You are on page 1of 21

ASKEPKECEMASAN

BABI PENDAHULUAN Kecemasanatauansietimerupakansalahsatubentukemosiindividuyangberkaitandenganadanya rasaterancamolehsesuatu,biasanyadenganobjekancamanyangbegitutidakbegitujelas.Kecemasan denganintensitasnilaiancamanyangwajardapatdianggapmemilikinilaipositifsebagai motivasi,tetapiapabilaintensitasnyabegitukuatdanbersifatnegatifjustruakanmenimbulkankerugian dandapatmenggangguterhadapkeadaanfisikdanpsikisindividuyangbersangkutan. Kecemasandapatdialamiolehsiapapundandimanapunsertakapanpuntergantungdarifaktorpencetus darikecemasantersebut.Faktamembuktikanbahwadiseluruhlapisanduniakecemasanpalingbanyak terjadisetiapharinya.halinidisebabkansemakinkongkretnyamasalahyangterjadisaatini. Dinegaramaju,gangguanjiwaberupaansietasataukecemasanmenempatiposisipertamadibandingkan dengankasuslain.olehkarenaitusebagaiseorangperawat,kitaharusbenarbenarkritisdalam menghadapikasuskecemasanyangterjadi.

BABII KONSEPDASAR A.Pengertian Kecemasanatauansietasadalahreaksiemosionalterhadappenilaianindividuyangsubjektif,yang dipengaruhiolehalambawahsadardantidakdiketahuisecarakhususpenyebabnya. Kecemasanatauansietasadalahistilahyangsangatakrabdengankehidupanseharihariyang menggambarkankeadaankhawatir,gelisahyangtidakmenentu,takut,tidaktenteram,kadangkadang disertaiberbagaikeluhanfisik. B.Tingkatkecemasan Beberapateorimembagiansietasmenjadiempattingkat: a.Ansietasringan Ansietasringanberhubungandenganketeganganakanperistiwakehidupansehariharidan menyebabkanseseorangmenjadiwaspadadanlahanpersepsinyameningkat.Kecemasandapat memotivasibelajardanmenghasilkanpertumbuhandankreativitas. b.Ansietassedang Padatingkatinilapanganpersepsiterhadaplingkunganmenurun.Individulebihmemfokuskanpadahal pentingsaatitudanmengesampingkanhalyanglain. c.Ansietasberat Padaansietasberatlapanganpersepsimenjadisangatmenurun.Individucenderungmemikirkanhal yangsangatkecilsajadanmengabaikanhalyanglain.Individutidakmampuberfikirrealistisdan membutuhkanbanyakpengarahan,untukdapatmemusatkanpadadaerahlain.

d.Panik Padatingkataninilahanpersepsisudahsangatsempit,sehinggaindividutidakdapatlagi mengendalikandiridantidakdapatmelakukanapaapawalaupunsudahdiberipengarahan/tuntutan. Padakeadaanpanikterjadipeningkatanaktivitasmotorik,menurunnyakemampuanberhubungan denganoranglaindankehilanganpemikiranyangrasional.

C.Rentangresponansietasataukecemasan Rentangresponansietasataukecemasanberfluktuasiantararesponadaptifdanmaladptif,seperti terlihatpadagambarberikut.

BABIII KONSEPKEPERAWATAN A.Pengkajian 1.Faktorperedisposisi Teoriyangdikembangkanuntukmenjelaskanpenyebabansietasadalah: a.Teoripsikoanalitik Ansietasmerupakankonsepemosionalyangterjadiantaraduaelemenkepribadianaddansuperego. Idmewakilidoronganinstingdanimpulsprimitiveseseorang,sedangkansuperegomencerminkanhati nuraniseseorangdandikendalikanolehnormanormabudayaseseorang.EgoatauAkuberfungsi

menengahituntutandariduaelementyangbertentangandanfungsiansietasadalahmengingatkanego bahwaadabahaya. b.Teoriinterpersonal Ansietasterjadidariketakutanakanpenolakaninterpersonal.halinijugadihubungkandengantrauma padamasaperkembangansepertikehilangan,perpisahanmenyebabkanseseorangtidakberdaya. Individuyangmempunyaihargadirirendahbiasanyasangatmudahuntukmengalamiansietasyang berat. c.Teoriprilaku Prilakukecemasanmerupakanprodukfrustasiyaitusegalasesuatuyangmenggangukemampuan seseoranguntukmencapaitujuanyangdiinginkan. d.Kajiankeluarga Kajiankeluargamenunjukkanbahwagangguanansietasmerupakanhalyangbiasanyaditemuidalam suatukeluarga. e.Kajianbiologis Kajianbiologismenunjukkanbahwaotakmengandungreseptorspesifikuntuk benzodiazepines.reseptorinimungkinmembantumengaturansietas. 2.Faktorpresipitasi Faktorpresipitasipadagangguanansietasberasaldarisumbereksternaldaninternalsepertidibawahini : a.Ancamanterhadapintegritasseseorangmeliputiketidakmampuanfisiologisataumenurunnya kapasitasuntukmelakukanaktivitashidupseharihari. b.Ancamanterhadapsistemdiriseseorangdapatmembahayakanidentitas,hargadiri,danintegrasi fungsisosial. 3.Perilaku Kecemasandapatdiekspresikansecaralangsungmelaluiperubahanfisiologidanperilakudansecara tidaklangsungmelaluitimbulnyagejalaataumekanismekopingdalamupayamelawankecemasan. Intensietasperilakuakanmeningkatsejalandenganpeningkatantingkatkecemasan. TabelI.Responfisiologisterhadapansietas. SistemRespon KardivaskulerPalpitasi Jantungberdebar Tekanandarahmeningkatdandenyutnadimenurun Rasamaupingsandanpadaakhirnyapingsan SaluranpernapasanNapasepat Pernapasandangkal Rasatertekanpadadada Pembengkakanpada Tenggorokan Rasatercekik Terengahengah NeuromuskulerPeningkatanreflek Reaksikejutan

