You are on page 1of 266

J. MILEI & J.

LERMAN

CARDIOLOGA
TEMAS ACTUALES
La presente es una publicacin de:

www.corpuslibros.com

Milei, Jos
Cardiologa, temas actuales / Jos Milei y Jorge Lerman. - 1a ed. - Ciudad Autnoma de Buenos Aires:
&RUSXV/LEURV0pGLFRV\&LHQWtFRV
S[FP

,6%1

1. Cardiologa. I. Lerman, Jorge


&''

)HFKDGHFDWDORJDFLyQ

DERECHOS RESERVADOS
&RUSXV(GLWRULDO\'LVWULEXLGRUD
editorial@corpuslibros.com
mileilerman@corpuslibros.com
www.corpuslibros.com
7XFXPiQ7HO)D[  
&$$5 &LXGDG$XWyQRPDGH%XHQRV$LUHV$UJHQWLQD

Editor: Esteban Oscar Mestre

7LUDGDHMHPSODUHV
6HWHUPLQyGHLPSULPLUHQ
Buenos Aires - Argentina

ISBN: 

No est permitida la reproduccin total o parcial


de esta obra, ni su tratamiento o transmisin por
cualquier medio o mtodo, sin autorizacin escrita
de la Editorial.
J. MILEI & J. LERMAN

CARDIOLOGA
TEMAS ACTUALES

www.corpuslibros.com
AUTORES

Jos Milei
Es Doctor en Medicina y Mdico Cardilogo Universitario. Es Director, por concurso, del Instituto
GH ,QYHVWLJDFLRQHV &DUGLROyJLFDV 3URI 'U$OEHUWR & 7DTXLQL 8QLYHUVLGDG GH %XHQRV$LUHV
&21,&(7 (V3URIHVRU7LWXODU&RQVXOWRGH0HGLFLQD,QWHUQDGHOD)DFXOWDGGH0HGLFLQD 8%$ 
Miembro de la Carrera de Investigador del CONICET, categora Principal y Miembro Titular de la
6RFLHGDG$UJHQWLQDGH&DUGLRORJtDGHVGHRFXSDQGRHQODPLVPDGLYHUVRVFDUJRVVRFLHWDULRV
)RUPDSDUWHGHO&RPLWpHGLWRULDOGHQXPHURVDVUHYLVWDVFLHQWtFDVQDFLRQDOHVHLQWHUQDFLRQDOHV)XH
6XEVHFUHWDULR$FDGpPLFR\([&RQVHMHUR$FDGpPLFRGHOD)DFXOWDGGH0HGLFLQDGHOD8QLYHUVLGDG
de Buenos Aires y actualmente Director del Departamento de Postgrado de la Universidad del
Noreste. +D SXEOLFDGR PiV GH  WUDEDMRV GH LQYHVWLJDFLyQ FOtQLFD R DSOLFDGD  GH pVWRV HQ
LGLRPDLQJOpV\HQUHYLVWDVLQGL]DGDVHQ0HG/LQHDVtFRPRXQDGHFHQDGHOLEURV6XWUDWDGR
VREUHODHQIHUPHGDGGH&KDJDVHVHOOLEURGHUHIHUHQFLDHQORV~OWLPRVDxRV. Ha desarrollado
SURIXQGRVOD]RVGHFRRSHUDFLyQFLHQWtFDFRQGLYHUVRVFHQWURVGHIDPDLQWHUQDFLRQDO

Jorge Lerman
Es Doctor en Medicina y Mdico Cardilogo. Fue Visiting Scientist de la Universidad de
Washington, EEUU. Desarroll toda su carrera asistencial, docente y de investigacin en el Hospital
GH &OtQLFDV -RVp GH 6DQ 0DUWtQ GHO TXH IXH -HIH GH OD 'LYLVLyQ &DUGLRORJtD GXUDQWH  DxRV \
'LUHFWRU$VRFLDGRGH'RFHQFLDH,QYHVWLJDFLyQGXUDQWHDxRV
(VDFWXDOPHQWH3URIHVRU$VRFLDGR&RQVXOWRGH&DUGLRORJtDGH8QLYHUVLGDGGH%XHQRV$LUHV\([
Presidente de la Fundacin Cardiolgica Argentina. Desarroll intensa actividad en numerosas
iUHDVGHOD6RFLHGDG$UJHQWLQDGH&DUGLRORJtDGHODTXHIXHVX3UHVLGHQWHHQ3UHVLGHQWHGHO
&RPLWp2UJDQL]DGRUGHO;9,&RQJUHVR0XQGLDOGH&DUGLRORJtDHQ\'LUHFWRUGHO&RQVHQVR
GH3UHYHQFLyQ&DUGLRYDVFXODUHQ
+DSXEOLFDGRPiVGHWUDEDMRVHQUHYLVWDVQDFLRQDOHVHLQWHUQDFLRQDOHVFRQDUELWUDMH\SUHVHQWDGR
PiVGHDEVWUDFWVHQFRQJUHVRVQDFLRQDOHVHLQWHUQDFLRQDOHV(VDXWRURFRDXWRUGHOLEURVR
FDStWXORVGHOLEURVJDQDGRUGHSUHPLRVFLHQWtFRV\GLUHFWRUGHYDULDVWHVLVGHGRFWRUDGR


CO-AUTORES

Giuseppe Ambrosio
Director del Departamento de Cardiologia Universidad de Perugia, Facultad de Medicina, Ospedale
S. Maria della Misericordia Perugia, Italia.
Profesor Honorario, Universidad de Buenos Aires.

Francisco Azzato
Profesor Titular de Medicina Interna, Universidad de Buenos Aires.
Director del Departamento de Medicina y de la Unidad Hospitalaria del Hospital de Clnicas Jos
de San Martin.

Ricardo Beigelman
Mdico Cardilogo Universidad de Buenos Aires.
(['LUHFWRU\DFWXDOGHO&RQVHMRGH6WURNHGHOD6RFLHGDG$UJHQWLQDGH&DUGLRORJtD6DQDWRULRGH
Denton Cooley.

Claudio Bellido
Mdico Cardilogo Universitario.
(VSHFLDOLVWDHQ+LSHUWHQVLyQ$UWHULDO3URIHVRU$GMXQWR&RQVXOWRGH0HGLFLQD,QWHUQD8QLYHUVLGDG
de Buenos Aires. Miembro del Programa de Geriatria y Gerontologa del Hospital de Clnicas Jos
de San Martn.

