1999 2317.00
Sanderson
36736 Human Development: WITH PowerWeb Corinne Haines Crandell, 2006 4269.00
James Wilfrid Vander Zand
40684 Theories of Infant Development Bremner 2003 3625.00
41819 LJUBAV NA DRUGI POGLED Prošlost i sadašnjost 2007 1120.00
VSHFLILþQROMXGVNRJRVMHüDMD
43774 Lewis's Child and Adolescent Psychiatry: A LEWIS 2007 13054.00
Comprehensive Textbook, 4 Ed
45292 I Just Lost Myself: Psychological Abuse of Women in Valerie Nash Chang 1996 8130.00
Marriage
45307 Women Growing Older Turner,Barbara 1993 3660.00
F;Troll,Lillian E
45922 How the Special Needs Brain Learns Sousa,David A 2006 3294.00
51012 The Autism Spectrum and Further Education: A Guide Breakey, Christine 2006 1791.00
to Good Practice
53692 *sp* Handbook of Psychology: Forensic Psychology v. Weiner IB 2003 3508.00
11
56321 Antipsychotics and Mood Stabilizers Stahl 2008 3050.00
58548 Helping Pupils with Autistic Spectrum Disorders to Pittman,Mary 2007 7320.00
Learn
60490 Global Conflict Resolution Through Positioning 2007 6005.00
Analysis (Peace Psychology Book Series) (Peace
Psychology Book Series)
60733 Willard and Spackman's Occupational Therapy, 11 Ed CREPEAU 2008 5246.00
61172 Biological Psychology Rosenzweig M. et al 2007 5123.00
62017 Mrcpsych Part I: Passing the Osce Dr Justin Sauer 2005 2683.00
62029 Culture and Mental Health: a comprehensive textbook Kamaldeep Bhui 2007 12078.00
64039 Health Behavior and Health Education: Theory, Glanz K 2008 6100.00
Research and Practice, 4 Ed
64489 Working with Emotional Intelligence Daniel Goleman 2000 1886.00
65237 3VLKRORãNLUHþQLN .UVWLü'UDJDQDXWRU 1996 2484.00
65660 Sensation and Perception Wolfe et al J. 2009 5123.00
66731 Child and Adolescent Psychiatry Coghill, David; Bonnar, 2009 4370.00
Sally; Duke, Sandra; Graha
67571 Introduction to Neuropsychopharmacology UNKNOWN 2009 3752.00
67756 2SãWDSVLKRORJLMDVDSVLKRORJLMRPOLþQRVWLXYRGQD Hrnjica, Sulejman - autor 2005 810.00
predavanja
68047 PSIHOLOGIJA SPORTA - koncepti i primjene richard h. cox 2005 4116.00
68254 Socijalna percepcija Havelka, Nenad - autor 2008 648.00
68293 Osnovi socijalne psihologije Rot, Nikola - autor 2008 810.00
68589 3VLKRORJLMDOLþQRVWL Larsen, Buss 2008 6791.00
68844 Community Treatment of Drug Misuse: More Than Seivewright 2009 4270.00
Methadone
70091 Psihodinamska razvojna psihologija : odabrana .RQGLü.VHQLMDDXWRU 2007 1080.00
poglavlja
70924 Bolesti zavisnosti : pušenje, alkoholizam i narkomanija : 1LNROLü'UDJRVODYDXWRU 2007 648.00
knjiga za svaku porodicu
70944 Overcoming Teenage Low Mood and Depression : a Nicky Dummett 2008 2805.00
Five Areas Approach

87 od 116
71127 Career Theory and Practice Swanson,Jane 2009 3904.00
L;Fouad,Nadya A
71462 Kriza kao šansa : kako pobediti depresiju Naneti, Franko - autor 2008 540.00
71463 Duhovni kapital Zohar, Dana - autor 2008 1080.00
71467 Maslina i šta s njom : o sporazumevanju i ponašanju .QHåHYLþ$QD1XãDDXWRU 2007 864.00
71470 5HþQLN-XQJRYLKSRMPRYDLVLPEROD Trebješanin, Žarko - autor 2008 5357.00
71476 Zdrav život u poslovnom svetu Milna Tudor&tim 2008 432.00
71795 Psychology and Sociology Applied to Medicine, 3 Ed Beth Alder 2009 3781.00

72541 TREATING CHILD & ADOLESCENT DEPRES CB REY 2009 5734.00


72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen 2009 2495.00
Nursing, 1 Ed
74219 Children's Mental Health Research Hoagwood, Kimberly Eaton; 2009 2814.00
Jensen, Peter S.; McKay,
74847 The Developing Child:Plus MyDevelopment Lab Helen Bee Denise Boyd 2009 4639.00
Access Card 12ed
76567 *sp* Life Span Motor Development Kathleen Haywood, Nancy 2001 2318.00
Getchell
76573 *sp* Psychology for Physical Educators Yves Vauden Avweele, 1998 1830.00
Stuart Biddle
76664 2VHüDMLPHUDRSVLKRIL]LþNLPRVQRYDPDVD]QDQMD 2JQMHQRYLü3UHGUDJDXWRU 2006 756.00
77317 =ORþLQL]VWUDVWL .RVWLü0LODQDXWRU 2009 810.00
78509 Pkg-Hdev W/Review Card & Pac Rathus 2009 4757.00
78512 Pkg-Psych W/Review Card & Pac Rathus 2008 4391.00
78861 7DMQDVUHüQHGHFH Bidalf, Stiv - autor 2009 800.00
78862 -RãWDMQLVUHüQHGHFH Bidalf, Stiv - autor 2009 800.00
79167 Personal Conflict Management:Theory and Practice Suzanne Mccorkle 2009 3842.00
80462 Social Cognition and Developmental Psychopathology Sharp, Carla; Fonagy, 2008 4746.00
Peter; Goodyer, Ian
82720 Psihologija mediji etika - Iskustva i promišljanja za bolju +DGåLVHOLPRYLü'å3ODYãLü 2009 1470.00
suradnju Marlena, Pregrad Jase
82806 'H%RQRYNXUVUD]PLãOMDQMDPRüQLDODWNRMLüHYDP De Bono, Edvard - autor 1512.00
SRPRüLGDSURPHQLWHYDãQDþLQUD]PLãOMDQMD
109192 Tajni prsten : Frojdov uži krug saradnika i politika Groskurt, Filis - autor 2009 1296.00
psihoanalize
109194 Kompletan uvod u psihoanalizu Frojd, Sigmund - autor 2006 1944.00
109304 Veštine vladanja sobom : (kada vam neko ide) na =GUDYNRYLü-H]GLPLUDXWRU 2007 432.00
åLYFH DVHUWLYQRVWPDJLþQDUHþEH]PDJLMH
110113 892'832/,7,ý.836,+2/2*,-8 M. Cottam, B. Dietz- Uhler, 2010 2830.00
E. Mastors, T. Preston
110343 Forensic Psychology: A Very Short Introduction Canter, David 2010 999.00
110532 1DþHODL]UDGHSVLKRORãNLKWHVWRYD %XNYLü$OHNVDQGDUDXWRU 2007 648.00
112543 2UD]YRMXOLþQRVWL Jung, Carl Gustav - autor 2008 918.00
112545 Destruktivnost i autodestruktivnost mladih 9RMLVODYûXUþLü 2010 864.00
113939 The Oxford Handbook of Eating Disorders Agras, W. Stewart 2010 11880.00
114211 Performance Psychology, David John Collins 2010 4269.00
114927 Sensation, Perception and ActionAn Evolutionary Zanker J. 2010 3049.00
Perspective
115175 Psihologija invaliditeta Vash, Carolyn L., Crewe, 2010 4116.00
Nancy M.
115209 PSIHOTERAPIJSKA PEDAGOGIJA Zdenka Gruden 2010 1890.00
116296 *5831,352&(6,GLQDPLNDXQXWDULL]PHÿXJUXSD rupert brown 2006 3528.00
117232 Designing and Conducting Mixed Methods Research Creswell,John W;Clark,Vicki 2010 3537.00
88 od 116
L Plano
117585 Measurement and Evaluation in Psychology and Robert Thorndike Tracy 2009 6038.00
Education 8ed Thorndike-Christ
118460 Agresivnost u djece i mladeži, 2. izdanje Essau, Cecilia A., Conradt, 2009 2352.00
Judith
118463 $QNVLR]QLSRUHPHüDML Hollander, E., D. Simeon 2006 2646.00
118464 $VSHUJHURYVLQGURP±9RGLþ]DURGLWHOMHLVWUXþQMDNH Attwood, T. 2010 2205.00
118465 Trening s agresivnom djecom Petermann, F., Petermann, 2010 4116.00
Ulrike
118481  SVLKRORãNLYRGLþ]DVYDNLGDQVDPR]D 0LOLü0LODQDXWRU 2010 756.00
pametne
pulmologija
95 *sp* Asthma 3ed: Basic Mechanisms and Clinical Barnes, Rodger, Thomson 1998 400.00
Management
259 *sp* Asthma and Allergic Diseases Marone Et Al 1998 900.00
7374 *sp* Respiratory Medicine: An Illustrated Colour Text Selby 2002 1450.00
8226 *sp* Interleukin-5: From Molecule to Drug Target for Colin J. Sanderson 1999 900.00
Asthma
14584 Respiratory System (Netter Collection of Medical Frank H. Netter,Matthew B. 1980 7929.00
Illustrations, Volume 7) Divertie,Alister Brass
16849 *sp* Tracheostomy : A Multi-Professional Handbook Claudia RusselliBasil Matta 2004 900.00
18820 Bolesti pleure Pongrac Ivan 1994 700.00
18838 Pneumonije Ilija Kuzman 1999 3080.00
18864 *OMLYLþQHSOXüQHEROHVWL Ivan Pongrac 1998 1120.00
18895 Astma Slavica Dodik 1260.00
18896 Kako živjeti sa astmom? 5RVDQD6YHWLüýLãLü 1260.00
21892 *sp* Textbook of Respitory Medicine V. Courtney Broaddus,John 2005 22729.00
F. Murray,etc.
24338 Tuberculosis and Nontuberculosis Mycobacterial Schlossberg 2005 7320.00
Infections
26087 HIGH-YIELD LUNG- IE DUDEK 2005 1281.00
26091 MANUAL OF CLINICAL PROBLEMS IN PULMONARY BORDOW 2005 3660.00
MEDICINE 6E-IE
26623 NUKLEARNA KARDIOLOGIJA I PULMOLOGIJA 67HåDN',YDQþHYLü' 2005 2800.00
'RGLJ,ýLNHã
26908 6DUNRLGR]DEROHVWLSOXüQRJLQWHUVWLFLMD 7DWMDQD3HURã*ROXELþLü 2005 3500.00
37824 Atlas pulmološke citologije Ivan Pongrac 4200.00
39623 *sp* PULMONARY MEDICINE 5E GEORGE 2005 4270.00
43787 PULMONARY PATHOPHYSIOLOGY 7E PB WEST 2007 1952.00
47316 Quantitative Skin Testing for Allergy: IDT and MQT 2006 3235.00
60730 RESPIRATORY PHYSIOLOGY ESSENTIALS 8E PB WEST 2008 2196.00
61048 Oxford Handbook of Respiratory Medicine (2/e) Chapman Steven 2009 3125.00
61069 Paediatric Respiratory Medicine Hull, Jeremy; Forton, Julian; 2008 4370.00
Thomson, Anne
61739 3OXüQHEROHVWL 6HNXOü6UEROMXE 2000 2700.00
62012 Pulmonary Circulation 2ed Peacock, A.J. 2004 16958.00
62025 Respiratory Emergencies Alan M Fein 2006 17080.00
62048 Respiratory Infections Antoni Torres 2006 15738.00
62050 Respiratory Genetics Edwin Silverman 2005 15738.00
62053 Pulmonary Rehabilitation Donner et al 2005 15250.00
71575 Pulmonary Manifestations of Pediatric Diseases, Nelson L. Turcios 2009 7807.00
71655 Mosby's Respiratory Care Online for Egan's Mosby 2009 16226.00
89 od 116
Fundamentals of Respiratory Care (User Guide,
Access Code, Textbook and Workbook Package),
71656 Mosby's Respiratory Care Online for Egan's Mosby 2009 14884.00
Fundamentals of Respiratory Care (User Guide,
Access Code and Textbook Package),
72226 Oxford Handbook of Respiratory Nursing Robinson 2009 2375.00
74202 Oxford Handbook of Respiratory Medicine and Chapman, Steven; 2009 5621.00
Emergencies in Respiratory Medicine Pack Robinson, Grace; Stradling,
John;
74797 Chronic Obstructive Lung Diseases: 2 Norbert, F Voelkel, William 2009 9149.00
Macnee
82118 Harrison's Pulmonary and Critical Care Medicine Loscalzo 2010 6343.00
83063 The Respiratory System, Andrew Davies 2010 3049.00
111548 Murray and Nadel's Textbook of Respiratory Medicine,2 Robert J. Mason 2010 29158.00
-Volume Set,5ed
113559 The Respiratory System at a Glance 3e Ward JPT 2010 2805.00
116057 .OLQLþNDSXOPRORJLMDXSHGLMDWULML 1LNROLü3DVNDODXWRU 1997 260.00
118357 Core Topics in Airway Management Calder/Pearce 2010 6710.00
119349 5HVSLUDWRUQLWUDNWSULUXþQLN]DWHUDSLMXEROHVWL .DåLü7RPLVODYDXWRU 2011 648.00
respiratornog trakta
119872 9RGLþNUR]EURQKRVNRSLMX 7RPLü,OLMDDXWRU 2009 1080.00
119873 3OHXUDOQLL]OLYLGLMDJQRVWLþNLSULVWXS Plavec, Goran - autor 2009 1080.00
radiologija
4212 Pocket Atlas of Radiographic Anatomy Moeller 2000 3775.00
4219 Normal Findings in CT and MRI Moeller 2000 3775.00
7243 Pocket Guide To Radiography, 5 Ed -IE Ballinger 2003 1829.00
10382 *sp* Radiotherapy for Head and Neck Cancer: Adam S., Md Garden, K. 2002 3500.00
Indications and Techniques Kian Ang, Gardem Adam S
12872 Pocket Atlas of Radiographic Anatomy, 3 Ed Moeller 2010 3775.00
14553 Teaching Manual of Color Duplex Sonography Hofer 2004 4855.00
14594 Color Atlas of Ultrasound Anatomy Berthold Block 2004 4315.00
15286 Spiral and Multislice Computed Tomography of the Cornelia M. Prokop 2003 21492.00
Body
16485 *sp* Benign Breast Diseases: Radiology-Pathology- Catherine N. Chinyama 2004 4816.00
Risk Assessment
16755 Ultrasound in Emergency Care - IE Brooks,Adam Brooks,Jim 2004 2745.00
Connolly,OTTO CHAN
17505 The Practice of Ultrasound. A Step-by-step Guide to Berthold Block 2004 6475.00
Abdominal Scanning
18572 Accident & Emergency X-Rays Made Easy IE Begg 2006 1502.00
18578 Cross-sectional Imaging Made Easy Jackson 2004 1092.00
18942 Radijacijske ozlijede Damir Dodig 2002 2800.00
19607 RADIOLOGIJA Andrija Hebrang, Marijan 2006 1750.00
/RYUHQþLüLVXUDGQLFL
19828 *sp* Practical Guide to Abdominal and Pelvic MRI Leyendecker, John R. 2004 4000.00
20193 MRI Principles Donald G. MitchelliMark 2004 8661.00
Cohen
20574 Introduction to Vascular Ultrasonography,5 Ed William J. Zwiebel 2004 9759.00
21698 *sp* Applied Medical Image Analysis Methods Heang-Ping ChaniLena 2005 7259.00
Costaridou
22305 Thoracic Imaging Boiselle, Phillip M. 2010 4025.00
22666 Ultrasound Teaching Manual. The Basics of Performing Matthias Hofer 2005 4855.00
and Interpreting Ultrasound Scans
90 od 116
24057 *sp* IMAGING OF THE AIRWAY FUNCTIONAL AND NAIDICH 2005 4270.00
RADIOLOGIC CORRELATIONS
24289 Emergency Ultrasound Karen S. Cosby 2005 6466.00
24604 3RPRüXUDGLRORãNRMGLIHUHQFLMDOQRMGLMDJQRVWLFL Stephen Chapman 2005 2583.00
24605 92',ý.52=0$*1(7185(=21$1&8 Robert Semnic 2002 2700.00
ENDOKRANIJUMA
24924 MRI from A to Z Liney 2005 2439.00
25487 Getting Started in Clinical Radiology Eastman,Wald,Crossin 2005 4855.00
27886 Medical Imaging Renton 2004 3049.00
30633 *sp* RADIOBIOLOGY FOR THE RADIOL 6E CB HALL 2005 4819.00
30811 Essential Radiology. Clinical Presentation - Richard B. Gunderman 2006 5395.00
Pathophysiology - Imaging
30820 Teaching Atlas of Interventional Radiology Non- Saadoon Kadir 2006 10795.00
vascular interventional procedurs
31521 8/75$=98ý1,$7/$6'2-.(&'GLIHUHQFLMDOQD eva pichler 2005 3197.00
dijagnoza i interventne tehnike
34577 Differential Diagnosis in Ultrasound Gunter Schmidt 2005 18355.00
34743 Abdominal X-Rays Made Easy 2ed - IE Begg 2006 1228.00
34761 Diagnostic Ultrasound,, 7th Edition Frederick Kremkau 2005 5977.00
35174 Atlas radiološke anatomije Lothar Wicke 2007 1790.00
35175 2VQRYLNOLQLþNHUDGLRORJLMH Eastman, Wald, Crossin 2007 2190.00
35531 Ultrasound in Obstetrics and Gynecology: Volume 2 - Eberhard Merz 2006 16195.00
Gynecology
35533 POCKET ATLAS OF SECTIONAL ANATOMY : Moeller, Torsten Bert; Reif, 2006 3775.00
COMPUTED TOMOGRAPHY AND MAGNETIC Emil
RESONANCE IMAGING (V. 1) : HEAD AND NECK 3
Rev ed
35535 Pocket Atlas of Sectional Anatomy: Computed Moeller, Torsten Bert; Reif, 2006 3775.00
Tomography and Magnetic Resonance Imaging Emil
Volume 2: Thorax, Abdomen, and Pelvis, 3 rev. ed