Insomnia Ketakutan Gelisah Wajahtegang Kelemahansecaraumum Gerakanlambat Gerakanyangjanggal GastrointestinalKehilangannafsumakan Menolakmakn Perasaandangkal Rasatidaknyamanpadaabdominal Rasaterbakarpadajantung Nausea Diare SalurankemihTidakdapatmenahankencing Seringkencing SistemkulitRasaterbakarpadamukosa Berkeringatbanyakpada Telapaktangan Gatalgatal Perasaanpanasataudinginpadakulit Mukapucatdanbekeringat Diseluruhtubuh TabelII.Responprilakukognitif SistemRespon PerilakuGelisah Keteganganfisik Tremor Gugup Bicaracepat Tidakadakoordinasi Kecenderunganuntukcelaka Menarikdiri Menghindar Terhambatmelakukanaktifitas KognitifGangguanperhatian Konsentrasihilang Pelupa Salahtafsir Adanyablokingpadapikiran Menurunnyalahanpersepsi Kreatifdanproduktifmenurun Bingung Khawatiryangberlebihan Hilangmenilaiobjektifitas

Takutakankehilangankendali Takutyangberlebihan AfektifMudahterganggu Tidaksabar Gelisah Tegang Nerveus Ketakutan Alarm Tremor Gugup Gelisah 4.Mekanismekoping Ketikamengalamiansietas,individumenggunakanberbagaimekanismekopinguntukmencoba mengatasinya,danketidakmampuanmengatasiansietassecarakontruktifmerupakanpenyebabutama terjadinyaprilakupatologis,yangmengancamego.Dimanaindividumenggunakanenergiyanglebih besaruntukmengatasiancamantersebut. Adaduamekanismekopingyangdikategorikanuntukmengatasiansietas: 1.Reaksiyangberorientasipadatugas(taskorientedreaction) Merupakanpemecahanmasalahsecarasadardigunakanuntukmenanggulangiancamanstressoryang adasecararealistis,yaitu a.Perilakumenyerang(agresif) Biasanyadigunakanindividuuntukmengatasirintanganagarmemenuhikebutuhan. b.Perilakumenarikdiri Digunakanuntukmenghilangkansumberancamanbaiksecarafisikmaupunsecarapsikologis c.Perilakukompromi Digunakanuntukmengubahtujuantujuanyangakandilakukanataummengorbankankebutuhan personaluntukmencapaitujuan. 2.Mekanismepertahananego(egoorientedreaction) MekanismepertahananEgomembantumengatasiansietasringanmaupunsedangyangdigunakan untukmelindungidiridandilakukansecaratidaksadaruntukmempertahankanketidakseimbangan. AdapunmekanismepertahananEgoadalah: a.Kompensasi Adalahprosesdimanaseseorangmemperbaikipenurunancitradiridengansecarategasmenonjolkan keistimewaan/kelebihanyangdimilikinya.

b.Penyangkalan(denial) Menyatakanketidaksetujuanterhadaprealitasdenganmengingkarirealitastersebut.Mekanisme pertahananinipalingsederhanadanprimitif. c.Pemindahan(displacemen) Pengalihanemosiyagsemuladitujukanpadaseseorang/bendatertentuyangbiasanyanetralataukurang mengancamterhadapdirinya. d.Disosiasi

Pemisahandarisetiapprosesmentalatauprilakudarikesadaranatauidentitasnya. e.Identifikasi(identification) Prosesdimanaseseorangmencobamenjadiorangyangiakagumidenganmengambil/menirukan pikiranpikiran,prilakudanseleraorangtersebut. f.Intelektualisasi(intelektualization) Penggunaanlogikadanalasanyangberlebihanuntukmemghindaripengalamanyangmengganggu perasaannya. g.Introjeksi(intrijection) Mengikutinormanormadariluarsehinggaegotidaklagitergangguolehancamandari luar(pembentukansuperego) h.Fiksasi Berhentipadatingkatperkembangansalahsatuaspektertentu(emosiatautingkahlakuatau pikiran)sehinggaperkembanganselanjutnyaterhalang. i.Proyeksi Pengalihanbuahpikiranatauimpulspadadirisendirikepadaoranglainterutamakeinginan.Perasaan emosionaldanmotivasitidakdapatditoleransi. j.Rasionalisasi Memberiketeranganbahwasikap/tingkahlakunyamenurutalasanyangseolaholahrasional,sehingga tidakmenjatuhkanhargadiri. k.Reaksifoemasi Bertingkahlakuyangberlebihanyanglangsungbertentangandengankeinginankeinginan,perasaan yangsebenarnya.

l.Regressi Kembaliketingkatperkembanganterdahulu(tingkahlakuyangprimitif),contoh;bilakeinginan terhambatmenjadimarah,merusak,melemparbarang,meraung,ds. m.Represi Secaratidaksadarmengesampingkanpikiran,impuls,atauingatanyangmenyakitkanatau bertentangan,merupakanpertahananegoyangprimeryangcenderungdiperkuatolehmekanismeego yanglainnya. n.Actingout Langsungmencetuskanperasaanbilakeinginannyaterhalang o.Sublimasi Penerimaansuatusasaranpenggantiyangmuliaartinyadimatamasyarakatuntuksuatudoronganyang mengalamihalangandalampenyalurannyasecaranormal. p.Supresi. Suatuprosesyangdigolongkansebagaimekanismepertahanantetapisebetulnyamerupakananalog represiyangdisadari;pengesampinganyangdisengajatentangsuatubahandarikesadaran seseorang;kadangkadangdapatmengarahpadarepresifberikutnya. q.Undoing Tindakan/prilakuataukomunikasiyangmenghapuskansebagiandaritindakan/prilakuataukomunikasi sebelumnyamerupakanmekanismepertahananprimitif. B.Diagnosa