Sara Berensztein
3URIHVRUD$GMXQWDGH0HGLFLQD,QWHUQD8QLYHUVLGDGGH%XHQRV$LUHV
Jefa de la Divisin Cardiologa del Hospital de Clnicas Jos de San Martin.

Federico Cintora
Mdico de Planta de la Divisin Cardiologa del Hospital de Clnicas Jos de San Martin.
([6HFUHWDULRGHOD)XQGDFLyQ&DUGLROyJLFD$UJHQWLQD

Fernando de Valais
Fundacin Arrhythmia Alliance.

Jorge Gonzlez Zuelgaray


Director Centro de Arritmias del Instituto de Investigaciones Cardiolgicas Prof. Dr. Alberto C.
Taquini.
Sanatorio de la Trinidad San Isidro.
Fundacin Arrhythmia Alliance.

Julin Gonzlez
Mdico de planta del Instituto de Investigaciones Cardiolgicas Prof. Dr. Alberto C. Taquini.

Andrs M. Izaguirre
Mdico Cardilogo Universidad de Buenos Aires. Servicio de Ecodoppler Cardiaco del Hospital
(VSDxRO(['LUHFWRU\DFWXDO$VHVRUGHO&RQVHMRGH6WURNHGHOD6RFLHGDG$UJHQWLQDGH&DUGLRORJtD

7
Roberto Peidro
Vicepresidente de la Fundacin Cardiolgica Argentina.
Director del Comit de Cardiologa del Deporte de la Sociedad Argentina de Cardiologa. Subdirector
de la Carrera de Mdico Especialista en Medicina del Deporte, Universidad de Buenos Aires.

Martn Perea
Mdico Cardilogo del Sanatorio Las Lomas
Ricardo Prez de la Hoz
3URIHVRU$GMXQWRGH0HGLQD9&iWHGUD8QLYHUVLGDGGH%XHQRV$LUHV
Jefe de la Unidad Coronaria Hospital de Clnicas Jos de San Martn.

Gustavo Risso
Mdico de planta del Instituto de Investigaciones Cardiolgicas Prof. Dr. Alberto C. Taquini.

Gastn Rodriguez Granillo


Jefe de la Seccin TC y RM Cardiaca de la Clnica la Sagrada Familia.
Miembro de la Carrera del Investigador del Conicet.

Pablo Roura
Mdico Cardilogo Universitario y Jefe de Cardiologa del instituto Argentino del Diagnostico y
Tratamiento.

Eduardo Rusak
Medico Cardilogo Especialista en Hipertensin Arterial.
Magister en Mecnica Vascular e Hipertensin Arterial.
Director del Curso de Hipertensin Arterial de la Sociedad Argentina de Hipertensin Arterial.
Miembro del Programa de Geriatria y Gerontologa del Hospital de Clnicas Jos de San Martn.

Samuel Sclarovsky
Profesor Emrito de la Universidad de Tel Aviv.
Assuta Medical Center.

Augusto Torino
Doctor en Medicina Universidad de Buenos Aires.
3URIHVRU$GMXQWRGH0HGLFLQD)XQGDFLyQ)DYDORUR

Isabella Tritto
Departamento de Cardiologia Universidad Perugia, Italia.

Agustn Vanella
Fundacin Arrhythmia Alliance.

Hctor O.Ventura
Presidente del Comit de Educacin Mdica.
Director del Programa de Entrenamiento y Educacin de la Enfermedad Cardiovascular.
Ochsner Clinic Foundation, New Orleans. Profesor de Medicina en la Facultad de Medicina de
Tulane, New Orleans.

Cinzia Zuchi
Departamento de Cardiologia Universidad Perugia, Italia.


A nuestras esposas, hijas y nietos
PRLOGO

1XPHURVRVLQWHUURJDQWHVH[LVWHQHQODSUiFWLFDFDUGLROyJLFDGLDULDTXHUHSUHVHQWDQXQGLOHPDSDUD
HOPpGLFRWUDWDQWH6LQHPEDUJRSRFDVREUDVH[LVWHQHQODOLWHUDWXUDPpGLFD\PHQRVD~QHQ&DVWH-
OODQRTXHDEDUTXHQHVWRVWHPDVHQXQWUDEDMRPRQRJUiFRGHXQPRGRSUiFWLFR\DFFHVLEOHIXHUD
GHODHVWUXFWXUDUtJLGDGHYRO~PHQHVGHWH[WRRVLPLODUHV5HFXHUGRTXHGHVGHPLVWLHPSRVGHHVWX-
GLDQWHGH0HGLFLQD\OXHJRFRPR5HVLGHQWHGH&DUGLRORJtDORVHVWXGLDQWHV\ORVPpGLFRVMyYHQHV
cursando las primeras etapas de nuestro entrenamiento estabamos permanentemente a la bsqueda
GHRSLQLRQHVH[SHUWDVHQODOLWHUDWXUDTXHSXGLHVHQDSRUWDUXQDYLVLyQSUiFWLFD\UHDOLVWDVREUHVLWXD-
FLRQHVFOtQLFDVFRPSOHMDVPDVDOODGHODVTXHSRGLDPRVHQFRQWUDUHQYROXPHQHVGHWH[WRGHPDVLDGR
HVWUXFWXUDGRV\DOHMDGRVGHODVFXHVWLRQHVFOtQLFDVQRYHGRVDVTXHGHVSHUWDEDQQXHVWURLQWHUpV(VWH
volumen, editado por J. Milei y J. Lerman, cumple precisamete los requisitos mencionados antes y
ofrece un gran atractivo tanto para el mdico tratante como para los mdicos en formacin.
5HSUHVHQWDSDUDPLXQKRQRU\XQDVDWLVIDFFLyQSURORJDUHVWHH[FHOHQWHOLEURHGLWDGRSRUORV
Dres. Milei y Lerman, cuya reconocida trayectoria en docencia e investigacin clnica no requiere
presentacin. Ellos han seleccionado una serie de temas de gran actualidad, abordados, cada uno
GHHOORVSRUH[FHOHQWHVFOtQLFRV/DRSLQLyQGHHVWRVH[SHUWRVFODUDPHQWHGHVDUUROODGDHQFDGD
FDStWXORVHUiGHJUDQXWLOLGDGSDUDHOPDQHMRGHOSDFLHQWHHQODSUiFWLFDGLDULD
Una caracteristica fundamental de este libro es el enfoque prctico que los autores han dado a
cada uno de sus captulos y la presentacin clara y concisa de la obra en general. Las ilustraciones
TXHDFRPSDxDQORVGLYHUVRVFDStWXORVGHOOLEURVRQ~WLOHVSDUDODFRPSUHQVLyQGHORVFRQFHSWRVYHU-
WLGRVHQHOWH[WR\FLHUWDPHQWHIDFLOLWDQVXOHFWXUD/RVDXWRUHVGHFDGDXQRGHORVFDStWXORVKDQVLGR
HVFRJLGRVSRUVXH[WHQVRFRQRFLPLHQWRGHOWHPDWUDWDGR\VXFDSDFLGDGGLGiFWLFD(QHVWDpSRFDHQ
que la oferta de informacin mdica es, de algn modo, apabullante, este libro canaliza, de un modo
elegante y prctico el caudal de conocimiento que ofrecen los diversos autores y que ha sido muy
FULWHULRVDPHQWHSODQLFDGR\RUJDQL]DGRSRUORVHGLWRUHV
1RHVIUHFXHQWHKDOODUHQHOFRQWH[WRGHOLGLRPD(VSDxROXQDREUDTXHFRPRHVWDTXHQRVRFX-
pa, presente tantos temas de actualidad tratados de un modo tan accesible y prctico. Los clnicos
y estudiantes que lean este libro encontraran respuesta a muchos de los interrogantes que plantean
sus pacientes en la prctica cotidiana y tendrn la oportunidad de conocer el pensamiento de estos
clnicos sagaces en relacin a tcnicas diagnsticas y tratamientos de las diversas entidades abar-
cadas en la obra.