35600 *sp* Radiologic Diagnosis of Gastric Cancer. A New L. M. Portnoy 2006 4533.00
Outlook
36177 Radiation Protection in Medical Radiography, 5th Mary Alice Statkiewicz Sh 2006 4513.00
edition
36290 Cost Effective Diagnostic Imaging, 4th edition Zachary Grossman 2006 4757.00
37589 CT TORAKSA I ABDOMENA Robert Semnic 2005 2700.00
40013 Diagnostic Imaging: Head and Neck Harnsberger 2004 22204.00
40827 Diagnostic Imaging: Brain Anne Osborn 2004 22082.00
40991 Diagnostic Imaging: Spine Ross 2004 22082.00
42258 Diagnostic Imaging: Chest Jud Gurney 2006 22204.00
43281 Diagnostic Imaging: Breast, Wendie A. Berg 2006 22936.00
43511 Chest X-ray Trainer. A Systematic Teaching Atlas Hofer 2006 4315.00
43513 Clinical 3T Magnetic Resonance , 2008 4315.00
43538 *sp* Advances in Nuclear Oncology: Bombardieri 2007 19673.00
43653 Diagnostic Imaging: Ultrasound, Anil Ahuja 2007 22204.00
43947 Gastrointestinal Imaging, 3rd edition Robert Halpert 2006 7929.00
43948 Sectional Anatomy for Imaging Professionals, 2nd Lorrie Kelley 2007 7319.00
edition
43951 Radiology in Surgical Practice Susan Neuhaus 2006 5611.00
43952 Internal Derangements of Joints, 2nd edition Donald Resnick 2006 35380.00
43958 Diagnostic Imaging: Nuclear Medicine Kathryn Morton 2007 22936.00
43962 Head & Neck Imaging, 2nd edition David Yousem 2006 4025.00
91 od 116
43962 Head & Neck Imaging, 2nd edition David Yousem 2006 4025.00
43963 Genitourinary Imaging, 2nd edition Ronald Zagoria 2006 4025.00
43967 Ultrasound Scanning, 3rd edition Betty Tempkin 2007 7319.00
47360 CT Teaching Manual. A Systematic Approach to CT Matthias Hofer 2007 4855.00
Reading
47362 Brain Imaging Sartor 2007 4855.00
47430 LANGE Q&A FOR THE RADIOGRAPHY SAIA 2006 2471.00
EXAMINATION ISE
47790 Merrill's Atlas of Radiographic Positioning and Eugene Frank 2007 18910.00
Procedures 3 Volume Set, 11th edition
48349 Perez and Brady's Principles and Practice of Radiation HALPERIN 2007 24278.00
Oncology, 5 Ed
48376 Diagnostic and Surgical Imaging Anatomy: Ultrasound Anil Ahuja 2007 20252.00
48396 Grainger & Allison's Diagnostic Radiology, 5th edition Andy Adam 2007 36478.00
48401 Gastrointestinal Imaging, 2nd edition Robert Halpert 2007 4025.00
48508 Radiologic Differential Diagnosis Bhargava, Satish. K. 2007 5489.00
49004 Mri-Guided Focused Ultrasound Surgery Jolesz Ferenc a 2007 11590.00
49331 Diagnostic and Surgical Imaging Anatomy: Knee, B. J. Manaster 2007 18666.00
Ankle, Foot
50386 Ultrasound. A Practical Arrroach to Clinical ProblemsEdward I. Bluth, Peter H. 2007 18355.00
Arger, Carol B. Benson
50827 Imaging of the Nervous System Richard Latchaw 2005 27694.00
51725 Ultrasonography in Vascular Diseases: A Practical Edward I. Bluth, Philip W. 2007 5395.00
Approach to Clinical Problems Ralls, etc.
51802 Diagnostic Imaging: Emergency R. Jeffrey 2007 22204.00
55103 Pocket Guide to Sonography, Regina Swearengin 2007 3049.00
55119 Instrumentation, An Issue of Pet Clinics,2-2 Abass Alavi 2008 5367.00
55121 Imaging of the Chest, 2-Volume Set, Nestor Muller 2008 23546.00
55138 Netter's Concise Radiologic Anatomy, Edward Weber 2008 4513.00
55145 Computed Tomography, Euclid Seeram 2008 6587.00
55147 Radiographic Procedures: a Pocket Index, Alanah Kirby 2008 2927.00
55161 Radiology for Surgeons in Clinical Practice Evis Sala, Alan H. 2008 4530.00
Freeman, David J. Lomas
55162 Learning Diagnostic Imaging. 100 Essential Cases Ramon Ribes, Antonio 2008 4530.00
Luna, Pablo R. Ros
59895 Churchill Livingstone Pocket Radiography and Medical Chris Gunn 2007 3171.00
Imaging Dictionary
59913 Ultrasound of Fetal Syndromes: Text with DVD Beryl R. Benacerraf 2007 15738.00
59931 CT and MRI of the Whole Body, 2-Volume Set John R. Haaga 2008 28304.00
59933 Mosby's Comprehensive Review for General Susanna Ovel 2008 5977.00
Sonography Examinations
59940 An Introduction to Radiography Suzanne Easton 2008 4025.00
59943 Radiography and Radiology for Dental Care Eric Whaites 2008 2439.00
Professionals
59955 Emergency Radiology: The Requisites (Requisites in Jorge A Soto, Brian Lucey 2008 8417.00
Radiology)
59974 Brain Imaging, Laurie A. Loevner 2008 4025.00
59987 Breast Cancer Imaging: A Multidisciplinary, Marie Tartar, Chris E. 2008 13054.00
Multimodality Approach Comstock, Michael S.
Kipper
60002 Practical Differential Diagnosis in CT and MRI 2008 4315.00
60006 Musculoskeletal Imaging (Direct Diagnosis in Maximilian Reiser, Christian 2008 4855.00
Radiology) Glaser, Andrea Baur-M
60007 The Practice of Breast Ultrasound: Techniques, Helmut Madjar, Ellen B. 2008 14035.00
92 od 116
Findings, Differential Diagnosis Mendelson
60009 Urogenital Imaging (Direct Diagnosis in Radiology: DX- Bernd Hamm, Dirk 2008 4855.00
Direct!) Beyersdorff, Uta Lemke
60010 Breast Imaging (DX-Direct Series) U. Fischer, F. Baum, S. 2007 4855.00
Luftner-Nagel
60012 Gatrointestinal Imaging. Direct Diagnosis in Radiology Hans-Jürgen Brambs 2007 4855.00
(DX-Direct Series)
60015 Cardiac Imaging (DX-Direct Series) Claus Claussen, Stephan 2008 4855.00
Miller, Michael Fenchel
60019 Spinal Imaging (DX-Direct Series) Herwig Imhof 2007 4855.00
60020 Head and Neck Imaging (DX-Direct Series) Ulrich Moedder, Mathias 2007 4855.00
Cohnen, Kjel Andersen
60032 Image-Guided Intervention, 2-Volume Set: Expert Matthew A. Mauro, Kieran 2008 23546.00
Radiology Series Murphy, Kenneth Thomson
60036 Problem Solving in Musculoskeletal Imaging with CD- William Brian Morrison, 2008 12322.00
ROM Timothy G. Sanders
60045 Ultrasonography in Urology: A Practical Approach to Edward I. Bluth, Philip W. 2007 7555.00
Clinical Problems Ralls, Carol B. Benson
60759 Mayo Clinic Guide to Cardiac Magnetic Resonance McGee 2008 6710.00
Imaging
61132 Basic Clinical Radiobiology Fourth Edition Michael Joiner 2009 4879.00
61999 Radiologija : univerzitetski udžbenik -/D]Lü9âRELü6ýLNDULü 2007 3240.00
%*ROGQHU5%DELü7
62020 Clark's Positioning in Radiography 12th Edition Whitley 2005 10370.00
62032 Computer Aided Tomography Case Histories of the Dr Karthikeyan 2005 10370.00
Brain
62043 The Physics of Diagnostic Imaging 2ed Dowsett 2006 9638.00
62066 ,QWHUSUHWDFLMDUHQGJHQVNLKVQLPDNDSULUXþQLN]D Palmer. P. E. S. 2004 1620.00
ljekare opšte prakse
62084 Radiologija pankreasa -RYDQRYLü7RPLVODY' 2008 432.00
autor
62097 8OWUD]YXþQDGLMDJQRVWLNDSULUXþQLN P.E.S.Palmer,Univerzitet 2006 3564.00
Kalifornija,SAD-prevod Si
62101 Osnovi radiološke zaštite : [udžbenik za studente Više -RYDQRYLü7RPLVODY' 2005 324.00
medicinske škole] autor
62103 Rendgenska dijagnostika bolesti debelog creva -RYDQRYLü7RPLVODYDXWRU 2004 432.00
62280 ER Radiology Trauma Trainer (DVD)/Windows Ole Ackermann, Steffen 2007 5395.00
Vista/XP/2000/ME/98 Ruchholtz, Holger Siemann
65427 EXPERT DIFF DIAG: BRAIN SPINE AMIRSYS CB OSBORN 2008 26718.00
66316 Imaging of the Temporal Bone Joel Swartz 2009 16195.00
66730 Interventional Radiology Uberoi, Raman 2009 4996.00
68292 Radioterapija : ilustrovana istorija ýLNDULü6ORERGDQDXWRU 2006 2700.00
68453 Emergencies in Clinical Radiology Graham, Richard; 2009 2745.00
Gallagher, Ferdia
68817 Pocket Guide to Chest X-rays Greg Briggs 2009 3415.00
68819 Nuclear Cardiology: Technical Applications Gary V Heller, April Mann, 2009 6099.00
Robert C. Hendel
68833 A-Z of Musculoskeletal and Trauma Radiology Murray/Holmes/Misra 2008 4880.00
68834 Clinical Neuroradiology Hathout/Ferguson 2008 10370.00
68849 Interventional Radiological Treatment of Liver Tumors Adam/Mueller 2008 5490.00
68850 Pancreatic Cancer Heiken 2008 5490.00
68851 Prostate Cancer Hricak/Scardino 2008 5490.00
68865 Aunt Minnie's Atlas and Imaging-Specific Diagnosis, 3 POPE 2008 8052.00
Ed
93 od 116
Ed
68867 Nuclear Medicine Technology: Procedures and Quick SHACKETT 2008 6832.00
Reference, 2 Ed
68917 Chest X-Ray Made Easy 3rd-IE Corne 2009 1228.00