Adapundiagnosayangbiasanyamunculpadakecemasanadalah: 1.Penyelesaiankerusakan 2.Kecemasan 3.Polanapastidakefektif 4.Kopingindividutidakefektif 5.Diam 6.Gangguanpembagianbidangenergi 7.Ketakutan 8.Inkontinensial 9.Stres 10.Cederaresikoterhadap...... 11.Perubahannutrisi 12.Responpascatrauma 13.Ketidakberdayaan 14.Gangguanhargadiri 15.Gangguanpolatidur 16.Isolasisosial 17.Perubahanprosesberfikir 18.Gangguaneliminasiurine C.Intervensi Tujuanumum:Klienakanmengurangiansietasnyadaritingkatringanhinggapanik. Tujuankhusus: Klienmampu: Membinahubungansalingpercaya Melakukanaktifitasseharihari Mengekspresikandanmengidentifikasitentangkecemasannya Mengidentifikasisituasiyangmenyebabkanansietas Meningkatkankesehatanfisikdankesejahteraannya Klienterlindungdaribahaya. 1.Ansietasringan DeskripsiBatasankarakterIntervensi Ansietasringanadalahansietasnormaldimanamotivasiindividupadakesehariandalambatas kemampuanuntukmelakukandanmemecahkanmasalahmeningkat.Tidaknyaman Gelisah Insomniaringan Perubahannafsumakanringan Peka Pengulanganpertanyaan Prilakumencariperhatian Peningkatankewaspadaan Peningkatanpersepsipemecahanmasalah Mudahmarah Fokuspadamasalahmasadating GerakantidaktenangPerhatikantandapeningkatanansietas Bantuklienmenyalurkanenergisecarakonstruktif

Gunakanobatbilaperlu Dorongpemecahanmasalah Berikaninformasiakuratdanfuktual Sadaripenggunaanmekanismepertahanan Bantudalammengidentifikasiketerampilankopingyangberhasil Pertahankancarayangtenangdantidakterburu Ajarkanlatihandantehnikrelaksasi

2.Ansietassedang DeskripsiBatasankarakterIntervensi Ansietassedangadalahcemasyangmempengaruhipengetahuanbarudenganpenyempitanlapangan persepsisehnggaindividukehilanganpegangantetapidapatmengikutipengarahanoranglain. Perkembangandariansietasringan Perhatianterpilihdarilingkungan Konsentrasihanyapadatugastugsindividu Suarabergetar Ketidaknyamananjumlahwaktuyangdigunakan Takipnea Takikardia Perubahandalamnadasuara Gemetaran Peningkatanketeganganotot Menggigitkuku,memukulmukulkanjari,menggoyangkankakidanmengetukkanjarikaki Pertahankansikaptidaktergesagesa,tenangbilaberurusandenganpasien Bicaradengansikaptenang,tegasmeyakinkan Gunakankalimatyangpendekdansederhana Hindarimenjadicemas,marah,danmelawan Dengarkanpasien Berikankontakfisikdenganmenyentuhlengandantanganpasien Anjurkanpasienmenggunakantehnikrelaksasi Ajakpasienuntukmengungkapkanperasaannya Bantupasienmengenalidanmenamaiansietasnya 3.Ansietasberat DeskripsiBatasankarakterIntervensi Padaansietasberatlapanganpersepsimenjadisangatmenurun.Individucenderungmemikirkanhal yangsangatkecilsajadanmengabaikanhalyanglain.Individutidakmampuberfikirrealistisdan membutuhkanbanyakpengarahan,untukdapatmemusatkanpadadaerahlain. Perasaanterancam Keteganganototyangberlebihan Diaforesis Perubahanpernapasan Napaspanjang

Hiperventilasi Dispnea Pusing Perubahangastrointestinalis Mualmuntah Rasaterbakarpadauluhati Sendawa Anoreksia Diareataukonstipasi Perubahankardivaskuler Takikardia Palpitasi Rasatidaknyamanpadaprekokardia Berkurangnyajarakpersepsisecaraberat Ketidakmampuanuntukberkonsentrasi Rasaterbakar Kesulitandanketidaktepatanpengungkapan Aktivitasyangtidakberguna BermusuhanIsolasipasiendalamlingkunganyangamandantenang Biarkanperawatandankontakseringsampaikonstan Berikanobatobatanpasienmelakukanhaluntukdirinyasendiri Observasiadanyatandatandapeningkatanagitasi Janganmennyentuhpasientanpapermisi Yakinkanpasienbahwadiaaman Kajikeamanandalamlingkungansekitarnya. 4.Panik DeskripsiBatasankarakterIntervensi Mengungkapkansampaitingkatdimanaindividuberadapadabahayaterhadapdirisendiridanorang lainsertadapatmenjadidiamataumenyerangdengancarakacau.Hiperaktifatauimobilitasiberat Rasaterisolasiyangekstrim Kehilangandesintegrasikepribadian Sangatgoncangdanotototottegang Ketidakmampuanuntukberkomunikasidengankalimatyanglengkap Distoripersepsidanpenilaianyangtidakrealististerhadaplingkungandanancaman Perilakukacaudalamusahamelarikandiri MenyerangTetapbersampasien;mintabantuan Jikamungkinhilangkanbeberapastressorfisikdanpsikologisdarilingkungan Bicaradengantenang,sikapmeyakinkan,menggunakannadasuarayangrendah Katakanpadapasienbahwanada(staf)tidakakanmembahayakandirinyasendiriatauoranglain Isolasikanpasienpadadaerahyangamandannyaman Lanjutdenganperawatanansietasberat. D.Implementasi Pelaksanaankeperawatanmerupakanperwujudandarirencanakeperawatanyangtelahdirumuskan dalamrangkamemenuhikebutuhanpasiensecaraoptimaldenganmenggunakankeselamatan,