Juan Carlos Kaski,


Dsc, MD, DM (Hons),
FRCP, FESC, FACC, FAHA
Professor of Cardiovascular Science
St. Georges, University of London

11
PREFACIO

/D H[WHQVD \ UiSLGDPHQWH FUHFLHQWH DPSOLWXG TXH HVWi DGTXLULHQGR OD 0HGLFLQD HQ JHQHUDO \ OD
&DUGLRORJtDHQSDUWLFXODUDEDUFDGHVGHODVFLHQFLDVTXHLQGDJDQHOIXQFLRQDPLHQWRVXEFHOXODU OD
%LRORJtD0ROHFXODU KDVWDODVTXHDQDOL]DQODDUTXLWHFWXUDGHODGLVWULEXFLyQGHODVHQIHUPHGDGHVHQ
ODVSREODFLRQHV OD(SLGHPLRORJtD (OORKDFHTXHODSURGXFFLyQGHXQOLEURGHWH[WRRXQWUDWDGRVH
transforme en una labor de una dimensin que hace que solo el tiempo que lleva engendrarla hace
que se vuelva obsoleta.
(QFRQVHFXHQFLDQXHVWURSURSyVLWRDOGLVHxDUHVWDREUDIXHVHOHFFLRQDUDOJXQRVGHORVWHPDVHQORV
TXHVHKDQSURGXFLGRDYDQFHVUHFLHQWHV\VLJQLFDWLYRVFRQLPSDFWRHQODSUiFWLFDFOtQLFD\GLJQRV
de ser actualizados y discutidos. Para ello convocamos a un grupo de prestigiosos especialistas con
FRQRFLGDWUD\HFWRULDDFDGpPLFD\H[SHULHQFLDDVLVWHQFLDOGRFHQWH\GHLQYHVWLJDFLyQHQGLYHUVDV
reas de 1a Cardiologa.
Algunos temas fueron abordados primordialmente desde las ciencias bsicas, otros en referencia
a los recursos diagnsticos, muchos de ellos por la clnica y en casi todos los casos en referencia a
ORVDFXHUGRVDFWXDOHVDFHUFDGHVXPDQHMRSRUHOPpGLFRSUiFWLFR
&RPRREMHWLYRVGHHVWDREUDFRQVLGHUDPRVTXHVHUi~WLOSDUDHOHVWXGLDQWHGH0HGLFLQDLQWHUHVDGR
HQ SURIXQGL]DU HO DSUHQGL]DMH GH FLHUWDV iUHDV GH OD HVSHFLDOLGDG SDUD ORV PpGLFRV UHVLGHQWHV \
especialistas en formacin, para el cardilogo en actividad y para otros especialistas relacionados
como los internistas, los medicos de atencin primaria y los colegas de otras especialidades de
la Clinica Medica como la Hematologa, la Neurologa, el Intensivismo, la Emergentologia o la
Geriatra.
Nuestro reconocimiento a los centros acadmicos donde nos formamos como profesionales:
OD )DFXOWDG GH 0HGLFLQD GH OD 8QLYHUVLGDG GH %XHQRV$LUHV OD 6H[WD &iWHGUD GH 0HGLFLQD ORV
Hospitales de Clnicas y Juan A. Fernndez y a nuestros maestros los profesores Osvaldo Fustinoni,
$OELQR3HURVLR\/XLV6XiUH] -/ \0DXULFLR5DSDSRUW9tFWRU)HUUDQV\/HyQGH6ROGDWL -0 
Agradecemos a nuestras familias, a todos los colaboradores que han brindado sus conocimientos,
VXH[SHULHQFLD\VXDUWHDOHQFDUDUODUHGDFFLyQGHORVGLIHUHQWHVFDStWXORVTXHLQWHJUDQHVWDREUD\D
Patricia Alegre, Karina Cassino y Liliana Iaconianni por la cooperacin desinteresada en el apoyo
HGLWRULDOHLFRQRJUiFR

Prof. Jorge Lerman


Prof. Jos Milei


INDICE

Captulo 1 - Nuevos aspectos Captulo 10 - Angina de pecho en


en la siopatologa de la placa la mujer
ateroesclertica CINZIA ZUCHI, ISABELLA TRITTO,
JOS MILEI, FRANCISCO AZZATO ............................. 13 GIUSEPPE AMBROSIO .......................................... 133

Captulo 2 - Diagnstico por Captulo 11 - Actualizacin en


imgenes en prevencin primaria sndromes coronarios agudos
GASTN A. RODRGUEZ GRANILLO ......................... 25 RICARDO PREZ DE LA HOZ................................. 147