68938 Expert Differential Diagnosis: Ultrasound Ahuja 2009 24278.00


68939 EXPERT DIFF DIAG: ABDOMEN AMIRSYS CB FEDERLE 2008 24278.00
68940 EXPERTDDX: HEAD AND NECK AMIRSYS CB HARNSBERGER 2009 26718.00
68942 EXPERT DIFF DIAG: MUSCULOSKEL AMIRSYS CB MANASTER 2008 26718.00
68949 ARTHROGRAPHY RADIOLOGY AMIRSYS CB CRIM 2008 16226.00
68957 Diagnostic Imaging 6e Armstrong P 2009 4879.00
69024 Paediatric Radiology Johnson, Karl; Williams, 2009 4746.00
Helen; Foster, Katharine;
69031 Imaging Atlas of Human Anatomy 4th Weir 2009 2048.00

69048 Handbook of Medical Image Processing and Analysis, Isaac Bankman 2008 13420.00
69628 Practical Digital Mammography Beverly Hashimoto 2008 7555.00
69738 8OWUD]YXþQLDWODVWUEXãQHDQDWRPLMH Berthold Block 2009 4445.00
70088 0DJQHWQDUH]RQDQFDNLþPH Robert Semnic 2009 3240.00
70800 PHYSICS OF RADIATION THERAPY 4E CB KHAN 2009 16226.00
71191 Ct Colonography: Principles and Practice of Virtual Perry J. Pickhardt 2009 20496.00
Colonoscopy,
71198 Textbook of Radiographic Positioning and Related Kenneth L. Bontrager 2009 12078.00
Anatomy,
71659 Chest X-Ray Made Easy, 3 Ed Jonathan Corne 2009 2195.00
71784 Vascular Ultrasound, Abigail Thrush 2009 5489.00
71805 Aids to Radiological Differential Diagnosis, 5 Ed Stephen G. Davies 2009 3903.00
71826 Digital and Radiographic Imaging, 4th Edition Chris Gunn 2008 4025.00

72395 Plastic and Reconstrutive Surgery of the Breast: A Christian J. Gabka, Heinz 2008 19435.00
Surgical Atlas Bohmert, Philip Blondeel
72444 Temporal Bone Imaging Ellen G. Hoeffner, Suresh 2008 9715.00
Kumar Mukherji
72446 Interventional Radiology in Women's Health Gary P. Siskin 2009 10795.00
72449 Teaching Atlas of Musculoskeletal Imaging Peter L. Munk, Anthony G. 2008 14035.00
Ryan
72450 Intracranial Sterotactic Radiosurgery 2009 16195.00
72453 Spine Surgery: Tricks of the Trade Alexander R. Vaccaro, 2008 15115.00
Todd J. Albert
72459 PET and PET/CT: A clinical guide Eugene C. Lin, Abass Alavi 2009 7555.00
72471 Pediatric Imaging: Rapid-fire Questions and Answers Frank L. Quattromani 2008 4315.00
72474 Vascular Imaging (Direct Diagnosis in Radiology: DX- Karl J. Wolf 2009 4855.00
Direct!)
72475 Pocket Atlas of Radiographic Positioning (Clinical Torsten Bert Möller, Emil 2009 3775.00
Sciences (Thieme)) Reif
72476 Atlas of Brain Function William W. Orrison 2008 7555.00
72477 Whole Body MRI Imaging Ernst J. Rummeny, Peter 2009 18355.00
Reimer, Walter Heindel
72478 The Physics of Clinical MR Taught Through Images Val M. Runge, Wolfgang R. 2008 5395.00
Nitz, Stuart H. Schmeets
72481 Teaching Atlas of Urologic Imaging Robert A. Older, Matthew 2009 12955.00
Bassignani
73534 RADIOLOGY 101 THE BASICS 3E PB ERKONEN 2009 6100.00
73548 DIAGNOSTIC IMAGING: BRAIN 2E AMIRSYS CB OSBORN 2010 27572.00
94 od 116
73552 CLINICAL IMAGING 5E CB EISENBERG 2009 17080.00
74162 Musculoskeletal Radiology: Past, Present, and Future, Carolyn M. Sofka 2009 7807.00
An Issue of Radiologic Clinics,47-3
74205 Radiotherapy in Practice - Imaging Hoskin, Peter; Goh, Vicky 2009 4996.00
74393 Ultrasound Guidance for Nerve Blocks Marhofer, Peter 2008 3370.00
74799 McGraw-Hill Specialty Board Review Radiology Cheri L. Canon 2009 8661.00
74801 Cases in Pediatric Radiology Ammar Haouimi 2009 6831.00
75306 3UDNWLNXPNOLQLþNHUDGLRORJLMH 3HWDU%RãQMDNRYLü'UDJDQ 2009 1240.00
Stojanov; Zoran Radovano
77857 Gastrointestinal Tract Imaging, Julie Nightingale 2009 5001.00
77862 Emergency Radiology, Stuart E. Mirvis 2009 4391.00
79008 Cardiovascular Magnetic Resonance,2ed Warren J. Manning 2010 11833.00
80315 Kompjuterizovana tomografija centralnog nervnog 6DQMD6WRMDQRYLü 2007 3564.00
sistema
80793 Vaskularni ultrazvuk %RULV%UNOMDþLü 2010 4900.00
80816 Emergency Radiology Krishnam/Curtis 2009 3904.00
80840 8OWUD]YXþQDGLMDJQRVWLNDGLIHUHQFLMDOQDGLMDJQR]D Guenter Schmidt 2010 7990.00
atlas
80940 Neurosonografska dijagnostika 2EUDGRYLü6ORERGDQ' 2009 2527.00
DXWRUL]GDYDþ
80987 Cardiovascular Magnetic Resonance Myerson, Saul G.; Francis, 2010 4996.00
Jane; Neubauer, Stefan
81245 Radiology Secrets Plus, 3rd Edition E. Scott Pretorius 2010 4635.00

81293 Breast Cancer Michell 2010 6710.00


81996 Neuroradiology,3 Ed David M. Yousem 2010 7929.00
82110 Essentials of Pediatric Radiology Daldrup-Link/Gooding 2010 7930.00
82278 Osnovi radiologije 0DMNOýHQ'MYLG2W/M,OMDQD 2009 1296.00
5DGRãHYLü-HOLü
82429 Sectional Anatomy: PET/CT and SPECT/CT 2010 5758.00
82701 DIAGNOSTIC IMAG MUSCL TRAUMA AMIRSYS CB SONIN 2010 27572.00
83026 Anatomy for Diagnostic Imaging, Stephanie Ryan 2010 6099.00
83060 Pediatric Ultrasound, Rose de Bruyn 2010 5489.00
110080 Medical Imaging of Normal and Pathologic Anatomy, Joel A. Vilensky 2010 3171.00
111549 The Teaching Files: Pediatric, Sarah Milla 2010 10247.00
111618 Cardiovascular Imaging, 2-Volume Set, Vincent Ho 2010 23546.00
111652 Diagnostic Ultrasound, 2-Volume Set,4ed Carol M. Rumack 2010 27572.00
111653 Head and Neck Imaging,3ed David M. Yousem 2010 4025.00
111875 Chest Radiology,6ed,(Expert Consult - Online and James C. Reed 2010 9149.00
Print)

112038 On-Call X-Rays Made Easy International Edition, Iain Au-Yong 2010 1638.00
112157 PRAC GUIDE TO ABDOMINAL PELVIC MRI 2E CB LEYENDECKER 2010 11590.00
112511 Molecular Imaging: Principles and Practice Ralph Weissleder, Brian D. 2010 15493.00
Ross, Alnawaz Rehemtull
112513 Bedside Ultrasonography in Clinical Medicine Alexander Levitov, Paul 2010 8417.00
Dallas, Anthony D. Slonim
112515 Basic Radiology, 2nd Edition (Lange Clinical Medicine) Michael Y. Chen, Thomas 2010 6953.00
L. Pope, David J. Ott
112661 Abdominal Ultrasound, Jane A. Bates 2010 5245.00
112662 Handbook of Mri Scanning, Geraldine Burghart 2010 4025.00
112663 Sonography Principles and Instruments ,8ed Frederick W. Kremkau 2010 6221.00

95 od 116
112740 Teaching Manual of Color Duplex Sonography Matthias Hofer 2010 5395.00
112743 Pediatric Imaging (RadCases) Richard Gunderman, Lisa 2010 4482.00
Delaney
112746 Interventional Radiology (RadCases) 2010 4855.00
112747 Cardiac Imaging [With Access Code] (RadCases) 2010 4855.00
112748 Musculoskeletal Radiology (RadCases) 2010 4855.00
113389 Fetal Radiology: A Diagnostic Atlas Reinhard Schumacher, 2011 11334.00
Laurie H. Seaver, Jürgen
Spra
113441 Essential Radiology for Sports Medicine 2010 18138.00
113763 Introduction to the Science of Medical Imaging Bryan 2009 9150.00
114149 Pocket Atlas of Emergency Ultrasound Robert Reardon, O. John 2011 6709.00
Ma, James R. Mateer
114493 Essential Musculoskeletal Mri, Michelle Anna Wessely 2010 4391.00
114498 Introduction to Radiologic Technology , La Verne Tolley Gurley 2010 4391.00
114577 Sonography, Reva Arnez Curry 2010 9149.00
114597 Imaging of Diseases of the Chest, David M. Hansell 2009 22570.00
114919 Functional Magnetic Resonance Imaging Huettel S. 2009 7075.00
115068 Breast Cancer Imaging Ii, An Issue of Pet Clinics,4-4 Sandip Basu 2010 6099.00
115223 Emergency Medicine Sonography: Pocket Guide to Abraham 2009 2561.00
Sonographic Anatomy and Pathology
115371 NEUROSONOLOGIJA VIDA DEMARIN I DRUGI 5496.00

116134 EXAM PREP ULTRASOUND ABDOMEN OBS GYN PENNY 2010 5734.00
PB
116136 DIAG PATHOLOGY SOFT TISSUE AMIRSYS CB FISHER 2010 23302.00
116652 Gastrointestinal Imaging (RadCases) Lorenz 2010 4173.00
116653 Thoracic Imaging (RadCases) Restrepo 2010 4173.00
116654 CT Teaching Manual: A Systematic Approach to CT Matthias Hofer 2010 5935.00
Reading
118088 Kolor dupleks sonografija u radiološkoj praksi =RUDQ/LþDQLQ 2010 4320.00
118233 Interventional Radiology: a Survival Guide, David Kessel 2010 4879.00
118477 Radiološka tehnologija u praksi Klanfar, Z. i sur 2009 3528.00
118479 Film i fotokemijska obrada u radiologiji Klanfar, Z. 2010 2352.00
119695 Cerebrovaskularne bolesti 6YHWRPLU3,YDQRYLü 2010 7560.00
120083 8OWUD]YXþQDGLMDJQRVWLNDORNRPRWRUQRJVLVWHPD /D]DU3HWNRYLü 2008 918.00
reumatologija
18883 8ULþQLDUWLWULV 6ODYNRýXQRYLü 2000 1750.00
18944 Fizijatrijsko reumatološka propedeutika ,YR-DMLü 2004 2800.00
19589 PSIHOREUMATOLOŠKA DIJAGNOSTIKA U PRAKSI Hartwig Mathies 2001 1050.00
VWUXþQLXUHGQLN7KHRGRU
Dürrigl
26093 MANUAL OF RHEUMATOLOGY AND OUTPATIENT PAGET 2005 3904.00
ORTHOPEDIC DISORDERS 5E-IE
26907 Izvanzglobni reumatizam i srodna stanja ,YR-DMLüL=ULQND-DMLü 2005 3500.00
30627 Oxford Handbook of Rheumatology (2/e)-IE Hakim, Alan; Clunie, Gavin; 2006 3375.00
Haq, Inam
43952 Internal Derangements of Joints, 2nd edition Donald Resnick 2006 35380.00
47462 CURRENT DIAGNOSIS & TREATMENT IN IMBODEN 2007 4002.00
RHEUMATOLOGY ISE
55150 Kelley's Textbook of Rheumatology, 8th Edition Gary S. Firestein 2008 29768.00
2-Volume Set, Expert Consult: Online and Print

96 od 116
2-Volume Set, Expert Consult: Online and Print

70112 Reumatologija za praksu sa fizijatrijom u reumatologiji 0LRPLU5LVWLü,YDQ 2004 1296.00


=JUDGLü$OHNVDQGDU-RNLü
71196 Arthritis and Arthroplasty: The Shoulder (Expert David Dines 2009 18056.00
Consult - Online, Print and DVD)