keamanandankenyamananpasien.Dalammelaksanakankeperawatan,haruslahdilibatkantim kesehatanlaindalamtindakankolaborasiyangberhubungandenganpelayanankeperawatanserta berdasarkanatasketentuanrumahsakit. E.Evaluasi Ansietasringan: a.Pasienmampumenggunakankopingsecaraefektifuntukmengatasiancamanpotensialatauaktual b.Pasienmampumeningkatkanpengetahuantentangsituasidiri c.Pasienmelaporkanpeningkatanhargadiri Ansietassedang: a.Pasienmenerimaancamansecrarealitas b.Pasienmengekspresikanberkurangnyatingkatansietas Ansietasberat: a.Pasienmengungkapkanpenurunanprilaku,afektif,gejalafisiologisdariansietas. b.Pasienmampumendemonstrasikankemampuanuntukkonsentrasidanmengikutidenganbantuan terhadaplingkungansekitar. c.Menggunakanstrategiskopinguntukmengurangiansietas. d.Menggunakanpikiranpersepsidanansietasterlebihdahulu. Panik: a.Pasientidakmembahayakandirisendiridanoranglain. b.Pasienmengekspresikanpenurunanperasaanansietas. c.Mulaimembuatkeputusanuntukdirisendiri. BABIV PENUTUP A.Kesimpulan Kecemasanatauansietasadalahreaksiemosionalterhadappenilaianindividuyangsubjektif,yang dipengaruhiolehalambawahsadardantidakdiketahuisecarakhususpenyebabnya. Kecemasanatauansietasadalahistilahyangsangatakrabdengankehidupanseharihariyang menggambarkankeadaankhawatir,gelisahyangtidakmenentu,takut,tidaktenteram,kadangkadang disertaiberbagaikeluhanfisik. Beberapateorimembagiansietasmenjadiempattingkat: a.Ansietasringan b.Ansietassedang c.Ansietasberat d.Panik Rentangresponansietasataukecemasanberfluktuasiantararesponadaptifdanmaladptif,seperti terlihatpadagambarberikut.

B.Saran

Sebagaiseorangperawat,kitaharusbenarbenarkritisdalammenghadapikasuskecemasanyangterjadi dankitaharusmampumembedakanjenisjeniskecemasantersebut. Daftarpustaka Mallapiang.2003.keperawatanjiwa.Jakarta:EGC Lyndajuallcarpenitodanmoyet.2007.Bukusakudiagnosiskeperawatan.jakarta:EGC

KONSEPCEMAS,STRESSDANADAPTASI(KonsepDasarKeperawatan) Empattingkatanrasacemas/gangguanperasaan(anxiety)padamanusia 1.Rasacemasringan 2.Rasacemassedang 3.Rasacemasberat 4.Panik Rasacemas(anxiety)merupakanreaksiemosionalterhadappenilaianindividuyangsubyektif. Penyebabrasacemasdapatdikelompokkanpulamenjaditigafaktor,yaitu: a.Faktorbiologis/fisiologis,berupaancamanakankekuranganmakanan,minuman,perlindungandan keamanan. b.Faktorpsikososial,yaituancamanterhadapkonsepdiri,kehilanganorang/bendayangdicintai, perubahanstatussosial/ekonomi. c.Faktorperkembangan,yaituancamanpadaperkembanganmasabayi,anak,remaja. Gejalagejalakecemasan ditandaipadatigaaspek: a.Aspekbiologis/fisiologis,sepertipeningkatandenyutnadidantekanandarah,tarikannafasmenjadi pendekdancepat,berkeringatdingin,termasukditelapaktangan,nafsumakanhilang,mual/muntah, seringbuangairkecil,nyerikepala,takbisatidur,mengeluh,pembesaranpupildangangguan pencernaan. b.Aspekintelektual/kognitif;sepertiketidakmampuanberkonsentrasi,penurunanperhatiandan keinginan,tidakbereaksiterhadaprangsanganlingkungan,penurunanproduktivitas,pelupa,orientasi lebihkemasalampaudaripadamasakini/masadepan. c.Aspekemosionaldanperilaku;sepertipenarikandiri,depresi,mudahtersinggung,mudahmenangis, mudahmarahdanapatisme. Pembagianrasacemas 1.Rasacemasringan:berhubungandenganpermasalahanyangdihadapiseharihari. Keadaaniniakanmeningkatkanpersepsiindividu,yangmengakibatkanorangakanberhati hati/waspadadanmendorongmanusiauntukbelajarsertakreatif. 2.Rasacemassedang:lapanganpersepsiterhadaplingkunganmenurun. Individulebihmemfokuskanhalyangpentingsaatitusajadanmengesampingkanhallainnya. 3.Rasacemasberat:lapanganpersepsisangatmenurun. Oranghanyamemikirkanhalyangkecilsajadanmengabaikanhallainnya. Individutakmampuberpikirlagi,diasudahharusdiberipertolongan/tuntunan. 4.Panik:lapanganpersepsisudahsangatsempit.Individutidakdapatmengendalikandirilagi. Bilamanusiasalahorientasi;ketikamenghadapimasalahpelik;rasadanperiksatidakberfungsi; Disebutorangsedangpanik. STRESSADAPTASI STRESS Stressadalahsuatuketidakseimbangandiri/jiwadanrealitaskehidupansetiaphariyangtidakdapat dihindariperubahanyangmemerlukanpenyesuaianSeringdianggapsebagaikejadianatauperubahan negatifyangdapatmenimbulkanstress,seperticedera,sakitataukematianorangyagdicintai,putus cintaPerubahanpositifjugadapatmenimbulkanstress,sepertinaikpangkat,perkawinan,jatuhcinta JENISSTRESS Stressfisik Stresskimiawi