Captulo 3 - Biopsia Captulo 12 - Insuciencia


endomiocrdica procedimiento cardaca avanzada y transplante
diagnstico o de investigacin? cardaco
JULIN GONZLEZ, GUSTAVO RISSO, FRANCISCO AZZATO, HECTOR VENTURA ............................................. 165
JOS MILEI ......................................................... 37
Captulo 13 - El corazn del
Captulo 4 - Remodelacin deportista
siolgica y patolgica ROBERTO M. PEIDRO ......................................... 181
SAMUEL SCLAROVSKY ........................................... 47
Captulo 14 - Tratamiento de la
Captulo 5 - Impacto brilacin auricular con ablacin
cardiovascular del sndrome por radiofrecuencia
metablico AGUSTN VANELLA, FERNANDO DE VALAIS Y JORGE
JORGE LERMAN ................................................... 57 GONZLEZ ZUELGARAY....................................... 199

Captulo 6 - Miocardiopata Captulo 15 - Muerte sbita y


hipertrca reanimacin cardiopulmonar
C. SARA BERENSZTEIN .......................................... 75 FEDERICO CINTORA............................................ 213

Captulo 7 - Miocardiopata Captulo 16 - Hipertensin


restrictiva arterial en los ancianos
C. SARA BERENSZTEIN .......................................... 91 CLAUDIO A. BELLIDO, EDUARDO J. RUSAK ............. 225

Captulo 8 - Insuciencia mitral Captulo 17 - La enfermedad


AUGUSTO TORINO, PABLO ROURA ....................... 107 carotidea
RICARDO BEIGELMAN, ANDRES M IZAGUIRRE ........... 233
Captulo 9 - Estenosis artica
AUGUSTO TORINO, MARTN PEREA ....................... 121


CAPTULO 1

1XHYRVDVSHFWRVHQODVLRSDWRORJtD
de la placa ateroesclertica
JOS MILEI, FRANCISCO AZZATO

Es importante destacar que si bien las manifestaciones SRUODIRUPDFLyQGHSODFDVEURVDVHQODtQWLPDTXH


clnicas y patolgicas de la enfermedad aterosclertica SXHGHHVWDUDFRPSDxDGDSRUXQQ~FOHRFHQWUDOULFRHQ
DSDUHFHQ GHVSXpV GH ORV  DxRV GH HGDG VH KD GH- OtSLGRV\SRUFDOFLFDFLyQ\SXHGHFRPSOLFDUVHSRUOD
mostrado que las lesiones pre-ateroesclerticas apa- ruptura de su cubierta, con trombosis y/o hemorragia
recen muy tempranamente, an en la vida fetal y es- LQWUDSODFD   )LJXUD 
pecialmente vinculadas a las clulas musculares lisas Durante la aterognesis ocurren bsicamente tres
&0/ (QHIHFWRVHKDQHQFRQWUDGROHVLRQHVLQWLPD- KHFKRVSULQFLSDOHVDXQTXHFRQXQDVHFXHQFLDVXMHWD
les en las arterias coronarias de fetos de madres fuma- DFRQWURYHUVLDVD 0LJUDFLyQ\SUROLIHUDFLyQGHODV
doras, muertos sin causa aparente luego de la semana FpOXODVPXVFXODUHVOLVDV &0/ \VtQWHVLVGHPDWUL]
GHJHVWDFLyQFRPRH[SOLFDUHPRVPiVDGHODQWH   H[WUDFHOXODUE ,QYDVLyQGHODSDUHGDUWHULDOSRUSDUWH
La ateroesclerosis, con sus complicaciones y sus GHPRQRFLWRV\OLQIRFLWRV7\F $FXPXODFLyQOLStGL-
GLIHUHQFLDVWRSRJUiFDVHVFRQVLGHUDGDGHVGHHOSXQ- ca y retencin de lipoprotenas por parte de macrfa-
to de vista epidemiolgico la primera causa de morbi- JRV\&0/  
lidad y mortalidad en pases occidentales a travs de
las enfermedades coronaria, cerebro-vascular y arte- CLULAS MUSCULARES LISAS
rial perifrica. En su forma establecida, se caracteriza /DV &0/ MXHJDQ XQ SDSHO FHQWUDO HQ OD DWHURHVFOH-
rosis temprana y en la establecida, por eso parte de
nuestros estudios estn focalizados en estas clulas.
5HSUHVHQWDQ HO  GH ORV FRPSRQHQWHV FHOXODUHV
HQ SODFDV FUyQLFDV \ SXHGHQ OOHJDU D VHU HO  HQ
lesiones tempranas. Est ampliamente demostrado
que las CML tienen la capacidad de migrar desde la
PHGLDDODtQWLPD )LJXUD EDMRGLVWLQWRVWLSRVGH
estimulacin, mediante movimientos de tipo ameboi-
GH8QDYH]DOOtSUROLIHUDQ  \SURGXFHQGLVWLQWDV
VXVWDQFLDVFRPRFRPSRQHQWHVGHPDWUL]H[WUDFHOXODU
SURWHRJOLFDQRV  \ HQ]LPDV SURWHROtWLFDV $GHPiV
DFXPXODQ FROHVWHURO HVWHULFDGR OR FXDO IDYRUHFH
WDPELpQODSURJUHVLyQGHODHQIHUPHGDGMXQWRFRQOD
acumulacin de restos necrticos. La migracin, pro-
Figura 1.1 Corte transversal de arteria coronaria. Ncleo cen- liferacin y diferenciacin de CML y macrfagos son
tral rico en lpidos con hemorragias intraplaca focales, calci-
cacin y erosin de la cubierta con calcicacin (azul, echa)
respuestas patolgicas que contribuyen al desarrollo
complicada por la formacin de una trombosis reciente oclu- y progresin de lesiones arteriales. Todo este proceso
siva. Tricrmico de Masson. 40x. (13) constituye la activacin de las CML.