71605 Infections and Rheumatic Diseases, An Issue of Espinoza 2009 6099.00


Rheumatic Disease Clinics, Volume 35-1

74366 Oxford Handbook of Musculoskeletal Nursing Oliver, Susan 2009 2870.00


74373 Myotonic Dystrophy (2/e) Harper, Peter 2009 1749.00
74733 First Aid for the Orthopaedic Boards, Second Edition Robert A. Malinzak, Mark J. 2009 5367.00
(First Aid Specialty Boards) Albritton, Trevor R Pi
110854 Harrison's Rheumatology, Second Edition Anthony S. Fauci, Carol 2010 5245.00
Langford
111084 Rheumatology, 2-Volume Set: EXPERT CONSULT - Marc C. Hochberg 2010 29402.00
ENHANCED ONLINE FEATURES AND PRINT, 5 Ed
111585 Essential Applications of Musculoskeletal Ultrasound in Richard J. Wakefield 2010 14518.00
Rheumatology,
111615 Fam's Musculoskeletal Examination and Joint Injection George V. Lawry 2010 7563.00
Techniques,2ed
111812 Križobolja Grazio S., Buljan D. 2009 4116.00
111878 Orthopaedics and Rheumatology In Focus, Ariane L. Herrick 2009 2195.00
114833 Integrative Rheumatology, Allergy, and Immunology Horwitz, Randy; Muller, 2010 3439.00
Daniel
sportska medicina
6886 *sp* Measurement and Evaluation in Human James R. Morrow, Allen W. 2000 2953.00
Performance Jackson, James G. Disch
17998 Science of Flexibility Michael J. Alter 2004 4819.00
18000 *sp* Research Methods in Physical Activity Jerry R. ThomasiJack K. 2001 3019.00
Nelson
18874 Športska medicina 0DUNR3HüLQD 2003 1120.00
21638 *sp* Sports Medicine McCann, Peter D. 2004 6661.00
24370 Preparticipation Physical Evaluation Physician and Sports 2004 2927.00
Medicine
24371 Bull's Sports Injuries Handbook William O. Roberts 2004 4757.00
25372 *sp* Foundations of Sport and Exercise Psychology Weinberg, Robert S. 2005 2974.00
30424 Kinetic Anatomy: The Essentials of Human Anatomy Robert A. Behnke 2006 5206.00
(Book & CD Rom)
30425 Biomechanics of Sport and Exercise 2 Rev ed 2005 6094.00
30426 Fitness After 50 Wright, Brenda 2006 1707.00
30429 *sp* Introduction to Kinesiology Hoffman, Shirl J. 2005 3288.00
30516 Disordered Eating Among Athletes Beals, Katherine A. 2004 3721.00
36526 Oxford Handbook of Sports and Exercise Medicine MacAuley, Domhnall 2006 2750.00
37094 Sportska medicina 'XãDQ/HNLü 2001 810.00
37344 Fiziologija sporta 'XãDQ/HNLü 2001 810.00
37345 Sportska medicina 8UHGQLFL0LFLüL1HãRYLü 2002 1080.00
43473 An Introduction to Biomechanics of Sport and Exercise James Watkins 2007 3415.00
46071 Povrede u sportu GU'UDJROMXE0%DQRYLü 2006 2862.00
46212 Power Eating: Build Muscle Increase Energy Cut Fat Susan M. Kleiner, Maggie 2006 1585.00
Greenwood-Robinson
46216 Principles and Practice of Resistance Training Michael Stone; Margaret 2007 6039.00
Stone; William A. Sands
47831 Oxford Dictionary of Sports Science and Medicine (3/e) Kent, Michael 2006 999.00
97 od 116
48056 Athletic Abs Cole, Scott; Seabourne, 2002 1463.00
Tom
48394 Physical Therapies in Sport and Exercise, 2nd edition Gregory Kolt 2007 9271.00
48438 Dance Anatomy and Kinesiology Clippinger, Karen 2007 4392.00
48442 Practical Sports Nutrition Louise Burke 2007 6039.00
48448 Physical Activity and Health Claude Bouchard, Steven 2006 6094.00
Blair, William Haskell
48511 Current Diagnosis and Treatment in Sports Medicine McMahon, Patrick J 2006 4635.00
(Lange Medical Books)
48569 Fitness Professional's Handbook Edward T. Howley; B.Don 2007 6039.00
Franks
48701 Planet Health 2 Rev ed Carter, Jill; Gortmaker, 2007 3567.00
Steven Lawrence; Nobrega,
49332 ACSM's Primary Care Sports Medicine Douglas B. McKeag, James 2007 9760.00
L. Moeller
53533 Christian Paths to Health and Wellness 2007 2501.00
53535 Endurance Sports Nutrition 2 Rev ed 2007 1463.00
55836 Kineziterapija sustava za kretanje Dr. se. Zdenko Kosinac 2008 3888.00
59932 Delee & Drez's Orthopaedic Sports Medicine: Jesse Delee 2008 32696.00
Principles and Practice (Hardcover)
60000 Sports Injury Outcomes and Prevention, An Issue of Joseph M. Hart 2008 7807.00
Clinics in Sports Medicine (The Clinics: Orthopedics)
60112 *sp* Martindale's Drugs Restricted in Sport 2008 2008 490.00
Pocket Companion
60373 Essentials of Strength Training and Conditioning 3rd Thomas Baechle and Roger 2008 6039.00
Edition Earle
61854 Fitnes kuharica Hubert Horn i Gert Schill 1862.00
61862 Joga kuharica Sivananda Vedanta joga 2170.00
centri
61867 Mentalni trening za sportaše Terry Orlick, PhD 1944.00
61883 Periodizacija - teorija i metodologija treninga Tudor Bompa 2009 3456.00
61952 Sportska prehrana, 2 Ed (meki uvez) Nancy Clark 2008 2700.00
62093 Steroidi W.Nathaniel Phillips 1944.00
62108 Stretching - Vježbe istezanja Bob Anderson 1997 1836.00
62116 8PMHWQRVWOLMHþHQMDVSRUWVNRPPDVDåRP Joan Johanson 1836.00
62152 Vežbanje i zdravlje Brian J. Sharkey, Steven E. 2008 1595.00
Gaskill
63517 Gymnastics and Politics: Niels Bukh and Male Hans Bonde 2006 5904.00
Aesthetics
64367 ENGLISH IN SPORTS 0LUD00LOLü 2007 832.00
65863 9RGLþ]DLVKUDQXVSRUWLVWDEROMLVSRUWVNLUH]XOWDWLYLãH Fajl, Vofgang - autor 2006 756.00
PLãLüDPDQMHPDVQRJWNLYDEH]VODELKWDþDNDQD
WHWLYDPDPLãLüLPD
67752 ,VSLWLYDQMHVQDJHPLãLüDPDQXHOQDPHWRGD Zec, Živojin - autor 2007 594.00
68047 PSIHOLOGIJA SPORTA - koncepti i primjene richard h. cox 2005 4116.00
68262 BIOMECHANICAL BASIS HUMAN MOVE 3E CB HAMILL 2008 4757.00
68282 SPORTS MEDICINE & REHABILITATION 2E CB BUSCHBACHER 2008 10126.00
68848 Sports Medicine Drez, Jr./Bach, Jr/Nofsin 2008 4270.00
69015 ACSM's Guidelines for Exercise Testing and ACSM 2009 2434.00
Prescription 8E
69016 ACSM's Exercise is Medicine: A Clinician's Guide to ACSM 2009 4026.00
Exercise Prescription
69108 The Athlete's Shoulder, James Andrews 2008 12566.00

98 od 116
69423 Foundations of Sport And Exercise Psychology Robert S. Weinberg, Daniel 2007 6039.00
Gould
70302 Osnove sportske medicine Richard Higgins, Peter 2009 1095.00
Brukner, Bryan English
71689 Netter's Sports Medicine, Christopher Madden 2009 7929.00
74188 Sports Development and Sports Polic Bloyce 2009 3049.00
74211 Sports Injury Research Verhagen, Evert; van 2009 4370.00
Mechelen, Willem
74508 Nutrition for Health, Fitness & Sport Melvin H Williams 2009 5611.00
74789 McGraw-Hill's NPTE (National Physical Therapy Mark Dutton 2009 6221.00
Examination) (Lange)
75053 Hard Work:Defining Physical Work Performance Brian J. Sharkey, Paul O. 2008 5612.00
Requirements Davis
76572 *sp* Statistics in Kinesiology William J. Vincent 1999 1342.00
76751 Clinical Sports Medicine Book (Revised) & Clinical Brukner 2009 9149.00
Sports Medicine DVD Package
77995 Cardiovascular Physiology in Exercise and Sport, Christopher Bell 2008 2683.00
78000 Baxter's The Foot and Ankle in Sport, David A. Porter 2007 15372.00
82871 Sport Mechanics for Coaches Brendan Burkett 2010 3166.00
83231 Fundamentals of Sport and Exercise Psychology Alan S. Kornspan 2009 2195.00
(Human Kinetics' Fundamentals of Sport and Exercise
Science Series)
83237 Soft Tissue Release: Hands-on Guides for Therapists Jane Johnson 2009 1829.00
110109 Sports Emergencies, John M. O'byrne 2010 3903.00
110363 Clinical Sports Nutrition Louise Burke 2010 5489.00
110891 Essentials of Exercise Physiology 4E (INT ED) PB MCARDLE 2010 3659.00
113867 Rehabilitation Techniques for Sports Medicine Prentice 2010 5001.00
113967 Fundamentals of Sport and Exercise Nutrition Marie Dunford 2010 2434.00
(Fundamentals of Sport and Exercise Science)
113968 The Nutrient Timing for Peak Performance Heidi Skolnik, Andrea 2010 1585.00
Chernus
117217 5-MINUTE SPORTS MEDICINE CONSULT 2E CB BRACKER 2011 7198.00
stomatologija
26271 Smile Design Chiche, Gerard J. 2004 9516.00
37046 Mastering Digital Dental Photography Bengel, Wolfgang 2006 14640.00
40210 Netter's Head and Neck Anatomy for Dentistry Neil Norton 2006 3781.00
61955 'HþMDVWRPDWRORJLMD Dragan Beloica 2005 1620.00
74224 Orofacial Pain Zakrzewska, Joanna M. 2009 3745.00
78785 Head and Neck Anatomy for Dental Medicine Michael Schünke, Erik 2010 6475.00
Schulte, Udo Schumacher
114948 Oral and Maxillofacial Surgery Andersson L 2010 21959.00
stomatologija-bolesti zuba sa endodoncijom (restaurativna stomatologija)
8482 Dentin adhezivna sredstva u stomatologiji 6ODYROMXEäLYNRYLü 2007 1190.00
19809 Essentials of Dental Caries (3/e) Kidd, Edwina 2005 3375.00
25489 Pocket Atlas of Endodontology Rudolf Beer 2005 3775.00
26270 Adhesive Technology for Restorative Dentistry Jean-Francois Rouleti 2004 8906.00
31323 Practical Clinical Endodontics Lumley 2006 5611.00
35176 .OLQLþNDHQGRGRQFLMD Tronstad 2007 1990.00
35694 Fundamentals of Operative Dentistry: A Contemporary Hilton, Thomas J.; Robins, 2006 6832.00
Approach, 3 Ed J. Williams; Schwartz,
49337 Minimally Invasive Dentistry: The Management of Wilson, Nairn H.F.; Wilson, 2007 6710.00
Caries Nairn H.F.
99 od 116
53601 Biologija pulpe i dentina u restaurativnoj stomatologiji Ivar A. Mjor 2008 2495.00
55117 Endodontics: Principles and Practice, 4 Ed Mahmoud Torabinejad 2008 9149.00
59559 Successful Posterior Composites (Quintessentials of Christopher Lynch 2008 3416.00
Dental Practice)
60930 Ingle's Endodonics Ingle, Bakland, 2008 13175.00
Baumgartner
68980 Endodontic Microbiology Fouad AF 2009 10369.00
69704 Practical Lessons in Endodontic Treatment Donald E. Arens 2009 10004.00
69710 Esthetics with Resin Composites: Basics and Burkard Hugo 2009 19276.00
Techniques
72402 Clinical Endodontics: A Textbook Leif Tronstad 2008 5395.00
74722 PDQ Endodontics John I. Ingle 2009 3659.00
75150 Clinical Success in Endodontic Retreatment Stephane Simon 2009 10004.00
75163 Endodontic Microsurgery Enrique Merino 2009 20008.00
75411 Osnovi restaurativne stomatologije 6ODYROMXEäLYNRYLü 2009 2790.00
75418 Solutions for Dental Esthetics: The Natural Look Toyohiko Hidaka 2008 8296.00
76858 Textbook of Endodontology 2e Bergenholtz G 2009 9759.00
82715 (QGRGRQFLMD1DþHODLSUDNVD Torabinejad, Walton 2010 11025.00
83054 Cohen's Pathways of the Pulp Expert Consult, 10th Kenneth M. Hargreaves 2010 11833.00
Edition

108965 Osnovi zubnog karijesa Edwina A. M. Kidd 2010 1590.00


109365 Removable Partial Dentures Garcia LT 2009 7685.00
109373 Problem Solving in Endodontics, James L. Gutmann 2010 9149.00
110105 Harty's Endodontics in Clinical Practice Text and Bun San Chong 2010 6587.00
Evolve ebooks Package,
VWRPDWRORJLMDGHþMDVWRPDWRORJLMD
20188 Clinical Problem Solving In Paediatric Dentistry And Declan Millett 2005 4879.00
Orthodontics
49339 Community Oral Health Harris; Pine 2007 6100.00
59990 Handbook of Pediatric Dentistry Cameron, Widmer 2008 5855.00
68023 3HGRGRQFLMDNOLQLþNLSULVWXS Goran Koch, Sven Poulsen 2005 11025.00
76553 Pediatric Dentistry - A Clinical Approach 2e Koch G 2009 10979.00
82979 Case Reports in Paediatric Dentistry Evert van Amerongen 2009 8784.00
83051 Mcdonald and Avery Dentistry for the Child and Jeffrey A. Dean 2010 8539.00
Adolescent, 9 Ed
109359 Early Childhood Oral Health Berg J 2009 8539.00
stomatologija-multidisciplinarno
6027 *sp* Dental Practitioners` Formulary 2002-2004 2002 400.00
19807 Integrated Dental Treatment Planning: A Case Based ELIZABETH J. KAY,Ann C. 2005 3120.00
Approach Shearer,A.
Bridgman,Gerald
26273 Dentists Who Care: Inspiring Stories of Professional James T. RuleiMuriel J. 2005 2074.00
Commitment Bebeau
30613 Oxford Handbook of Dental Patient Care Scully, Crispian 2005 2875.00
36242 Legal Aspects of General Dental Practice Len D'Cruz 2006 5367.00
38924 Precision in Dental Esthetics Massironi, D 2006 19154.00
43983 Churchill's Pocketbooks Clinical Dentistry, IE 3 Ed Chestnutt 2007 2185.00
44064 *sp* Lexi-Comp's Drug Information Handbook for Wynn, Meiller, Crossley 2007 900.00
Dentistry
46933 5MHþQLNHQJOHVNRQMHPDþNRKUYDWVNLVWRPDWRORãNL 0DULQ9RGDQRYLü 2005 4714.00
48197 Successful Esthetic and Cosmetic Dentistry for the J. Calamia 2007 6831.00
100 od 116
Modern Dental Practice, An Issue of Dental Clinics
49341 Hypnosis and Communication in Dental Practice Potter; Simons; Temple 2007 4636.00
49346 A Dental Treasure Chest: Tips And Tricks for Daily Bucking, Wolfram 2006 11102.00
Practice
51061 Mosby's Dental Dictionary, 2nd edition Mosby 2007 3415.00
55122 Dental Instruments, 3 Ed Linda Bartolomucci Boyd 2008 3415.00
A Pocket Guide

58845 Kontrola infekcije u stomatološkim ustanovama 9DQMD9XþLüHYLü%RUDV 2008 840.00


59531 Evidence-based Dentistry: Managing Information for Derek Richards, Jan 2008 3416.00
Better Practice (Quintessentials of Dental Practice) Clarkson, Debora Matthews
60618 Stedman's Medical Dictionary for the Dental Stedman 2007 3044.00
Professions
68985 Dentist's Guide to Medical Conditions and Ganda K 2008 4879.00
Complications
70638 Orofacijalna genetika ,OLMDâNULQMDULü 2006 5564.00
71640 Mosby's Dental Drug Reference, 9 Ed Mosby 2009 4025.00
71712 Infection Control and Management of Hazardous Chris H. Miller 2009 4269.00
Materials for the Dental Team, 4th Edition