Stressmikrobiologis Stressfisiologis Stressprosestumbuhkembang Stresspsikologisatauemosional Pengalamanstressdapatbersumberdari:Lingkungan,DiridantubuhPikiran ReaksiPsikologisterhadapstress a.Kecemasan ResponyangpalingumumMerupakantandabahayayangmenyatakandiridengansuatupenghayatan yangkhas,yangsukardigambarkanAdalahemosiyangtidakmenyenangkanistilahkuatir, tegang,prihatin,takutfisikjantungberdebar,keluarkeringatdingin,mulutkering,tekanan darahtinggidansusahtidur b.KemarahandanagresiAdalahperasaanjengkelsebagairesponterhadapkecemasanyangdirasakan sebagaiancaman.Merupakanreaksiumumlainterhadapsituasistressyangmungkindapat menyebabkanagresi,Agresiialahkemarahanyangmeluapluap,danorangmelakukanserangansecara kasardenganjalanyangtidakwajar.Kadangkadangdisertaiperilakukegilaan,tindaksadisdanusaha membunuhorang c.DepresiKeadaanyangditandaidenganhilangnyagairahdansemangat.Terkadangdisertairasasedih RESPONFISIOLOGITERHADAPSTRESS HansSelye(1946,1976)telahmelakukanrisetterhadap2responfisiologistubuhterhadapstress:Local AdaptationSyndrome(LAS)danGeneralAdaptationSyndrome(GAS). 1.LocalAdaptationSyndrom(LAS) Tubuhmenghasilkanbanyakresponssetempatterhadapstress.Responsetempatinitermasuk pembekuandarahdanpenyembuhanluka,akomodasimataterhadapcahaya,dll.Responnyaberjangka pendek. KarakteristikdariLAS: 1.responyangterjadihanyasetempatdantidakmelibatkansemuasystem 2.responbersifatadaptif;diperlukanstressoruntukmenstimulasikannya. 3.responbersifatjangkapendekdantidakterusmenerus. 4.responbersifatrestorative. Mungkinandabertanya,apasajayangtermasukkedalamLAS?.sebenarnyaresponLASinibanyak kitatemuidalamkehidupankitasehariharisepertiyangdiuraikandibawahini: a.Responinflamasi responinidistimulasiolehadanyatraumadaninfeksi.Responinimemusatkandirihanyapadaarea tubuhyangtraumasehinggapenyebaraninflamasidapatdihambatdanprosespenyembuhandapat berlangsungcepat.Responinflamasidibagikedalam3fase: fasepertama: adanyaperubahanseldansystemsirkulasi,dimulaidenganpenyempitanpembuluhdarahditempat cederadansecarabersamaanteraktifasinyakini,histamin,seldarahputih.Kininberperandalam memperbaikipermeabilitaskapilersehinggaprotein,leucositdancairanyanglaindapatmasuk ketempatyangcederatersebut. Fasekedua: pelepasaneksudat.Eksudatadalahkombinasicairandanselyangtelahmatidanbahanlainyang dihasilkanditempatcedera. Faseketiga: Regenerasijaringandanterbentuknyajaringanparut. b.Responrefleksnyeri

responinimerupakanresponadaptifyangbertujuanmelindungitubuhdarikerusakanlebihlanjut. Misalnyamengangkatkakiketikabersentuhandenganbendatajam. BagaimanadenganGAS.Gasmerupakanresponfisiologisdariseluruhtubuhterhadapstres.Respon yangterlibatdidalamanyaadalahsistemsarafotonomdansistemendokrin.DibeberapabukuteksGAS seringdisamakandenganSistemNeuroendokrin. 2.GeneralAdaptationSyndrom(GAS) a.FaseAlarm(Waspada) Melibatkanpengerahanmekanismepertahanandaritubuhdanpikiranuntukmenghadapistressor. Reaksipsikologisfightorflightdanreaksifisiologis.Tandafisik:curahjantungmeningkat, peredarandarahcepat,darahdiperiferdangastrointestinalmengalirkekepaladanekstremitas.Banyak organtubuhterpengaruh,gejalastressmemengaruhidenyutnadi,keteganganototdandayatahantubuh menurun Fasealaremmelibatkanpengerahanmekanismepertahanandaritubuhsepertipengaktifanhormonyang berakibatmeningkatnyavolumedarahdanakhirnyamenyiapkanindividuuntukbereaksi.Hormon lainnyadilepasuntukmeningkatkankadarguladarahyangbertujuanuntukmenyiapkanenergiuntuk keperluanadaptasi,teraktifasinyaepineprindannorepineprinmengakibatkandenyutjantungmeningkat danpeningkatanalirandarahkeotot.PeningkatanambilanO2danmeningkatnyakewaspadaanmental. Aktifitashormonalyangluasinimenyiapkanindividuuntukmelakukanresponsmelawanatau menghindar.Responinibisaberlangsungdarimenitsampaijam.Bilastresormasihmenetapmaka individuakanmasukkedalamfaseresistensi. b.FaseResistance(Melawan) Individumencobaberbagaimacammekanismepenanggulanganpsikologisdanpemecahanmasalah sertamengaturstrategi.Tubuhberusahamenyeimbangkankondisifisiologissebelumnyakepada keadaannormaldantubuhmencobamengatasifaktorfaktorpenyebabstress.Bilateratasigejalastress menuruntaunormal tubuhkembalistabil,termasukhormon,denyutjantung,tekanandarah,cardiacoutput.Individu tersebutberupayaberadaptasiterhadapstressor,jikainiberhasiltubuhakanmemperbaikiselselyang rusak.BilagagalmakaindividutersebutakanjatuhpadatahapaterakhirdariGASyaitu:Fase kehabisantenaga. c.FaseExhaustion(Kelelahan) Merupakanfaseperpanjanganstressyangbelumdapattertanggulangipadafasesebelumnya.Energi penyesuaianterkuras.Timbulgejalapenyesuaiandiriterhadaplingkungansepertisakitkepala, gangguanmental,penyakitarterikoroner,dll.Bilausahamelawantidakdapatlagidiusahakan,maka kelelahandapatmengakibatkankematian. Tahapinicadanganenergitelahmenipisatauhabis,akibatnyatubuhtidakmampulagimenghadapi stres.Ketidakmampuantubuhuntukmepertahankandiriterhadapstressorinilahyangakanberdampak padakematianindividutersbut. KONSEPADAPTASI Faktorpentingyangmempengaruhitingkah lakumanusia: 1.Kebutuhan Kebutuhanbadaniah Kebutuhanpsikologis 2.Dorongan Menjaminagarmanusiaberusaha