17
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

La proliferacin de las CML constituye un paso torio sobre la proliferacin celular ya que inhibe la
clave en el camino de la aterognesis y puede estar VtQWHVLVGH$'1 )LJXUD  
GLULJLGDSRUFpOXODVLQPXQHVLQDPDWRULDVVHULQGX- /DPXWDFLyQGHHVWHJHQOOHYDDODH[SUHVLyQGH
FLGDSRUPHFDQLVPRVWy[LFRVRELHQGHVDUUROODUVHHQ una protena antignicamente idntica, pero metab-
forma autcrina. licamente ms estable, que tiene un tiempo de vida
(QHOSULPHUFDVRODVFpOXODVLQPXQHVLQDPDWRULDV mayor y posee sus propiedades regulatorias alteradas
SURGXFHQ GLIHUHQWHV PROpFXODV IDFWRU GH FUHFLPLHQWR sobre el crecimiento celular. El resultado es la esti-
GHULYDGRGHODVSODTXHWDV3'*)IDFWRUGHFUHFLPLHQWR mulacin de la proliferacin celular y una apoptosis
HSLGpUPLFR(*)LQWHUOHXNLQD,/IDFWRUGHQH- GHVUHJXODGD 8VDQGR DQWLFXHUSRV HVSHFtFRV SXHGH
FURVLVWXPRUDO71)HWF TXHDFW~DQFRPRPLWyJH- ORFDOL]DUVHHVWDSURWHtQDSPXWDGDDFXPXODGDHQHO
nos, activan factores de transcripcin, as como tambin ncleo por poseer un tiempo de vida ms largo. As,
proto-oncogenes como el c-fos y c-myc, que regulan la SFXPSOHXQSDSHOLPSRUWDQWHHQODSDWRJpQHVLV\
H[SUHVLyQGHJHQHVLQYROXFUDGRVHQODUHVSXHVWDLQD- progresin de una serie de enfermedades incluyendo
PDWRULDSUROLIHUDWLYDGHODVOHVLRQHV   ODDWHURHVFOHURVLV 
Como se describi previamente, el antgeno nu- En un estudio de nuestro grupo, se analizaron
clear de proliferacin celular, PCNA y el c-fos son placas ateroesclerticas estables e inestables o no
PDUFDGRUHV GH OD DFWLYLGDG SUROLIHUDWLYD /D H[SUH- complicadas y complicadas, mediante tcnicas in-
sin aumentada del gen c-fos tiene un efecto mitog- munohistoqumicas para analizar la evolucin de las
QLFRVREUHODVFpOXODVOXHJRGHODPLJUDFLyQ   mismas. Se observ positividad de PCNA, c-fos y
/D SURWHtQD VXSUHVRUD GH WXPRUHV S WDPELpQ S HQ WRGDV ODV SODFDV LQHVWDEOHV GH SDFLHQWHV VLQ-
est involucrada en este proceso. Es una molcula WRPiWLFRV   /RV UHVXOWDGRV IXHURQ QHJDWLYRV HQ
esencial en la proliferacin celular y la muerte celu- los pacientes asintomticos, demostrando la impor-
ODU SURJUDPDGD DSRSWRVLV  SRVHH XQ HIHFWR LQKLEL- WDQFLD GH 3&1$ FIRV \ S FRPR PDUFDGRUHV GH
la biologa vascular y del proceso aterognico. Esta
serie tuvo gran importancia, no slo por sus hallaz-
gos concretos sino por la apertura en la bsqueda de
marcadores moleculares de inestabilidad de placa.
En otras palabras, mirar a la enfermedad desde un
nuevo ngulo que se deber complementar con la
imagenologa.
(QORTXHUHVSHFWDDIDFWRUHVWy[LFRVQXHVWURJUX-
SRHVWXGLyODH[LVWHQFLDGHOHVLRQHVDWHURHVFOHUyWLFDV
tempranas en fetos y lactantes y su relacin con el
tabaquismo materno, como factor de riesgo para el
GHVDUUROORGHODHQIHUPHGDG  (QHOGHORV
casos analizados, que incluyen fetos y lactantes, se
han evidenciado alteraciones pre-ateroesclerticas
inciales en las arterias de los fetos y se ha demos-
Figura 1.2 Las CML tienen la capacidad de migrar desde la
media a la ntima, bajo distintos tipos de estimulacin, me-
trado la formacin y progresin de placas ateroescle-
diante movimientos de tipo ameboide (D). Una vez all, proli- UyWLFDV HQ ORV ODFWDQWHV )LJXUD   (Q UHODFLyQ DO
feran y producen engrosamientos intimales. A, B y C. WDEDTXLVPRPDWHUQRHQHOGHORVIHWRV\HQHO

Figura 1.3 Corte transversal de arteria coronaria de feto de edad gestacional estimada en 12 a 16 semanas, fallecido producto
de un aborto infectado en curso. 1A- Arteria coronaria derecha HE 10x 1B- HE 25x 1C- HE 40x. Marcado engrosamiento intimal
por proliferacin de CML.


CAPTULO 1 1XHYRVDVSHFWRVHQODVLRSDWRORJtDGHODSODFDDWHURHVFOHURWLFD

Figura 1.4 Arterias coronarias de lactantes con diferentes tipos de engrosamientos miointimales.

GHORVLQIDQWHVKLMRVGHPDGUHVIXPDGRUDVVH ateromas humanos son capaces de regular por si mis-


detectaron lesiones ateroesclerticas coronarias mul- mas su proliferacin secretando factores mitognicos
tifocales de variadas caractersticas, desde placas fo- como el PDGF, por lo menos en los estados tempra-
cales con proliferacin y migracin de CML y engro- nos de la aterognesis.
VDPLHQWRPLRLQWLPDOOHYHHQODHWDSDSUHQDWDO )LJXUD Esto a su vez se ve apoyado por el hallazgo de
  KDVWD SODFDV EODQGDV MXYHQLOHV FRQ REVWUXFFLyQ la positividad de c-fos en las lesiones tempranas y
GHODOX]DUWHULDOHQORVODFWDQWHV )LJXUD  ODFRQUPDFLyQGHOHIHFWRPLWRJpQLFRTXHGHVHQFD-
En el caso de la estimulacin autcrina de la pro- dena la activacin del gen c-fos y la mutacin de la
liferacin, se ha visto que las CML provenientes de SURWHtQDSHQHOQ~FOHRGHODV&0/FRPRKHPRV
detallado en las arterias coronarias de infantes y fetos
KLMRVGHPDGUHVIXPDGRUDV  
(QKXPDQRVODV&0/H[SUHVDQVyORXQDGHODV
GRVFDGHQDVSROLSHSWtGLFDVGHO3'*) VHKDQHYLGHQ-
ciado mRNAs de la cadena A en cultivos de CML
SURYHQLHQWHV GH SODFDV DWHURHVFOHUyWLFDV KXPDQDV 
&DEHKDFHUQRWDUTXHVHKDQSXULFDGRKRPRGtPHURV
AA de PDGF en clulas derivadas de osteosarcomas
humanos, lo que enfatiza el paralelismo de la ateroes-
clerosis y las neoplasias como ya se ha propuesto.
Figura 1.5 Bifurcacin de arteria descendente anterior con
El concepto de que una clula pueda generar su pro-
placa brosa y marcada disminucin parcial de la luz arterial, pio estmulo mitognico se deriva de los estudios de
en un lactante. Orcena 40x. (13) WUDQVIRUPDFLyQQHRSOiVLFD  