72251 Oxford American Handbook of Clinical Dentistry Da Silva 2007 3125.00


72615 Oxford Handbook of Clinical Dentistry (5/e) L.Mitchell; D. Mitchell 2009 2750.00
74897 Kompjuterska stomatologija %0LKDLORYLü00LODGLQRYLü 2009 1377.00
'0ODGHQRYLü=/D]Lü
75142 Change Your Smile: Discover How a New Smile Can Ronald E. Goldstein 2009 2410.00
Transform Your Life
75418 Solutions for Dental Esthetics: The Natural Look Toyohiko Hidaka 2008 8296.00
76538 Clinical Problem Solving in Dentistry, 3 Ed Edward W Odell 2010 4879.00
76700 Oral Pathology for the Dental Hygienist, 5th Edition Olga A. C. Ibsen 2008 6831.00

82489 Medical Problems in Dentistry,6 Ed Crispian Scully 2010 8539.00


109900 1HPDþNRVUSVNLUHþQLNXVWDL]XEL 'HXWVFK 6LPLü0LORUDGDXWRU 2004 216.00
serbische Wörterbuch : Mund und Zähne L]GDYDþ
110106 Pharmacology and Therapeutics for Dentistry, John A. Yagiela 2010 7929.00
115360 GERONTOSTOMATOLOGIJA 2010 2660.00
stomatologija-opštemedicinski predmeti u stomatologiji
50087 Otorinolaringologija za studente stomatologije 'RFGU,YLFD3HQÿHU 2006 1188.00
57998 Neurologija za stomatologe Demarin, Trkanjec 2008 2786.00
stomatologija-oralna histologija
68916 Oral Anatomy, Histology & Embryology 4thed -IE Berkowitz 2009 3825.00

115237 Osnovi oralne histologije i embriologije James K. Avery, Daniel J 0.00


Chiego
115238 Osnovna i oralna histologija i embriologija 9HVQD/DþNRYLü,YDQ 0.00
1LNROLü9HUD7RGRURYLü
stomatologija-oralna i maksilofacijalna hirurgija
19547 Oralna hirurgija /M7RGRURYLü93HWURYLü 2007 2052.00
0-XULãLü
26516 Praktikum oralne hirurgije $0DUNRYLü6ýROLü0 2003 1691.00
5DGXORYLüLGUXJL
32819 Atlas oralne hirurgije 3URIGU9ODVWLPLU3HWURYLü 2006 2990.00
50574 Anestezija u stomatologiji /M7RGRURYLü93HWURYLü= 2003 648.00
6WUDMþLü.$YUDPRYLü
101 od 116
56573 Illustrated Lecture Notes in Oral and Maxillofacial George Dimitroulis 2008 13176.00
Surgery
59522 Cone-beam Volumetric Imaging in Dental, Oral and Joachim Zoller, Jorg 2008 14396.00
Maxillofacial Medicine: Fundamentals, Diagnostics and Neugebauer
Treatment Planning
59968 Oral and Maxillofacial Surgery: 3-Volume Set Fonseca, Turvey, Marciani 2008 49532.00
60189 Fundamentals Of Orthognathic Surgery, 2 Ed Malcolm Harris 2008 7906.00
68521 Hemostaza u stomatološkoj praksi 3HURYLü-RYDQ9DXWRU 2002 648.00
72963 Oral and Maxillofacial Surgery, Vol 1 Raymond J. Fonseca 2008 21106.00
74896 Krvarenje i hemostaza u oralnohirurškoj praksi %9XMLþLü/0DþXNDQRYLü 2009 1690.00
*ROXERYLü
75153 Clinical Success in Bone Surgery with Ultrasonic Marie G. Poblete-Michel, 2009 8540.00
Devices Jean-Francois Michel
76872 Local Anaesthesia in Dentistry Baart JA 2008 4269.00
76873 Clinical Sedation in Dentistry Girdler NM 2009 4269.00
108891 Bone Reformation: Contemporary Bone Augmentation Stefan Lundgren, Lars 2008 8296.00
Procedures in Oral and Maxillofacial Implant Surgery Sennerby
110107 Principles and Practice of Laser Dentistry, Robert A. Convissar 2010 12566.00
110347 Oxford Textbook of Anaesthesia for Oral and Shaw, Ian; Kumar, 2010 11880.00
Maxillofacial Surgery Chandra; Dodds,
Christopher
stomatologija-oralna implantologija
8506 Oralna implantologija 3HURYLü-RYDQ9 2004 648.00
29663 Bone Grafting Techniques for Maxillary Implants Kahnberg 2005 9760.00
49345 Bone Augmentation in Oral Implantology Antoun, Hadi; Khoury, 2006 21594.00
Fouad; Missika, Patrick
58713 Oralna implantologija -XULãLü0LODQ6WDPHQNRYLü 2008 6480.00
'UDJRVODY0DUNRYLü$OH
59528 ITI Treatment Guide: Loading Protocols in Implant 2007 7442.00
Dentistry - Partially Dentate Patients v. 2
59560 The Art of Computer-guided Implantology Tardieu, Rosenfield 2009 12810.00
68978 Implant Restorations - A Step-by-Step Guide Drago C 2007 6831.00
75145 Oral and Implant Surgery: Principles and Procedures Thomas Lambrecht 2009 19520.00
76857 Implant and Regenerative Therapy Fugazzotto PA 2009 10125.00
81246 Color Atlas of Dental Implant Surgery,3ed Michael S. Block 2010 16470.00
82393 Esthetics in Implantology Jose B. Das Neves 2009 15616.00
82397 Dental Implants, 2nd Edition Charles A. Babbush 2010 18056.00
The Art and Science

82398 Atlas of Oral Implantology, Pankaj Singh 2009 17202.00


111553 Implant Dentistry,2ed Arun K. Garg 2009 10247.00
116006 Dental Implant Complications - Etiology Froum S 2010 12809.00
Prevention and Treatment
116007 Implant Laboratory Procedures - A Step-By-Step Drago C 2010 7319.00
stomatologija-oralna medicina
20564 Treatment of Oral Diseases Laskaris, George 2005 5395.00
21816 3ULUXþQLNRUDOQLKEROHVWL 99%RUDV$QÿD5DLþ 2005 2800.00
37595 Burketova oralna medicina, 10. izdanje Greenberg & Glick 2006 9800.00
48515 Burket's Oral Medicine, 11 Ed Greenberg, Glick, Ship 2008 6709.00
55102 Oral Pathology:Clinical Pathologic Correlations 5e, IE Regezi, Sciubba & Jordan 2008 6694.00
55107 Oral and Maxillofacial Medicine, 2nd Edition Crispian Scully 2008 5977.00
The Basis of Diagnosis and Treatment

102 od 116
55744 Oralna medicina-praktikum SURI-DQNRYLü/MLOMDQD 2007 490.00
58081 Salivary Diagnostics Wong D 2008 9150.00
60303 Cawson's Essentials of Oral Pathology and Oral Cawson 2008 3551.00
Medicine, International Edition, 8th Edition

61238 Atlas bolesti usta 'ĈXNDQRYLü'ĈDMLü 2008 3456.00


62002 Preventivna stomatologija 9XORYLü 2005 1728.00
65983 Bolesti usta ĈDMLü'UDJROMXEDXWRU 2008 4320.00
68864 Color Atlas of Common Oral Diseases, 4 Ed LANGLAIS 2009 3654.00
74200 Applied Medicine and Surgery in Dentistry (3/e) Scully, Kalantzis 2009 4125.00
75460 Lexi-Comp's Oral Soft Tissue Diseases Manual: A NEWLAND 2008 5734.00
Reference Manual for Diagnosis and Management, 4
Ed
83753 Dental Practice: Get in the Game Okuji 2010 3904.00
stomatologija-oralna mikrobiologija
62001 Oralna mikrobiologija Pavlica, Dušan - autor 2008 335.00
68980 Endodontic Microbiology Fouad AF 2009 10369.00
76874 Oral Microbiology at a Glance Lamont R 2010 3049.00
81188 Stomatološka mikrobiologija 9ODGLPLU3UHVHþNL 2009 5320.00
stomatologija-ortodoncija (ortopedija vilica)
21727 The Orthodontic Patient Ireland, A.J. 2003 4250.00
22687 Orthodontics: Current Principles and Techniques, 4 Ed Thomas M. Graber 2005 18544.00
25488 *sp* Orthodontic Pearls &Tricks Mizrahi 2004 6832.00
43528 Contemporary Orthodontics,4 Ed William R. Proffit 2007 10979.00
65814 2UWRGRQWVNLSDFLMHQWOHþHQMHLELRPHKDQLND Anthony J. Ireland, Fraser 2010 1790.00
McDonald
71822 Tip-Edge Orthodontics and the Plus Bracket, 2nd Richard Parkhouse 2008 13298.00
Edition

82716 Ortodoncija Proffit, Fields, Server 2010 17640.00


113706 Clinical Problem Solving in Orthodontics and Paediatric Declan Millett 2010 5367.00
Dentistry Text and Evolve ebooks Package,2 Ed
114040 Diagnosis and Treatment of Simple Orthodontic Staley R 2010 6099.00
Problems
114043 Three-Dimensional Imaging for Orthodontics and Kau CH 2010 11590.00
Maxillofacial Surgery
114130 Manual of Wire Bending Techniques Elichiro Nakajima 2010 7930.00
stomatologija-parodontologija
19719 *sp* Fundamentals of Peridontal Instrumentation and Nield-Gehrig, Jill S. 2004 1500.00
Advanced Root Instrumentation
20559 Periodontology Mueller 2005 4855.00
23612 Color Atlas of Dental Medicine, Vol.1 : Periodontology Klaus H. Rateitschak 2005 21595.00
25766 Periodontics, An Issue of Dental Clinics Scannapieco 2005 5977.00
45365 Fundamentals of Periodontal Instrumentation and Nield-Gehrig 2007 4264.00
Advanced Root Instrumentation (Spiral-bound)
46989 Reinforced Periodontal Instrumentation and MILLAR 2007 2135.00
Ergonomics for the Dental Care Provider
61235 Atlas paradontologije 'ĈDMLü'ĈXNDQRYLü 2006 2916.00
61236 Parodontologija 'ĈXNDQRYLþ'ĈDMLü 2006 972.00
68979 Practical Advanced Periodontal Surgery Dibart S 2007 4879.00
75418 Solutions for Dental Esthetics: The Natural Look Toyohiko Hidaka 2008 8296.00
79278 Periodontics, 6th Edition Barry M. Eley 2010 6953.00
103 od 116
80537 Parodontologija Wolf, Rateitschak-Plüss, 2009 17640.00
Rateitschak,
114589 Carranza's Clinical Periodontology Expert Consult, 11th Michael G. Newman 2011 11833.00
Edition
Text with Continually Updated Online Reference
stomatologija-stomatološka protetika
8297 The Science and Art of Porcelain Laminate Veneers Galip Gurel 2003 18056.00
8368 Introduction to Metal Ceramic Technology Naylor 6222.00
42256 7HPSRURPDQGLEXODUQLSRUHPHüDMLLVWRPDWRORãND Tomislav Badel 2007 4200.00
protetika
50085 Stomatološka protetika- parcijalne proteze 'UDJRVODY6WDPHQNRYLü 2006 4860.00
50180 Clinical Problem Solving in Prosthodontics David Bartlett 2003 4513.00
53855 7HPSRURPDQGLEXODUQLSRUHPHüDMLLRNOX]LMDL]G 2NHVRQ9DOHQWLü3HUX]RYLü 2008 6300.00
56111 ESTHETIC REHABILITATION IN FIXED Mauro, M.D. Fradeani, 2008 28060.00
PROSTHODONTICS, Vol 2: Prosthetic Treatment, a Giancarlo Barducci
Systematic Approach to Esthetic, Biologic, and
Functional Integration: 2
61957 Bezubost : klinika, dijagnoza, tretman 6RNRORYLü%XGLPLU 1997 1620.00
75418 Solutions for Dental Esthetics: The Natural Look Toyohiko Hidaka 2008 8296.00
98837 Clinical Success in Immediate Complete Dentures: An Michel I. Pompignoli, Michel 2008 6344.00
Alternative Approach Postaire, Didier Raux
stomatologija-stomatološka radiologija
47309 Pocket Atlas of Dental Radiology Pasler, Visser 2007 3775.00
59943 Radiography and Radiology for Dental Care Eric Whaites 2008 2439.00
Professionals
66281 Oral Radiology 6th ed White 2008 4098.00
75177 Colour Atlas of Cone Beam Volumetric Imaging for Dale A. Miles 2009 11956.00
Dental Applications
83066 Radiology for the Dental Professional, Herbert H. Frommer 2010 5367.00
111558 Radiology for the Dental Professional - Text and Study Herbert H. Frommer 2010 6709.00
Guide Package,9ed
114043 Three-Dimensional Imaging for Orthodontics and Kau CH 2010 11590.00
Maxillofacial Surgery
stomatologija-stomatološki materijali
31404 Craig's Restorative Dental Materials, 12th edition Powers 2006 7075.00
48404 Introduction to Dental Materials, 3rd edition Richard Van Noort 2007 5367.00
59901 Dental Materials: Properties and Manipulation (Dental John M. Powers, John C. 2007 5001.00
Materials: Properties & Manipulation (Craig)) Wataha
68983 Applied Dental Materials 9e McCabe J 2008 4513.00
75419 Introduction to Metal-ceramic Technology Patrick Naylor 2009 8296.00
76877 Basic Guide to Dental Materials Scheller-Sherid C 2010 2927.00
83067 Dental Materials, Carol Dixon Hatrick 2010 4879.00
91296 Tooth Whitening in Esthetic Dentistry: Principles and So-Ran Kwon, Seok-Hoon 2008 13176.00
Techniques/Communication Tools Ko
109696 Clinical Aspects of Dental Materials, 3e Gladwin/ Bagby 2010 5124.00
stomatologija-urgentna stomatologija
42537 Medical Emergencies in the Dental Office, 6th edition Stanley Malamed 2007 6709.00
70830 First Aid A&A for the NBDE Part I 1ed ISE Steinbacher 2009 2190.00