memenuhikebutuhannya. Stressterjadijikaorangdihadapkandenganperistiwayangdirasakansebagaimengancamfisikatau psikologisnya Peristiwanyadisebutstressor Reaksiorangterhadapperistiwatersebutdinamakanresponstress Adaptasiadalahprosesdimanadimensifisiologisdanpsikososialberubahdalamberesponterhadap stress.Karenabanyakstressortidakdapatdihindari,promosikesehatanseringdifokuskanpadaadaptasi individu,keluargaataukomunitasterhadapstress. Adabanyakbentukadaptasi.Adaptasifisiologismemungkinkanhomeostasisfisiologis.Namun demikianmungkinterjadiprosesyangserupadalamdimensipsikososialdandimensilainnya. Suatuprosesadaptifterjadiketikastimulusdarilingkunganinternaldaneksternalmenyebabkan penyimpangankeseimbanganorganisme.Dengandemikianadaptasiadalahsuatuupayauntuk mempertahankanfungsiyangoptimal.Adaptasimelibatkanrefleks,mekanismeotomatisuntuk perlindungan,mekanismekopingdanidealnyadapatmengarahpadapenyesuaianataupenguasaan situasi(Selye,1976,;Monsen,FloyddanBrookman,1992). Stresoryangmenstimulasiadaptasimungkinberjangkapendek,sepertidemamatauberjangkapanjang sepertiparalysisdarianggotageraktubuh.Agardapatberfungsioptimal,seseorangharusmampu beresponsterhadapstressordanberadaptasiterhadaptuntutanatauperubahanyangdibutuhkan. Adaptasimembutuhkanresponsaktifdariseluruhindividu. DIMENSIADAPTASI Stresdapatmempengaruhidimensifisik,perkembangan,emosional,intelektual,sosialdanspiritual. Sumberadaptifterdapatdalamsetiapdimensiini.Olehkarenanya,ketikamengkajiadaptasi klienterhadapstress,perawatharusmempertimbangkanindividusecaramenyeluruh. ADAPTASIFISIOLOGIS Indikatorfisiologisdaristressadalahobjektif,lebihmudahdiidentifikasidansecaraumumdapat diamatiataudiukur.Namundemikian,indicatorinitidakselaluteramatisepanjangwaktupadasemua klienyangmengalamistress,danindicatortersebutbervariasimenurutindividunya.Tandavital biasanyameningkatdanklienmungkintampakgelisahdantidakmampuuntukberistirahat aberkonsentrasi.Indikatorinidapattimbulsepanjangtahapstress. Durasidanintensitasdarigejalasecaralangsungberkaitandengandurasidanintensitasstressoryang diterima.Indikatorfisiologistimbuldariberbagaisistem.Olehkarenanyapengkajiantentangstress mencakuppengumpulandatadarisemuasistem.Hubunganantarastresspsikologikdanpenyakitsering disebutinteraksipikirantubuh.Risettelahmenunjukkanbahwastressdapatmempengaruhipenyakit danpolapenyakit.Padamasalampau,penyakitinfeksiadalahpenyebabkematianpalingutama,tetapi sejakditemukanantibiotic,kondisikehidupanyangmeningkat,pengetahuantentangnutrisiyang meningkat,danmetodesanitasiyanglebihbaiktelahmenurunkanangkakematian.Sekarangpenyebab utamakematianadalahpenyakityangmencakupstressorgayahidup. Indikatorfisiologisstress 1.Kenaikantekanandarah 2.Peningkatanketegangandileher,bahu,punggung. 3.Peningkatandenyutnadidanfrekwensipernapasan 4.TelapaktanganberkeringatTangandankakidingin 5.Posturtubuhyangtidaktegap 6.Keletihan 7.Sakitkepala 8.Gangguanlambung

9.Suarayangbernadatinggi 10.Mual,muntahdandiare. 11.Perubahannafsumakan 12.Perubahanberatbadan 13.Perubahanfrekwensiberkemih 14.Dilatasipupil 15.Gelisah,kesulitanuntuktiduratauseringterbangunsaattidur ADAPTASIPSIKOLOGIS Emosikadangdikajisecaralangsungatautidaklangsungdenganmengamatiperilakuklien.Stress mempengaruhikesejahteraanemosionaldalamberbagaicara.Karenakepribadianindividualmencakup hubunganyangkompleksdiantarabanyakfaktor,makareaksiterhadapstressyangberkepanjangan ditetapkandenganmemeriksagayahidupdanstresorklienyangterakhir,pengalamanterdahuludengan stressor,mekanismekopingyangberhasildimasalalu,fungsiperan,konsepdiridanketabahanyang merupakankombinasidaritigakarakteristikkepribadianyangdidugamenjadimediaterhadapstress. Ketigakarakteristikiniadalahrasakontrolterhadapperistiwakehidupan,komitmenterhadapaktivitas yangberhasil,danantisipasidaritantangansebagaisuatukesempatanuntukpertumbuhan(Wiebedan Williams,1992;Tarstasky,1993). Indikatoremosional/psikologidanperilakustress: Ansietas Depresi Kepenatan Peningkatanpenggunaanbahankimia Perubahandalamkebiasaanmakan,tidur,danpolaaktivitas. Kelelahanmental Perasaantidakadekuat Kehilanganhargadiri Peningkatankepekaan Kehilanganmotivasi. Ledakanemosionaldanmenangis. Penurunanproduktivitasdankualitaskinerjapekerjaan. Kecendrunganuntukmembuatkesalahan(mis.buruknyapenilaian). Mudahlupadanpikiranbuntu Kehilanganperhatianterhadaphalhalyangrinci. Preokupasi(mis.mimpisianghari) Ketidakmampuanberkonsentrasipadatugas. Peningkatanketidakhadirandanpenyakit Letargi Kehilanganminat Rentanterhadapkecelakaan. ADAPTASIPERKEMBANGAN Stresyangberkepanjangandapatmempengaruhikemampuanuntukmenyelesaikantugas perkembangan.Padasetiaptahapperkembangan,seseorangbiasanyamenghadapitugasperkembangan danmenunjukkankarakteristikperilakudaritahapperkembangantersebut.Stressyangberkepanjangan dapatmenggangguataumenghambatkelancaranmenyelesaikantahapperkembangantersebut.Dalam bentukyangekstrem,stressyangberkepanjangandapatmengarahpadakrisispendewasaan.Bayiatau anakkecilumumnyamenghadapistressordirumah.Jikadiasuhdalamlingkunganyangresponsivedan