19
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Una vez en la ntima, las CML muestran cambios de capas medias normales y CML epitelioides ob-
fenotpicos con respecto a las CML de la media, las tenidas de arterias con engrosamiento intimal post
FpOXODVKDVWDHVHPRPHQWRFRQWUiFWLOHV QRSUROLIHUD- lesin endotelial.
WLYDV VHFRQYLHUWHQHQFpOXODVVLQWHWL]DGRUDV SUROL- Se ha comprobado que se pueden obtener clones
IHUDWLYDV /RVPHFDQLVPRVTXHUHJXODQHVWHIHQyPH- celulares de ambos fenotipos tanto en capas medias
no, en particular el que tiene que ver con el cambio QRUPDOHVFRPRHQtQWLPDVHQJURVDGDVSHURGLHUHQ
fenotpico de las CML de la ntima se los denomina ODVSURSRUFLRQHVGHORVIHQRWLSRVH[KLELGRV
modulacin fenotpica. Las caractersticas principales de las CML de
6HSODQWHDQHQWRQFHVKLSyWHVLVSRVLEOHVTXHQR fenotipo epitelioide son: aumento de las actividades
VRQPXWXDPHQWHH[FOX\HQWHVD /DV&0/SURYH- proliferativa, migratoria y proteoltica, pobre nivel de
nientes de la media son moduladas por diversos es- GLIHUHQFLDFLyQ GHQLGRSRUODH[SUHVLyQGHSURWHt-
tmulos durante su traslado y desarrollan este nuevo QDVFRQWUiFWLOHV\FLWRHVTXHOHWR \DOWDVHQVLELOLGDGD
IHQRWLSR VLQWHWL]DGRU   (VWRV HVWtPXORV SRGUtDQ estmulos apoptticos.
ser factores hemodinmicos, qumicos, humorales En cuanto a la diferenciacin, para separar ambos
DQJLRWHQVLQD HWF  DJHQWHV LQIHFFLRVRV Chla- fenotipos se estudiaron tambin las protenas del ci-
mydia pneumoniae, Helicobacter pylori, etc) o toesqueleto, las cuales constituyen los marcadores de
factores producidos por linfocitos T y macrfagos. GLIHUHQFLDFLyQ3RUHMHPSOROD60DFWLQDVHH[SUH-
Estos produciran alteraciones genmicas clonales sa en las CML vasculares, an en estadios tempranos
en las CML generando una proliferacin selectiva. del desarrollo, por eso es un marcador general de este
(VWD HV OD KLSyWHVLV PiV SUHGRPLQDQWH \ E  ([LVWH OLQDMHFHOXODU6LELHQVHH[SUHVDSHUPDQHQWHPHQWHHQ
una subpoblacin de CML predispuesta presente las CML, lo hace en forma ms abundante en el fe-
en la capa media arterial con caractersticas fenot- notipo contrctil o alargado. Adems, en condiciones
picas diferentes que sera responsable de la produc- QRUPDOHVODV&0/GHODFDSDPHGLDDUWHULDOH[SUHVDQ
cin del engrosamiento intimal. La presencia de una DFWLQDHVSHFLDOPHQWHHQVXLVRIRUPD )LJXUD 
subpoblacin de CML distinta en la pared arterial (QHQJURVDPLHQWRVH[SHULPHQWDOHVGHODtQWLPD
LPSOLFD TXH EDMR FRQGLFLRQHV QRUPDOHV ODV &0/ artica de rata mediante lesin endotelial, en placas
sean fenotpicamente heterogneas. de ateroma de humanos y en cultivos de CML arti-
6HGHVFULEHQHQWRQFHVIHQRWLSRVH[LVWHQWHVHO FDVGHUDWD OXHJRGHSURGXFLGRHOGDxR VHSURGXFH
fenotipo contrctil es tpico de una arteria diferen- XQVZLWFKXQFDPELRHQODH[SUHVLyQFRQSUHGRPL-
ciada y el fenotipo sinttizador, es tpico de arterias nancia de la isoforma y una cantidad notable de la
HQGHVDUUROORRSDWROyJLFDV )LJXUD &XDQGRVH IRUPD(VWHFDPELRHQHOSDWUyQGHH[SUHVLyQUHSUH-
caracterizan morfolgicamente a las CML in vitro sentara un posible nuevo marcador qumico de estas
y en todas las especies estudiadas, se consideran clulas patolgicas. Con respecto a otras protenas
QXHYDPHQWHIHQRWLSRV&0/DODUJDGDVREWHQLGDV del citoesqueleto, en grandes animales los niveles

DFWLQD DFWLQD

Figura 1.6 Expresin de -SM y -actina. Si bien se expresan permanentemente en las CML, lo hace en forma ms abundante en
el fenotipo contrctil o alargado. En condiciones normales las CML de la capa media arterial expresan actina especialmente en
su isoforma , fenotipo contrctil o quiescente (-actina+). CML activados (-actina+), clulas sintetizadoras, readquieren caracte-
rsticas primordiales de movimiento ameboide que les permite dejar la capa media.