76878 Basic Guide to Medical Emergencies in the Dental Jevon P 2009 2805.00
Practice

104 od 116
120806 Urgentna medicina u stomatološkoj praksi : prvi kontakt 9XþRYLü'UDJDQDXWRU 2011 1728.00
EROHVQLNDVDOHNDURPXYHOLNRMPHULUHãDYDLL]OHþHQMH
toksikologija
2751 *sp* Lehrbuch der Toxikologie Marquardt 400.00
17791 Dreisbach's Handbook of Poisoning Dreisbach, Robert H. 2001 4269.00
24607 7URYDQMDSUHYHQFLMDGLMDJQR]DLOHþHQMH Robert Dreisbach, Bev- 2005 1790.00
Lorraine
30953 Pharmaceutical Toxicology G J Mulder & L Dencker 2006 3837.00
36003 Free Radicals in Biology and Medicine (4/e) Halliwell, Barry; Gutteridge, 2007 5940.00
John
39626 MANUAL OVERDOSES & POISONINGS IRWIN 2005 2678.00
49011 Clarke's Analytical Forensic Toxicology Edited by Sue Jickells 2008 5123.00
51134 CASARETT AND DOULL'S TOXICOLOGY : THE Klaassen, Curtis D. 2007 11590.00
BASIC SCIENCE OF POISONS 7 Rev ed
60148 Biomarker Methods in Drug Discovery and 2008 11334.00
Development (Methods in Pharmacology and
Toxicology)
60770 A Guide to Practical Toxicology: Evaluation, Prediction, Adam Woolley 2008 6100.00
and Risk, Second Edition
61740 Toksikologija -RNDQRYLü0LODQDXWRU 2001 1080.00
112492 CASARETT & DOULL'S ESSENTIALS OF WATKINS III 2010 5245.00
TOXICOLOGY

116706 Illustrated Handbook of Toxicology Franz-Xaver Reichl 2011 7555.00


urgentna medicina
16755 Ultrasound in Emergency Care - IE Brooks,Adam Brooks,Jim 2004 2745.00
Connolly,OTTO CHAN
16914 Emergency Triage - IE Not Applicable (Na ) 2006 1824.00
18926 Ozljede prsnog koša 7RPLVODY9ODGRYLü5HOMD 2000 2100.00
24289 Emergency Ultrasound Karen S. Cosby 2005 6466.00
32927 Urgentna medicina $UJLURYLü5DGRMND 2002 4633.00
$WDQDVLMHYLü7DWMDQD%DMHF
ĈRU
34778 Lecture Notes: Emergency Medicine, 3 Ed - IE Moulton 2006 1830.00
36182 Signs and Symptoms in Emergency Medicine, 2nd Mark Davis 2006 4025.00
edition
36983 FORENSIC EMERGENCY MEDICINE 2E OLSHAKER 2006 7808.00
39625 *sp* Primary Care Medicine: Office Evaluation and GOROLL 2005 2500.00
Management of the Adult Patient,5 Ed
47437 JUST THE FACTS IN CRITICAL CARE MEDICINE ISE HALL 2007 3033.00

47441 Wound Care Essentials: Practice Principles Sharon Baranoski, 2007 3044.00
Elizabeth A. Ayello
53889 CURRENT DIAGNOSIS AND TREATMENT: STONE 2007 3415.00
EMERGENCY MEDICINE
59935 Oh's Intensive Care Manual Bersten , Soni 2008 8051.00
61051 Emergencies in Clinical Medicine Page, Piers; Skinner, Greg 2008 2745.00
61129 Trauma Care Manual Second Edition Ian Greaves 2008 4269.00
61642 FIRST AID FOR THE EMERGENCY MEDICINE Barbara Blok, Dickson 2008 5489.00
BOARDS (First Aid Specialty Boards) Cheung, Timothy
Fortescue P
61996 Urgentna stanja u internoj medicini : prehospitalni i rani 6LPHXQRYLü6ODYLFD 2008 1080.00
hospitalni
62013 Maintaining Control: An Introduction to the Effective John Edward Gillett 2003 2805.00
105 od 116
Management of Violence and Aggression
62025 Respiratory Emergencies Alan M Fein 2006 17080.00
62100 Urgentna medicina : brzi pregled NJutn, Kristofer R. - autor 2007 1296.00
64331 9RGLþ]DSUHKRVSLWDOQR]EULQMDYDQMHSRYUHÿHQRJ 6LPHXQRYLü6ODYLFDDXWRU 2007 864.00
pacijenta
64335 Praktikum urgentne medicine 5LVWLü,YDQ'DXWRU 2007 680.00
64337 Urgentna medicina kroz primere iz prakse 5LVWLü,YDQ'DXWRU 2008 1512.00
64340 3UYDSRPRü Aleksandar Pavlovic 2007 2106.00
65455 Family Medicine: Ambulatory Care and Prevention, Mark B. Mengel, L. Peter 2009 4147.00
Fifth Edition: Ambulatory Care and Prevention (Lange Schwiebert
Clinical Medicine)
66415 Procedures in Critical Care Iii, C. William Hanson 2009 12809.00
66432 DEJA REVIEW: EMERGENCY MEDICINE-ISE JANG 2008 1585.00
66481 Oxford Handbook of Clinical Medicine and Longmore, Murray; 2008 4996.00
Emergencies in Clinical Medicine Pack Wilkinson, Ian; Turmezei,
Tom; C
68455 Emergencies in Trauma and Orthopaedics Bhangu, Aneel; Lee, 2009 2495.00
Caroline; Porter, Keith
69264 8UJHQWQLSRUHPHüDMLGLVEDODQVDYRGHLHOHNWUROLWD 9XNXãLü=YRQLPLUDXWRU 2009 540.00
YRGLþNUHDWLYQHGLMDJQRVWLNHVWHSE\VWHSSURWRNRO
UHãDYDQMHGLMDJQRVWLþNLKGLOHPDSULPHQDUDFLRQDOQH
reanimacije
69285 Zavoji ĈDQLü'DYRULQL6HNHOM 2000 4410.00
Alan
69622 Urgentna medicina 0LURVODY6.RYDþHYLü 2005 972.00
70832 First Aid for the Basic Sciences: General Principles LE 2009 2800.00
1ed ISE
70833 First Aid for the Basic Sciences: Organ Systems 1ed LE 2009 2800.00
ISE

70893 Emergency Medicine: PreTest Self-Assessment & ROSH 2009 1574.00


Review 2ed ISE

71603 Essential Emergency Medicine, Steven W. Salyer 2009 4147.00


71633 Saunders Nursing Survival Guide: Critical Care & Lori Schumacher 2009 3171.00
Emergency Nursing ,
71650 Paramedic Practice Today - 2-Volume Text, 2-Volume Aehlert 2009 23302.00
Workbook, and Virtual Patient Encounters Package
Above and Beyond

72258 Oxford Handbook of Emergency Nursing Crouch OBE 2009 2375.00


72399 Neurotrauma and Critical Care of the Spine Jack Jallo, Alexander R. 2008 14035.00
Vaccaro
72400 Neurotrauma and Critical Care of the Brain Jack Jallo, Christopher M. 2009 19435.00
Loftus
72401 Decision Making in Neurocritical Care Frontera, Jennifer A. 2009 5395.00
Frontera
73119 CLINICAL PRACTICE EMERGENCY MED 5E CB WOLFSON 2009 18544.00
73319 Case Files: Emergency Medicine, 2 Ed - ISE Toy 2009 1732.00

73516 CRITICAL CARE MEDICINE 4E - IE MARINI 2009 4270.00


74202 Oxford Handbook of Respiratory Medicine and Chapman, Steven; 2009 5621.00
Emergencies in Respiratory Medicine Pack Robinson, Grace; Stradling,
John;
74204 Oxford Handbook of Cardiology and Emergencies in Ramrakha, Punit; Hill, 2009 5621.00
106 od 116
Cardiology Pack (2/e) Jonathan; Myerson, Saul
G.;
74698 Critical Care Ultrasonography Alexander Levitov, Paul H. 2009 15249.00
Mayo, Anthony D. Sloni
74725 Intensive Review for the Emergency Medicine Sassan Naderi, Richard 2009 6587.00
Qualifying Examination (Intensive Review Book & CD Park
Rom)
74726 Pediatric Emergency Medicine: Third Edition (Strange, Gary R. Strange, William F 2009 11590.00
Pediatric Emergency Medicine) Ahrens, Robert W. Schaf
76548 Rosen's Emergency Medicine, 7 Ed,Expert Consult John Marx 2009 29402.00
Premium Edition – Enhanced Online Features and Print

80823 Neonatal and Infant Emergencies Sharieff/Mccollough 2008 6710.00


81006 Oxford Handbook of General Practice and Simon, Chantal; Everitt, 2010 5621.00
Emergencies in Primary Care Pack Hazel; Van Dorp, Francois
82722 Rana +DQþHYLü-DQNR$QWROMDN 2000 5145.00
Tonisav i suradnici
83021 Minor Injuries, Dennis Purcell 2010 4025.00
109420 Kardiopulmonalna cerebralna reanimacija /DOHYLü3UHGUDJDXWRU 2008 1620.00
110398 2SüLLQVWUXNWRUVNLWHþDM 1486.00
110826 +LWQDVWDQMDXQHXURKLUXUJLMLGLMDJQRVWLþNRWHUDSLMVNL 0LURVODY6DPDUGåLü 2010 1620.00
YRGLþ
111637 Emergency Medicine Review, Richard A. Harrigan 2010 7807.00
111776 International Trauma Life Support:International Edition John Campbell 2007 4281.00
6ed
112135 First Aid 5e Aaos 2006 700.00
112281 First Aid for the Emergency Medicine Oral Boards (First David S Howes, Rohit 2010 9515.00
Aid Specialty Boards) Gupta, Flora Waples-Trefil
112487 First Aid for the USMLE Step 3, Third Edition (First Aid Tao Le, Vikas Bhushan, 2010 4025.00
USMLE) Robert W. Grow
112489 FIRST AID FOR THE USMLE STEP 1, 2010 LE 2010 2428.00

112717 Spine and Spinal Cord Trauma: Evidence-Based Jerome Ed. Vaccaro 2010 19435.00
Management
113518 Dvd- First Aid 5e Dvd Aaos 2006 5710.00
114332 ESSENTIAL EMERGENCY TRAUMA PB SHAH 2010 5978.00
114334 POCKET EMERGENCY MEDICINE 2E SP ZANE 2010 4264.00
114336 TEXT PEDIATRIC EMERGENCY MEDICINE 6E CB FLEISHER 2010 17568.00
114592 Emergency Medicine Secrets, Vincent J. Markovchick 2010 4025.00
114832 Practical Procedures in Anaesthesia and Critical Care Jackson, Guy; Soni, Neil; 2010 4370.00
Whiten, Christopher J.
115362 Napredno održavanje života 2009 2100.00
116060 First Aid for the USMLE Step 2 CS LE 2010 2922.00

116129 AVOIDING COMMON ERRORS IN THE ED PB MARCUCCI 2010 4630.00


urologija
14583 Kidneys, Ureters and Urinary Bladder (Netter Collection Frank H. Netter 2000 6460.00
of Medical Illustrations, Volume 6)
18846 Rekonstrukcijska urološka kirurgija Darko Kropfl 1999 4480.00
18868 8URORãNLLGLMDJQRVWLþNLDOJRULWPL Marian Radej 2003 3500.00
29667 Drug Treatment in Urology Eardley 2005 6039.00
30616 Oxford Handbook of Genitourinary Medicine, HIV and Pattman, Richard 2005 2750.00
AIDS
32127 Urologija 1,2 0DUNRYLü9HOLERU 1997 2160.00
107 od 116
32127 Urologija 1,2 0DUNRYLü9HOLERU 1997 2160.00
36219 Campbells Urology 9 Ed- 4 vol IE Wein 2006 32384.00
37822 UROLOŠKA ONKOLOGIJA 5XÿHU1RYDN$QWXQ7XFDNL 1994 3500.00
suradnici
43537 The Overactive Bladder Kreder Iii 2007 15250.00
43590 *sp* Smith's Textbook of Endourology, Arthur Smith 2006 24235.00
43963 Genitourinary Imaging, 2nd edition Ronald Zagoria 2006 4025.00
48915 Atlas of Urogynecological Endoscopy 2006 12078.00
48920 Male Sexual & Reproductive Dysfunction Kandeel Fouad R 2007 35990.00
Pathophysiology and Treatm
53596 SMITH'S GENERAL UROLOGY 17ed ISE 2008 4391.00
55997 Complications Urologic Surg Prac Loughlin 2007 18300.00
59976 Early Diagnosis and Treatment of Cancer Series: Li-Ming Su 2009 10979.00
Prostate Cancer,
60009 Urogenital Imaging (Direct Diagnosis in Radiology: DX- Bernd Hamm, Dirk 2008 4855.00
Direct!) Beyersdorff, Uta Lemke
60045 Ultrasonography in Urology: A Practical Approach to Edward I. Bluth, Philip W. 2007 7555.00
Clinical Problems Ralls, Carol B. Benson
60763 Atlas of Laparoscopic Urologic Surgery (Atlas Of...) Serdar Deger, Jan Roigas, 2007 10370.00
Robert G. Moore
61063 Urological Surgery (Oxford Specialist Handbooks in Reynard, John; Turner, 2008 5315.00
Surgery) Kevin; Mark, Stephen;
Armen
61721 Lokalizovani karcinom prostate Jovan Hadzi-Djokic 2052.00
62022 One Stop Doc: Renal System and Electrolyte Balance Panos Stamoulos 2005 1341.00
62075 Bolesti prostate 0DUNRYLü9HOLERUDXWRU 2000 1080.00
62177 Kamenci urinarnog trakta : etiopatogeneza, prevencija, -DQX]RYLü1RYLFD/- 2007 756.00
OHþHQMH 8ULQDU\7UDFW6WRQHV autor
65974 Urinarne derivacije -RYDQ%+DGåLĈRNLü 2009 2808.00
66501 Oxford Handbook of Urology (2/e)- IE Reynard, John; Brewster, 2009 2750.00
Simon; Biers, Suzanne
68855 Male Fertility and Infertility Glover/Barratt 2009 3415.00
69775 Urinarna inkontinencija 7LKRPLU59HMQRYLü-RYDQ 2009 2808.00
%+DGåLĈRNLü
71821 Urodynamics Made Easy, 3rd Edition Christopher R. Chapple 2009 3415.00