empati,merekamampumengembangkanhargadiriyangsehatdanpadaakhirnyabelajarrespons kopingadaptifyangsehat(Haberetal,1992). Anakanakusiasekolahbiasanyamengembangkanrasakecukupan.Merekamulaimnyedaribahwa akumulasipengetahuandanpenguasaanketerampilandapatmembantumerekamencapaitujuan,dan hargadiriberkembangmelaluihubunganbertemandansalingberbagidiantarateman.Padatahapini, stressditunjukkanolehketidakmampuannatauketidakinginanuntukmengembangkanhubungan berteman.Remajabiasanyamengembangkanrasaidentitasyangkuattetapipadawaktuyangbersamaan perluditerimaolehtemansebaya.Remajadengansistempendukungsosialyangkuatmenunjukkan suatupeningkatankemampuanuntukmenyesuaikandiriterhadapstressor,tetapiremajatanpasistem pendukungsosialseringmenunjukkanpeningkatanmasalahpsikososial(Dubos,1992). Dewasamudaberadadalamtransisidaripengalamanmasaremajaketanggungjawaborangdewasa. Konflikdapatberkembangantaratanggungjawabpekerjaandankeluarga.Stresormencakupkonflik antaraharapandanrealitas. MANAJEMENSTRESS Manajemenstresskemungkinanmelihatpromosikesehatansebagaiaktivitasatauintervasiatau mengubahpertukaranrresponterhadappenyakit.Fokusnyatergantungpadatujuandariintervensi keperawatanberdasarkankeperluanpasien.Perawatbertanggungjawabpadaimplemenetasipemikiran yangdikeluarkanpadabeberapadaerahperawatan. MANAJEMENSTRESSUNTUKKLIEN REGULEREXERCISE DIETDANNUTRISI SUPPORTSISTEM TIMEMANAGEMENT HUMOR ISTIRAHAT TEHNIKRELAKSASI SPIRITUALITAS CaraPenyesuaianDiri Bilaseseorangmengalamistressmakasegeraadausahauntukmengatasinya.Halinidikenalsebagai Homeostasisyaituusahaorganismeyangterusmenerusmelakukanpertahananagarkeadaan keseimbanganselalutercapai.Stressdapatterjadipadabidangbadaniah(stressfisikatausomatik). Misalnya:bilaterjadiinfeksiataupenyakit,menggerakkanmekanismepenyesuaiansomatik,terjadi reaksi: Pembentukanzatantikuman,zatantiracun Mobilisasileukositketempattempatinvasikuman Lebihbanyakmelepaskankortisol,adrenalindansebagainya Usahatubuhuntukmencapaikeseimbangankembali Berorientasipadatugas:Bertujuanmenghadapistressorsecarasadar,realistik,objektif,rasional Pembelaanego Melindungiindividudarikecemasan Meringankanpenderitaanbilamengalamisuatukegagalan Menjagahargadiri Misalnya:seseorangyangmenghadapikegagalankemungkinanbereaksi: penyesuaiandiriberupaserangan(bekerjalebihkeras)ataumenghadapisecaraterangterangan

menarikdiridantidakmautaulagi(tidakberusaha) kompromiataumengurangikeinginannyalalumemilihjalantengah Reaksitersebutmenunjukkanlangkahlangkah: a.Mempelajaridanmenentukanpersoalan b.Menyusunalternatifpenyelesaian c.Menentukantindakanyangmempunyaikemungkinanbesarakanberhasil d.Bertindak e.Menilaihasiltindakandandapatmengambillangkahyanglainbilakurangmemuaskan MekanismePembelaanEGO Biladigunakanterusmenerusakibatnyaegobukannyamendapatperlindungan,melainkanlama kelamaanakanmendapatancaman/bencana.OlehkarenamekanismeiniTidakrealistikMengandung banyakunsurpenipuandirisendiriDistorsirealitaspemutarbalikanrealitas) MekanismePembelaanEGO 1.IDENTIFIKASI Inginmenyamaiseorangfiguryangdiidealkan,dimanasalahsatuciriatausegitertentudarifigureitu ditransferpadadirinya.Dengandemikianiamerasahargadirinyabertambahtinggi. Contoh:Teguh,15tahunmengubahmodelrambutnyamenirukanartisidolanyayangiakagumi. 2.INTROJEKSI Merupakanbentuksederhanadariidentifikasi,dimananilainilai,normanormadariluardiikutiatau ditaati,sehinggaegotidaklagitergangguolehancamandariluar.Contoh:Rasabenciataukecewa terhadapkematianorangyangdicintaidialihkandengancaramenyalahkandirisendiri. 3.PROJEKSI Haliniberlawanandenganintrojeksi,dimanamenyalahkanoranglainataskelalaiandankesalahan kesalahanataukekurangandirisendiri,keinginankeinginan,impulsimpulssendiri. Contoh:Seorangwanitamudayangmenyangkalbahwaiamempunyaiperasaanseksualterhadaprekan sekerjanya,berbalikmenuduhbahwatemannyatersebutmencobamerayunya 4.REPRESI Penyingkiranunsurpsikik(sesuatuafek,pemikiran,motif,konflik)sehinggamenjadinirsadar dilupakan/tidakdapatdiingatlagi).Represimembantuindividumengontrolimpulsimpuls berbahaya.Contoh:Suatupengalamantraumatismenjaditerlupakan 5.REGRESI Kembaliketingkatperkembanganterdahulu(tingkahlakuyangbersifatprimitif). Contoh:Seoranganakyangmulaiberkelakuansepertibayi,ketikaseorangadiknyadilahirkan. Esviyangberumur4tahunmulaimengompollagisejakadiknyayangbarulahirdibawapulangdari rumahsakit 6.REACTIONFORMATION Bertingkahlakuberlebihanyanglangsungbertentangandengankeinginankeinginan,perasaanyang sebenarnya.Mudahdikenalkarenasifatnyaekstrimdansukarditerima. Misalnya: Seorangwanitayangtertarikpadatemansuaminya,akanmemperlakukanorangtersebutdengankasar. 7.UNDOING Meniadakanpikiranpikiran,impulsyangtidakbaik,seolaholahmenghapussuatukesalahan. Misalnya: Seorangibuyangmenyesalkarenatelahmemukulanaknyaakansegeramemperlakukannyapenuh dengankasihsayang