CAPTULO 1 1XHYRVDVSHFWRVHQODVLRSDWRORJtDGHODSODFDDWHURHVFOHURWLFD

GHH[SUHVLyQGHGHVPLQDVHPDQWLHQHQHQHOIHQRWLSR pacientes con enfermedad oclusiva. Se observ que


alargado, mientras que se vuelven casi indetectables HQXQDOWRSRUFHQWDMHGHSODFDVDSDUHFHHQODV&0/
HQHOIHQRWLSRHSLWHOLRLGHRURPERLGHWDPELpQVHH[- WULVRPtD\WHWUDVRPtDGHOFURPRVRPD )LJXUD \
SUHVDQPD\RUHVQLYHOHVGH600+& FDGHQDSHVDGD HQXQPHQRUSRUFHQWDMHPRQRVRPtDGHOFURPRVRPD
GH PLRVLQD GH P~VFXOR OLVR  HQ HO IHQRWLSR DODUJD- $GHPiVVHREVHUYyDPSOLFDFLyQGHOJHQ)*)
do que en el romboide. En el caso de otras protenas IDFWRUGHFUHFLPLHQWREUREOiVWLFR HOFXDOVHXELFD
FRPR VPRRWKHOLQD 60 FDOSRQLQD KFDOGHVPLQD en el cromosoma 11, tanto en los casos de ploida
metavinculina, tambin son ms abundantes en el fe- normal como cuando hay monosoma del cromoso-
notipo alargado que en el epitelioide. PD/DSUHVHQFLDGHXQFURPRVRPDH[WUDHQODV
CML de las placas estara correlacionada con la so-
La apoptosis participa en la regulacin de la ce- EUHH[SUHVLyQGHOJHQGHODFDGHQD$GHO3'*)TXH
lularidad en los procesos de re-estenosis postangio- como se mencion previamente provocara un incre-
plasta y en la estabilidad de la placa. mento en la proliferacin de las CML. Asimismo, el
factor de crecimiento epidrmico est localizado en
/D H[LVWHQFLD GH DO PHQRV  IHQRWLSRV SRGUtD HVWH FURPRVRPD   &RQ UHVSHFWR DO IDFWRU GH FUH-
UHHMDU XQ GLVWLQWR RULJHQ HPEULROyJLFR PHVHQ- FLPLHQWR EUREOiVWLFR )*)  HQ RWURV WUDEDMRV
TXLPiWLFR \ FUHVWD QHXUDO  3RU OR WDQWR GHELGR se vio que sus transcriptos se acumulan en clulas
a que las CML provienen embriolgicamente de GH FORQHV WXPRURJpQLFRV 6X DFWLYLGDG VLROyJLFD
GLVWLQWRV yUJDQRV SDUHQTXLPDWRVRV H[LVWH XQD GL- incluira actuar como un potente mitgeno estimu-
versidad de estas clulas en las diferentes arterias, lando la angiognesis, desarrollo cerebral, formacin
haciendo que respondan de modo diferente a los GHFDUWtODJR\UHSDUDFLyQGHWHMLGRVEODQGRV6LELHQ
GLVWLQWRV HVWtPXORV ORFDOHV (VWR H[SOLFDUtD HO SRU HVWDVDQRPDOtDVUHPDUFDQODLGHDGHODH[SDQVLyQFOR-
qu los distintos lechos vasculares se comportan nal en la formacin de la placa, an no queda claro
de manera tan distinta con respecto a la ateroes- si contribuyen a la proliferacin celular o si son la
clerosis. consecuencia de otros factores o estmulos.

Origen monoclonal de la lesin ateroesclertica INVASIN DE LA PARED ARTERIAL POR PARTE


Se ha demostrado mediante la tcnica de PCR que DE MONOCITOS Y LINFOCITOS T
OD PRQRFORQDOLGDG HQ OD SODFD LQYROXFUD H[FOXVLYD- Distintos estmulos pueden desencadenar el mecanis-
mente a las CML y que el aumento de su capacidad PRGHWLSRLQDPDWRULRFRPRSRUHMHPSORDOWRVQLYH-
proliferativa suele asociarse con una tendencia a la les de colesterol srico que actan sobre leucocitos y
LQHVWDELOLGDGFURPRVyPLFD   clulas endoteliales estimulndolos para que los mis-
Un estudio realizado por nuestro grupo, ha re- PRVOLEHUHQIDFWRUHVGHWLSRLQDPDWRULR IDFWRUHVGH
velado diferentes alteraciones cromosmicas en las FUHFLPLHQWR\FLWRTXLQDV HVWRVIDFWRUHVLQGXFHQVREUH
&0/ GH SODFDV DWHURHVFOHUyWLFDV LQHVWDEOHV   6H VtPLVPRVODH[SUHVLyQGHPROpFXODVGHDGKHVLyQ6H
XWLOL]DURQ FDUyWLGDV H[WUDtGDV SRU HQGDUWHUHFWRPtD D KDEODHQWRQFHVGHXQHQGRWHOLRSHJDMRVRGRQGHODV
FpOXODV HQGRWHOLDOHV H[SUHVDQ PROpFXODV GH DGKHVLyQ
FRPR9&$0 PROpFXODGHDGKHVLyQGHODVFpOXODV
YDVFXODUHV DODVFXDOHVVHDGKLHUHQORVOHXFRFLWRV
TXHH[SUHVDQUHFHSWRUHVSDUDHVWDVPROpFXODV\TXHLQ-
tervienen en la transmigracin. VCAM-1 es regulada
HQUHVSXHVWDDODKLSHUFROHVWHUROHPLD  
Luego, los leucocitos son atrados qumicamente
TXLPLRWD[LV KDFLDHOLQWHULRUGHODSDUHGYDVFXODUD
WUDYpVGHXQPHFDQLVPRGHWUDQVGXFFLyQGHVHxDOHV
por la unin molculaR, por citoquinas que liberan
los leucocitos que arribaron tempranamente o por li-
SRSURWHtQDVGHEDMDGHQVLGDGTXHKDQDWUDYHVDGRHQ
IRUPDSDVLYDODSDUHG\TXHVHR[LGDURQGXUDQWHHO
SURFHVR (VWDV OLSRSURWHtQDV R[LGDGDV VRQ UHWHQLGDV
Figura 1.7 CML trisoma y tetrasoma del cromosoma 7 carti-
SRUUHFHSWRUHVGHPDFUyIDJRV\&0/(OH[FHVROLSt-
das extradas por endarterectoma en pacientes con enferme- GLFRHVWy[LFRSDUDODVFpOXODV\PXHUHQFRQVWLWX\HQ-
dad oclusiva. Hibridizacin in situ. do parte del core necrtico de la placa.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