71824 Hinman's Atlas Of Pediatric Urologic Surgery, 2nd Frank Hinman 2008 25132.00
Edition

72481 Teaching Atlas of Urologic Imaging Robert A. Older, Matthew 2009 12955.00
Bassignani
73528 5 MINUTE UROLOGY CONSULT 2E CB GOMELIA 2009 8052.00
77447 Karcinom prostate 0DUNRYLü9HOLERU6DXWRU 2007 1296.00
79175 Urologija 9HOLERU60DUNRYü 2009 1944.00
110202 Oxford Handbook of Genitourinary Medicine, HIV, and Sankar, Nathan; Pattman, 2010 3495.00
Sexual Health Richard; Handy, Pauline;
110396 Rak prostate Mirko Šamija i suradnici 2010 5648.00
115220 Dx/Rx: Sexual Dysfunction in Men and Women Zaslau 2010 3171.00
115384 Stres inkontinencija urina 7DOLü%UDQLVODY 1995 50.00
veterina
8339 9HWHULQDUVNLUHþQLN Nevenka Bjelica 2002 1620.00
8398 *sp* Learning Veterinary Terminology, 2nd Edition McBride 2001 1450.00
9515 *sp* The Little Book of Bees Weiss 2002 2263.00
108 od 116
18757 Laboratory Animal Medicine, 2nd edition Fox Et Al 2002 21960.00
18830 %DNWHULMVNHLJOMLYLþQHEROHVWLåLYRWLQMD &YHWQLü 2002 3500.00
18831 Zdravstvena dezinsekcija u nastambama i okolišu Asaj Antur 1999 1540.00
18832 Deratizacija u praksi Antun Asaj 1999 1148.00
18833 Dezinfekcija Antur Asaj 2000 1820.00
18834 %MHVQRüD 6ODYNR&YHWQLü 1999 560.00
18835 Veterinarska toksikologija 9MHNRVODY6UHERþDQ 1993 2030.00
18836 Pokusni modeli u biomedicini 0DUNR5DGRþLü 2000 2800.00
18892 Ekološko higijenska polazišta u šaranskim Antun Asaj 2800.00
ULEQMDþDUVWYLPD
18927 ,PHQLNLUMHþQLNIDXQHMDGUDQVNRJPRUD 0ODGHQ(UFHJRYLü 2003 4200.00
19611 $7/$67232*5$)6.($1$720,-('20$û,+ Peter Popesko 2004 16800.00
ŽIVOTINJA
19612 HIGIJENA NA FARMI I U OKOLIŠU Antun Asaj 2003 2800.00
32555 *sp* Biology of Metabolism in Growing Animals Burrin 2005 10248.00
34763 Saunders Comprehensive Veterinary Dictionary (Soft Douglas Blood 2006 4757.00
Cover),
36169 Pathologic Basis of Veterinary Disease, M. Donald Mcgavin 2006 10979.00
36211 Veterinary Genetics and Reproductive Physiology Susan Long 2006 3049.00
36285 Veterinary Laser Surgery a Practical Guide Berger 2006 7259.00
38969 Current Therapy in Large Animal Theriogenology, 2nd Robert Youngquist 2006 14640.00
edition
41820 (.2/2â.2672ý$56792,+20(23$7,-$ Antun Asaj 2006 2100.00
43917 Comparative Reproductive Biology Schatten 0 9150.00
43919 Differential Diagnosis in Small Animal Medicine Gough A 2007 3903.00
44100 A Dictionary of Animal Behaviour Mcfarland, David 2006 1374.00
45366 BSAVA Manual of Canine and Feline Clinical Villiers E 2005 10858.00
Pathology Second edition
46948 NACIONALNI REGISTAR VETERINARSKIH LEKOVA 2007 1188.00
2007
47758 Jubb, Kennedy & Palmer's Pathology of Domestic M. Maxie 2007 31842.00
Animals,
48328 Small Animal Medical Differential Diagnosis, Mark Thompson 2007 4269.00
48388 Textbook of Veterinary Physiology, James Cunningham 2007 8661.00
50901 Atlas of Small Animal Ultrasonography Penninck D 2008 12199.00
52646 Textbook of Veterinary Diagnostic Radiology, Donald E. Thrall 2007 9515.00
53880 Manual of Skin Diseases of the Dog and Cat Paterson 2008 6465.00
55111 Small Animal Clinical Pharmacology, Jill Maddison 2008 7319.00
55124 Veterinary Medical Terminology, Dawn Christenson 2008 4757.00
55140 Veterinary Neuroanatomy and Clinical Neurology, Alexander delahunta 2008 9881.00
55169 Large Animal Internal Medicine Smith, Bradford 2009 15860.00
55170 Diagnostic Cytology and Hematology of the Dog and Rick Cowell 2008 10491.00
Cat,
55801 Handbook of Small Animal Radiological Differential 2001 5489.00
Diagnosis
56121 Saunders Solutions in Veterinary Practice: Small Anita Patel 2008 5123.00
Animal Dermatology,
56792 Veterinary Dental Techniques for the Small Animal Steven Holmstrom 2004 8905.00
Practitioner,
57930 Small Animal ECGs - An Introductory Guide 2e Martin MWS 2007 3659.00
57948 Ophthalmology for the Veterinary Practitioner Stades 2007 9638.00
59412 Small Animal Dentistry, A manual of techniques Tutt C 2006 7747.00
109 od 116
59412 Small Animal Dentistry, A manual of techniques Tutt C 2006 7747.00
59413 Blackwell's Five-Minute Veterinary Consult Clinical Lobprise HB 2007 6039.00
Companion Small Animal Dentistry
59414 Small Animal Ophthalmology,4 Ed Robert Peiffer 2008 5367.00
59566 *sp* Exotic Animal Care & Management Judah Nuttall 2008 4830.00
59583 Veterinary Diagnostic Imaging: Birds, Exotic Pets, and Charles S. Farrow 2008 8539.00
Wildlife(Veterinary Diagnostic Imaging)
59590 Manual of Exotic Pet Practice Mark Mitchell, Thomas N. 2008 7441.00
Tully
59894 Slatter's Fundamentals of Veterinary Ophthalmology David Maggs, Paul Miller, 2007 9637.00
Ron Ofri
59918 Manual of Canine and Feline Cardiology, Larry P. Tilley 2008 8661.00
59929 Small Animal Internal Medicine,4 Ed Richard Nelson 2008 14884.00
59930 Georgis Parasitology for Veterinarians Dwight D. Bowman 2008 6709.00
60008 Atlas of Dental Radiography in Dogs and Cats Gregg A. DuPont, Linda J. 2008 8539.00
DeBowes
61275 Clinical Biochemistry of Domestic Animals, 6 Ed 2008 20740.00
61674 Colour Atlas of Anatomy of Small Laboratory Animals, Popesko 1992 18056.00
volume one
61675 Colour Atlas of Anatomy of Small Laboratory Animals, Popesko 1992 18056.00
volume two
61720 Principi genetike ĈHOLü1LQRVODYDXWRU 2004 1404.00
63454 Small Animal Dermatology, Peter Hill 2002 5977.00
63468 Medical History and Physical Examination in A. Rijnberk 2008 8051.00
Companion Animals, 2nd Edition
64312 BSAVA Manual of Canine and Feline Nephrology and Elliott J 2007 8784.00
Urology 2e
65268 Small Animal Anaesthesia and Analgesia Carroll GL 2008 4635.00
66698 Ophthalmic Disease in Veterinary Medicine Martin C 2009 6094.00
66880 Essentials of Veterinary Ophthalmology, 2e Gelatt KN 2008 6099.00
67696 Canine Behavior, Bonnie Beaver 2008 5123.00
67697 The Merck, Merial Manual for Pet Health, Merck 2008 1585.00
67698 Kirk's Current Veterinary Therapy Xiv, John Bonagura 2008 10613.00
68922 Equine Breeding Management and Artificial Juan Samper 2008 9149.00
Insemination,
68923 Equine Anesthesia, William Muir 2008 8905.00
68927 Color Atlas of Diseases and Disorders of the Foal, Siobhan Brid Mcauliffe 2008 11345.00
68928 Equine Exercise Physiology, Kenneth Hinchcliff 2007 6099.00
68930 Color Atlas of Veterinary Anatomy, Volume 3, The Dog Stanley H. Done 2009 9515.00
and Cat,
68933 Veterinary Immunology - Text and Veterinary Consult Ian Tizard 2008 7685.00
Package,
68943 The Diversity of Fishes - Biology, Evolution, and Helfman G 2009 6094.00
Ecology 2e
68946 BSAVA Small Animal Formulary Ramsey I 2008 7320.00
68947 Handbook of Veterinary Pharmacology Hsu WH 2008 4635.00
68948 Equine Color Genetics 3e Sponenberg DP 2009 4879.00
68950 The Equine Hospital Manual Corley K 2008 8539.00
68951 Large Animal Neurology 2e Mayhew J 2008 9149.00
68954 BSAVA Manual of Canine and Feline Dentistry Tutt C 2007 8418.00
68955 Colour Handbook of Skin Diseases of the Cat and Dog, NUTTALL 2009 4874.00
2 Ed
68956 BSAVA Manual of Canine and Feline Thoracic Imaging Schwarz T 2008 9760.00

110 od 116
69018 Introduction to Veterinary Anatomy and Physiology Sally Bowden 0 4513.00
Revision Aid Package,
69599 VETERINARSKA TOKSIKOLOGIJA 9MHNRVODY6UHERþDQ(PLO 2009 4200.00
drugo obnovljeno i dopunjeno izdanje 6UHERþDQ
69616 HIGIJENA I BIOEKOLOGIJA U PERADARSTVU 0DULMD9XþHPLOR 2008 2800.00
69683 Veterinary Reproduction & Obstetrics, David E. Noakes 2009 13176.00
69809 Small Animal Oncology, Susan M. North 2009 8051.00
70027 Canine and Feline Cytology: A Color Atlas and Rose E. Raskin 2009 9881.00
Interpretation Guide
70090 2SãWDNOLQLþNDGLMDJQRVWLNDNRGGRPDüLKSDSNDUD 5DGRMLþLü%LOMDQDDXWRU 2008 1296.00
L]GDYDþ
70095 0RUIRORJLMDGRPDüLKåLYRWLQMD âLMDþNL1HVWRUDXWRU 1997 1944.00
70110 Black's Veterinary Dictionary Edward Boden 2005 4320.00
70622 3$5$=,76.(%2/(67,3$6$,0$ý$.$ :,.(5+$86(5.87,ý,û 2006 1920.00

71193 Guide to the Dissection of the Dog,7 Ed Howard E. Evans 2009 5367.00
71197 Exotic Animal Medicine, A Quick Reference Guide Lance Jepson 2009 6343.00

71638 Feline Orthopedic Surgery and Musculoskeletal P. M. Montavon 2009 9271.00


Disease,
71675 Veterinary Pharmacology and Therapeutics 9e Papich M 2009 14030.00
71812 Pascoe's Principles and Practice of Equine Derek C. Knottenbelt 2009 11345.00
Dermatology, 2nd Edition

71891 Zoonoses - 2nd Edition Martin Shakespeare 2009 5123.00


72508 Mccurnin's Clinical Textbook for Veterinary Technicians Joanna M. Bassert 2009 6709.00
- Textbook and Workbook Package,7 Ed
72918 Clinical Medicine of the Dog and Cat 2e Schaer M 2009 10370.00
73938 *sp* Clinicopathologic Principles for Veterinary Robinson/Huxtable 2003 2440.00
Medicine
74822 Small Animal Gastroenterology Steiner J 2008 12078.00
74868 Introduction to Horse Nutrition Davies Z 2009 3049.00
74869 Infectious Disease Management in Animal Shelters Miller L 2009 4879.00
74872 Practical Small Animal MRI Gavin P 2009 10675.00
74874 A Colour Handbook of Urinary Stones in Small Hesse A 2009 4264.00
Animal Medicine
74875 Manual of Small Animal Soft Tissue Surgery Tobias K 2009 6465.00
74876 Small Animal Medical Diagnosis, 3 Ed Lorenz M 2009 4879.00
74877 BSAVA Manual of Canine and Feline Abdominal O'Brien R 2009 8540.00
Imaging
74879 BSAVA Manual of Canine and Feline Behavioural Horwitz D 2010 9028.00
Medicine
74884 Color Atlas of Small Animal Anatomy - The McCracken T 2009 3903.00
Essentials
74886 Veterinary Hematology: Atlas of Common Domestic Reagan WJ 2008 4269.00
and Non-Domestic Species, 2 Ed
76803 Clinical Canine and Feline Reproduction Root Kustritz MV 2009 5855.00
76804 Gastrointestinal Nematodes of Sheep and Cattle - Sutherland I 2009 7929.00
Biology and Control
76806 BSAVA Manual of Canine and Feline Musculoskeletal Houlton J 2006 9760.00
Disorders
76807 BSAVA Manual of Canine and Feline Musculoskeletal Barr 2006 8540.00
Imaging
111 od 116
76811 BSAVA Manual of Canine and Feline Emergency and King L 2007 10370.00
Critical Care 2e
76812 Rickettsiology and Rickettsial Diseases - Fifth Hechemy KE 2009 8540.00
International Conference
76813 Functional Anatomy and Physiology of Domestic Reece W 2009 4269.00
Animals 4e
78752 Sloughi: A Comprehensive Owner's Guide (Kennel M. Crappon de Caprona 2004 2456.00
Club Books)
79508 Textbook of Veterinary Anatomy, K. M. Dyce 2009 9515.00
79718 Saunders Veterinary Anatomy Flash Cards, Saunders 2009 2927.00
81015 Veterinarska anesteziologija 'UDJDQ9XþRYLü 2009 2160.00
81176 %2/(67,352%$912*$6867$9$3$6$,0$ý$.$ 'DOLERU3RWRþQMDN'DPLU 2010 2660.00
Stanin, Nenad Turk
81177 VETERINARSKA KIRURGIJA I ANESTEZIOLOGIJA 'UDåHQ0DWLþLü'UDåHQ 2010 6300.00
Vnuk
82719 $QDWRPLMDGRPDüLKVLVDYDFDXGåEHQLNLDWODV König, H.E., Liebich, H-G., 2009 23520.00
(ur.) Ur.hrv.izd. Mlad
82763 Color Atlas of Veterinary Anatomy, Volume 1, The Raymond R. Ashdown 2010 7319.00
Ruminants,
83027 Saunders Solutions in Veterinary Practice: Small Sue Fitzmaurice 2010 5367.00
Animal Neurology,
83068 Handbook of Small Animal Radiology and Ultrasound, Ruth Dennis 2010 5489.00
109183 Handbook of Small Animal MRI Elliott I 2010 3659.00
109184 Saunders Solutions in Veterinary Practice: Small Rob D. Foale 2010 4879.00
Animal Oncology,
109185 AVTA's Anesthesia Manual for Veterinary Bryant S 2010 5001.00
Technicians
109186 Veterinary Anaesthesia - Principles to Practice Dugdale A 2010 4879.00
109188 Feline Dentistry Bellows J 2010 7319.00
109339 Laboratory Animal Anaesthesia, Paul Flecknell 2009 9394.00
110485 Improving Animal Welfare: A Practical Approach (Cabi) T Grandin 2009 5605.00
110695 Dogs: Domestication and the Development of a Social Morey 2010 3050.00
Bond
110815 Bolesti svinja Šamanc, Horea A. - autor - 2009 1728.00
L]GDYDþ
110816 Bolesti organa za varenje goveda Šamanc, Horea A. - autor - 2009 1188.00
L]GDYDþ
111157 The Merck Veterinary Manual, 10th Edition Kahn CM 2010 4508.00
111589 Equine Dentistry, Jack Easley 2010 12199.00
111594 Diagnostic Radiology and Ultrasonography of the Dog J. Kevin Kealy 2010 11833.00
and Cat,
111616 Saunders Handbook of Veterinary Drugs,3ed Mark G. Papich 2010 5855.00
111634 Atlas of Normal Radiographic Anatomy and Anatomic Donald E. Thrall 2010 14884.00
Variants in the Dog and Cat,
111882 Canine and Feline Nephrology and Urology,2ed Dennis J. Chew 2010 7197.00
111883 Saunders Solutions in Veterinary Practice: Exotics, Lesa Longley 2010 5367.00
111884 Saunders Solutions in Veterinary Practice: Small Shailen Jasani 2010 5367.00
Animal Emergency Medicine,
111885 Canine and Feline Nutrition,3ed Linda P. Case 2010 5855.00
111886 Small Animal Pediatrics, Michael E. Peterson 2010 7197.00
111887 Small Animal Dermatology,3ed Keith A. Hnilica 2011 10247.00
113126 Bolesti respiratornog i kardio-vaskularnog sistema Šamanc, Horea A. - autor - 2010 1188.00
goveda L]GDYDþ