8.DISPLACEMENT Mengalihkanemosi,artisimbolik,fantasidarisumberyangsebenarnya(benda,orang,keadaan)kepada oranglain,bendaataukeadaanlain. Misalnya: Seorangpemudabertengkardenganpacarnyadansepulangnyakerumahmarahmarahpadaadik adiknya 9.SUBLIMASI Menggantikeinginanatautujuanyangterhambatdengancarayangdapatditerimaolehmasyarakat. ImpulsyangberasaldariIdyangsukardisalurkanolehkarenamenggangguindividuataumasyarakat, olehkarenaituimpulsharusdirubahbentuknyasehinggatidakmerugikanindividu/masyarakat sekaligusmendapatkanpemuasan Misalnya: Impulsagresifdisalurkankeolahraga,usahausahayangbermanfaat 10.ACTINGOUT Langsungmencetuskanperasaanbilakeinginanterhalang. Misalnya: Mengatasiproblemdenganjalanpalingsedikitbertengkar 11.DENIAL Menolakuntukmenerimaataumenghadapikenyataanyangtidakenak. Misalnya: Seoranggadisyangtelahputusdenganpacarnya,menghindarkandiridaripembicaraanmengenai pacar,perkawinanataukebahagiaan 12.KOMPENSASI Menutupikelemahandenganmenonjolkankemampuannyaataukelebihannya. Misalnya: Saddamyangmerasafisiknyapendeksebagaisesuatuyangnegatif,berusahadalamhalmenonjolkan prestasipendidikannya 13.RASIONALISASI Memberiketeranganbahwasikap/tingkahlakunyamenurutalasanyangseolaholahrasional,sehingga tidakmenjatuhkanhargadirinya. Misalnya: Munawiryangmenyalahkancaramengajardosennyaketikaditanyakanolehorangtuanyamengapa nilaisemesternyaburuk. 14.FIKSASI Berhentipadatingkatperkembangansalahsatuaspektertentu(emosiatautingkahlakuataupikiran, dsb)sehinggaperkembanganselanjutnyaterhambat. Misalnya: Seoranggadisyangtetapberbicarakekanakkanakanatauseseorangyangtidakdapatmandiridan selalumengharapkanbantuandariorangtuanyadanoranglain. 15.SIMBOLISASI Menggunakanbendaatautingkahlakusebagaisimbolpenggantisuatukeadaanatauhalyang sebenarnya Misalnya: Seoranganakremajaselalumencucitanganuntukmenghilangkankegelisahannya/kecemasannya. Setelahditelusuri,ternyataiapernahmelakukanmasturbasisehinggaperasaanberdosa/cemasdan merasakotor

16.DISOSIASI Pemisahansuatukelompokprosesmentalatauperilakudarikesadaran/identitasnya.Keadaandimana terdapatduaataulebihkepribadianpadadiriseorangindividu. Misalnya: Seoranglakilakiyangdibawakeruangemergensikarenamengamukternyatatidakmampu menjelaskankembalikejadiantersebut(ialupasamasekali) 17.KONVERSI Adalahtransformasikonflikemosionalkedalambentukgejalagejalajasmani. Misalnya: Seorangmahasiswayangtidakmengerjakantugastugasnyatibatibamerasasakitsehinggatidak masukkuliah

AsuhanKeperawatanpadaKlienyangMengalamiStressdanKecemasan Perawattidakbolehmenyepelekanstressyangringankarenajikaseseorangyagterkenastressringan terpaparterusdalamjangkawaktuyanglamaakandapatmerupakanpitugerbangdalamgangguan penyakityangserius.Olehkarenaituperawatmestimemahamikonsepstress,kopingdanadatasi sehinggadapatmemberikanbantuankepadakliensecaracepatdantepatmelaluipengkajianyag cermat,diagnosekeperawatanyangsesuaidengankebutuhan.. A.Pengkajian.Pengkajianterhadapmasalahstress,perawatmestimenerapkankonsephubungan perawatklienyangterapetik.Komunikasiperawatklienselamaberinteraksiseringkalimengalami hambatandalamucapanatauperkataanperawatyangtidakterapetiksehinggatidakjarangjustru meningkatkantingkatstressdariklien. B.Pohonmasalahkeperawatan.Sebelummengadakandiagnosekeperawatanterlebihdahulumembuat pohonmasalahkeperawatanyaitumembuatanalisismasalahyangsedangdihadapiklienpadasaatini. Daripohonmasalahkeperawatanininantinyaakandiketahuiakarmasalahyangsedangdihadapioleh kliensehinggabantuanyangdiberikansesuaidengankebutuhanklien. C.Daftarmasalahkeperawatan.Daftarmasalahharusdibuatterlebihdahuluuntukmengidentifikasi semuamasalahyangadapadaklienyangmengalamistress. Sumber:http://id.shvoong.com/medicineandhealth/2109942asuhankeperawatanpadaklien yang/#ixzz1SrmRQv8U