112 od 116
113426 Advances in Veterinary Surgery - The Canine Muir P 2010 9515.00
Cranial Cruciate Ligament
113427 Behavior of Exotic Pets Tynes VV 2010 5733.00
113429 Notes on Small Animal Dermatology Joyce J 2010 4879.00
113695 BSAVA Manual of Canine and Feline Fuentes VL 2010 10370.00
Cardiorespiratory Medicine 2e
113696 BSAVA Manual of Practical Animal Care Hotston-Moore P 2007 5978.00
113701 BSAVA Guide to Procedures in Small Animal Practice Bexfield N 2010 9150.00
Pracice
114103 Clinical Pathology for the Veterinary Team Rosenfeld A 2010 4269.00
114104 Clinical Cases in Avian and Exotic Animal Campbell TW 2010 9515.00
Hematology and Cytology
114106 Small Animal Emergency and Critical Care - Powell L 2010 4269.00
Case Studies in Client
Communication, Morbidity
and Mortality
114107 Blackwell's Five-Minute Veterinary Consult Mazzaferro EM 2010 7319.00
Clinical Companion - Small
Animal Emergency and
Critical Care
114109 Feline Emergency and Critical Care Medicine Drobatz KJ 2010 6831.00
114110 Feline Patient 4e Norsworthy G 2010 10369.00
114111 Blackwell's Five-Minute Veterinary Consult Osweiler G 2010 7319.00
Clinical Companion: Small
Animal Toxicology
114113 Blackwell's Five-Minute Veterinary Consult Helton Rhodes K 2011 7319.00
Clinical Companion: Small
Animal Dermatology with
CD
114114 Home-Prepared Dog and Cat Diets 2e Schenck P 2010 3781.00
114115 Clinical Canine and Feline Respiratory Medicine Johnson LR 2010 6831.00
114119 Fundamentals of Small Animal Surgery Mann F 2011 4819.00
114482 Anesthesia and Analgesia for Veterinary Technicians, John Thomas 2010 4269.00
114497 Veterinary Instruments and Equipment, Teresa F. Sonsthagen 2010 3293.00
114708 VETERINARY IMMUNOLOGY - PRINCIPLES & PB DAY & SCHULTZ 2010 3654.00
114727 CARDIOVASC DISEASE SMALL ANIMAL MED PB WARE 2010 6094.00
114929 BSAVA Manual of Canine and Feline Rehabilitative, Watson P 2010 9760.00
Palliative and Supportive
Care
115197 %2/(67,37,&$.8û1,+/-8%,0$&$ (VWHOOD3UXNQHU5DGRYþLü 2010 3500.00
115361 Antimikrobna terapija u veterinarskoj medicini 2010 2100.00
116494 Clinical Veterinary Advisor, Etienne Cote 2011 7929.00
116495 Veterinarska fiziologija 6WRMLü9HOLERU 2010 1620.00
zdravstvena nega
26251 Potter & Perry's Fundamentals of Nursing - Australian Crisp & Taylor 2005 6343.00
Version, 2nd edition
36165 Mosby's Pocket Guide for Health Assessment, 6th Pamela Weilitz 2006 3171.00
edition
36507 Oxford Handbook of Pre-hospital Care Greaves, Ian 2006 2750.00
40685 *sp* Leadership Roles and Management Functions in MARQUIS 2005 1500.00
Nursing
43992 Watson's Clinical Nursing and Related Sciences ISE Walsh 2007 2458.00
6E
44004 MEDICAL SURGICAL NURSING 7E IE Lewis 2007 4371.00
113 od 116
47398 Nursing Research: Generating and Assessing Denise F. Polit; Cheryl 2007 3843.00
Evidence for Nursing Practice (Nursing Research Tatano Beck
(Polit))
47404 Lippincott's Textbook for Nursing Assistants: A Pamela J. Carter 2007 2989.00
Humanistic Approach to Caregiving
47405 Lippincott's Workbook for Nursing Assistants: A Pamela J. Carter 2007 1647.00
Humanistic Approach to Caregiving
47410 Irwin and Rippe's Intensive Care Medicine (Intensive Richard S. Irwin, James M. 2007 15738.00
Care Medicine (Irwin & Rippe's)) Rippe
47441 Wound Care Essentials: Practice Principles Sharon Baranoski, 2007 3044.00
Elizabeth A. Ayello
48324 Medical Devices: Use and Safety Bertil Jacobson 2006 3415.00
48340 Differential Diagnosis for Primary Care, Jennifer Jamison 0 4757.00
48352 Lippincott's Q and A Review for NCLEX-RN Diane McGovern Billings 2007 2745.00
(Lippincott's Review)
52031 Pain Management: Evidence, Outcomes, and Quality of HarriÙt Wittink 2007 6709.00
Life, A Sourcebook
53185 *sp* Soins infirmiers et douleur Christiane Metzger, 2007 400.00
Christiane Walter, André
Mulle
54072 *sp* Contexts of Nursing 2e Daly et al 2005 1250.00
59051 The Little ICU Book of Facts and Formulas MARINO 2008 3044.00
59163 ATLAS MEDICATION ADMINISTRATION 2E LWW 2006 970.00
59914 Intensive Care: An Illustrated Colour Text Michael Avidan, Kara M. 2007 3415.00
Barnett, Laureen L. Hill
59935 Oh's Intensive Care Manual Bersten , Soni 2008 8051.00
61049 Oxford Handbook of Palliative Care (2/e)-IE Watson, Max; Lucas, 2009 2750.00
Caroline; Hoy, Andrew;
Wells,
61375 CURRENT CRITICAL CARE DIAGNOSIS AND BONGARD 2008 3537.00
TREATMENT, 3 ed ISE
62062 Student Nurses' Guide to Professional Practice and Jane E Schober 2005 2073.00
Development
65816 Sestrinske procedure Springhouse 2010 1980.00
66486 Oxford Handbook of Clinical Skills in Adult Nursing Randle, Jacqueline; Coffey, 2009 2250.00
Frank; Bradbury, Marty
67662 Oxford Handbook of Clinical Rehabilitation (2/e) Ward, Anthony; Barnes, 2009 3495.00
Michael; Stark, Sandra; Rya
67760 Zdravstvena nega i savremeno sestrinstvo 0LOHQD7LMDQLü'HVDQND 2008 2160.00
ĈXUDQRYLü5DWRPLUND5XGLü
68525 Oxford Handbook of Cancer Nursing Tadman, Mike; Roberts, 2007 2375.00
Dave
68527 Oxford Handbook of Women's Health Nursing, 1 Ed Gupta, Sunanda; Holloway, 2009 2375.00
Debra; Kubba, Ali
69439 Oxford Textbook of Palliative Medicine (4/e) Hanks, Geoffrey; Cherny, 2009 20633.00
Nathan I.; Christakis, Ni
71307 Bailliere's Nurses Dictionary 25e IE Weller 2009 818.00

71628 Simulation Learning System for Ignatavicius and Ignatavicius, Howard, 2009 7197.00
Workman: Medical-Surgical Nursing 6 Ed Schumacher & Weberg
71629 Essential Decision Making and Clinical Judgement for Carl Thompson 2009 3171.00
Nurses,
71654 Virtual Patient Encounters for Paramedic Practice Barbara Aehlert 2009 4269.00
Today,
71862 Nursing Knowledge and Practice, 3rd Edition Maggie Mallik 2009 3659.00
114 od 116
71869 Notes on Nursing- A Guide for Today's Caregivers International Council of 2009 1219.00

72226 Oxford Handbook of Respiratory Nursing Robinson 2009 2375.00


72250 Oxford Handbook of Nurse Prescribing Beckwith 2007 2375.00
72253 Oxford Handbook of Primary Care and Community Drennan 2007 2375.00
Nursing
72311 Oxford Handbook of Gastrointestinal Nursing Norton 2008 2375.00
72347 Oxford Handbook of Nursing Older People Tabernacle 2009 2375.00
72354 Oxford Handbook of Children's and Young People's Glasper 2006 2375.00
Nursing
72400 Neurotrauma and Critical Care of the Brain Jack Jallo, Christopher M. 2009 19435.00
Loftus
72617 Oxford Handbook of Adult Nursing, 1 Ed Castledine, George; Close, 2009 2495.00
Ann
72618 Oxford Handbook of Learning and Intellectual Disability Gates, Bob; Barr, Owen 2009 2495.00
Nursing, 1 Ed
72619 Oxford Handbook of Diabetes Nursing, 1 ed Avery, Lorraine; Beckwith, 2009 2375.00
Sue
72620 Oxford Handbook of Neuroscience Nursing, 1 Ed Woodward, Sue; 2009 2870.00
Waterhouse, Catheryne
72621 Oxford Handbook of Critical Care Nursing, 1 Ed Adam, Sheila K; Osborne, 2009 2870.00
Sue
73097 MANUAL INTENSIVE CARE MEDICINE 5E PB IRWIN 2009 4270.00
73134 Fluids and Electrolytes: An Incredibly Easy! Pocket LWW 2009 2434.00
Guide, 2 Ed
73616 Brunner and Suddarth's Textbook of Medical-Surgical SMELTZER 2009 4879.00
Nursing, 12e IE ED CB
74366 Oxford Handbook of Musculoskeletal Nursing Oliver, Susan 2009 2870.00
74719 Lippincott Manual of Nursing Practice, 9 Ed - IE NETTINA 2009 4874.00
74730 CURRENT Practice Guidelines in Primary Care 2009 Ralph Gonzales, Jean S. 2009 1219.00
(Lange Current Series) Kutner
79217 Churchill's Pocketbook of Intensive Care, 3rd Edition Simon M. Whiteley 2010 3049.00

81006 Oxford Handbook of General Practice and Simon, Chantal; Everitt, 2010 5621.00
Emergencies in Primary Care Pack Hazel; Van Dorp, Francois
82314 Critical Care Nursing Made Incredibly Easy! (1st UK CUTLER 2010 3044.00
Edition)
82374 Proces zdravstvene nege : praktikum za studente - 5XGLü5DWRPLUNDDXWRU 2008 1080.00
YRGLþ]DSUDNVX
108731 Cambridge English for Nursing Intermediate Plus Virginia Allum, Patricia 2008 1160.00
Student's Book with Audio CDs (2) McGarr
112135 First Aid 5e Aaos 2006 700.00
112136 Clinical Handbook for Medical-Surgical Nursing Kathleen Osborn Charlotte 2010 1536.00
Miller Annita Watson Che
112640 ESSENTIALS NURSING RESEARCH 7E IE VER PB POLIT 2009 3044.00
112641 FUNDAMENTALS OF NURSING 7E (INT ED) CB TAYLOR 2010 4270.00
112643 TEXT MED SURG NURS 12E H/BK (INT ED) PB SMELTZER 2010 3233.00
112657 Practical Guide to the Care of the Medical Patient, 8th Fred F. Ferri 2010 4025.00
Edition
Expert Consult: Online and Print
113400 Leadership and Management in Nursing Mary Grohar-Murray 2010 2964.00
115078 Oxford Handbook of Critical Care and Emergencies in Singer, Mervyn; Webb, 2009 5621.00
Critical Care Pack (2/e) Andrew
115 od 116
115088 Skills of Clinical Supervision for Nurses: A Practical Meg Bond, Stevie Holland 2010 2927.00
Guide for Supervisees, Clinical Supervisors and
Managers
115090 The Nurse Mentor's Handbook: Supporting Students in Danny Walsh 2010 2439.00
Clinical Practice
115359 32732512,3$/,-$7,912/,-(ý(1-( M. Šamija, D. Nemet i 2010 6160.00
ONKOLOŠKIH BOLESNIKA suradnici
116050 Drugs in Palliative Care Dickman, Andrew 2010 3120.00
118357 Core Topics in Airway Management Calder/Pearce 2010 6710.00
118480 .URQLþQDUDQD±GHNXELWXVLXOFXVFUXULV +DQþHYLü-LVXU 2010 1764.00
118526 Medical Surgical Nursing Single Vol 8ed Lewis 2011 4147.00
Sve detaljnije informacije mozete da dobijete na:
http://www.datastatus.rs
info@datastatus.rs
tel 0800 300 033, fax: 011 3017 835

116 od 116