&RPRHQRWUDVHQIHUPHGDGHVLQDPDWRULDVWDP- R[LGDFLyQGH/'/transformndose as en uno de


bin se producen quimioquinas, cuya funcin es re- los promotores ms activos de la aterognesis.
FOXWDU OHXFRFLWRV$GHPiV GH ODV FpOXODV LQDPDWR- Estos hechos, segn esta hiptesis, seran claves
ULDVODV&0/\ODVFpOXODVHGRWHOLDOHVSXHGHQH[SUH- en la progresin de la aterognesis. Ms an, se ha
VDUHVWDVTXLPLRTXLQDVVREUHWRGR,/ LQWHUOHXNLQD visto que el grado de disfuncin endotelial se corre-
 0&3 SURWHtQDTXLPLRWiFWLFDGHPRQRFLWRV  ODFLRQD FRQ OD H[WHQVLyQ GH OD HQIHUPHGDG FRURQD-
0,3 SURWHtQD LQDPDWRULD GH PDFUyIDJRV  \ ria. La lesin se relaciona a los factores de riesgo
5$17(6 FLWRTXLQDH[SUHVDGD\VHFUHWDGDHQFpOXODV de disfuncin endotelial: tabaquismo, diabetes, hi-
7QRUPDOHVUHJXODGDDODFWLYDUVH EDMRHVWLPXODFLyQ pertensin, hipercolesterolemia, agentes infecciosos
FRQFLWRTXLQDVLQDPDWRULDV   Chlamydia pneumoniae, Helicobacter pylori, cito-
megalovirus) es decir, los mismos factores de riesgo
Endotelio y aterognesis GHHQIHUPHGDGFRURQDULDDWHURHVFOHUyWLFD  
El endotelio es la monocapa de clulas que tapiza
los vasos sanguneos, no es slo una barrera pasi- COMPLICACIN DE LA PLACA
va para la difusin entre la sangre circulante y las
&0/ TXH HVWiQ LQPHGLDWDPHQWH GHEDMR VLQR TXH La importancia clnica del proceso aterognico ra-
modula la estructura y funcin vascular. Es un sen- GLFD HQ OD WUDQVIRUPDFLyQ GH XQD SODFD HVWDEOH )L-
sor y transductor de los cambios en la circulacin JXUD   D XQD LQHVWDEOH )LJXUD   /D UXSWXUD
y un generador de numerosos mediadores biolgi- GH OD SODFD )LJXUD   VH DVRFLD D OD SUHVHQFLD
cos. Sus clulas son capaces de detectar cambios HQODVFXELHUWDVGHXQJUDQLQOWUDGRGHPDFUyIDJRV
PHFiQLFRVHMHUFLGRVVREUHVXVXSHUFLHWDOHVFRPR &' OLQIRFLWRV7\HVFDVDVFpOXODV%(VWDVSOD-
cambios en la presin arterial u oclusin de una cas y aquellas con grandes cantidades de lpidos y
arteria y produce una gran cantidad de sustancias FXELHUWDVGHOJDGDV\SRFREUyWLFDVVRQFRQVLGHUDGDV
vasodilatadoras y vasoconstrictoras en respuesta a
estos estmulos. Estas sustancias regulan el tono va-
somotor, el sistema de coagulacin y trombolisis,
e intervienen en el crecimiento y migracin de las
&0/GHORVYDVRVVDQJXtQHRV  
El endotelio normal funciona a favor de la vaso-
dilatacin, la anticoagulacin y la antiproliferacin.
Esto lo hace inhibiendo la contraccin de las CML,
la trombosis y la adhesin de leucocitos y monocitos.
(Oy[LGRQtWULFRHVFRQVLGHUDGRHOSULQFLSDOUHJXODGRU
y su liberacin basal mantiene el tono vascular en la
circulacin sistmica y pulmonar y por lo tanto, la
presin sangunea y permite que en condiciones nor-
males el endotelio funcione impidiendo la adhesin
plaquetaria y de monocitos.
&XDQGRHOHQGRWHOLRQRHMHUFHDGHFXDGDPHQWHVX
funcin, se habla de disfuncin endotelial. La hipte-
VLVGHOGDxRHQGRWHOLDOSURSRQHTXHHOGDxRVREUH
el endotelio provoca la disfuncin y el mismo sera el
evento primario en la cadena de fenmenos que lleva
a la formacin de las placas ateroesclerticas.
La disfuncin se caracteriza por el deterioro de la
capacidad de los vasos de dilatarse y promover un au-
PHQWRHQHOXMRVDQJXtQHR$VtHOHQGRWHOLRSLHUGH
su carcter inhibitorio y se reduce la disponibilidad de
y[LGR QtWULFR FRPR YDVRGLODWDGRU ORFDO 3LHUGH WDP-
bin la capacidad de regular el tono vascular, aumenta
ODDGKHUHQFLDGHODVSODTXHWDV\PRQRFLWRV\GHMDGH Figura 1.8 Placa estable. Luz con obstruccin crtica, cubierta
inhibir la capacidad proliferativa de las CML. Aumen- gruesa y pequeo ncleo lipdico rodeado por tejido broso.
ta la permeabilidad a LDL y tambin se asocia con la 40x. (13)


CAPTULO 1 1XHYRVDVSHFWRVHQODVLRSDWRORJtDGHODSODFDDWHURHVFOHURWLFD

SODFDVYXOQHUDEOHVHVWDVFXELHUWDVSXHGHQXOFHUDU-
VH \ HQWRQFHV TXHGD H[SXHVWR DO XMR VDQJXtQHR HO
centro necrtico altamente trombognico, resultando
HQODIRUPDFLyQGHXQWURPERTXHSXHGHYLDMDUGLVWDO-
PHQWH\RFOXLUYDVRVPiVSHTXHxRVRELHQSURGXFLU
de acuerdo al sitio de la placa trombosada, infarto de
PLRFDUGLRDFFLGHQWHFHUHEURYDVFXODU $&9 RJDQ-
JUHQDHQODVH[WUHPLGDGHV
La hemorragia intraplaca sin ruptura de placa,
HQ FDPELR VH FDUDFWHUL]D SRU XQD H[WHQVD YDVFXOD-
rizacin y es causada por la ruptura de los vasos de
QHRIRUPDFLyQ &'\&' HQHOQ~FOHROLStGL-
FREDVH\SHULIHULDGHODSODFD )LJXUD 

PLACA VULNERABLE

(OFRQFHSWRVHUHHUHDODVFDUDFWHUtVWLFDVGHODSODFD
aterosclertica que la hacen propensa a sufrir acci-
GHQWHVGHSODFD  

Figura 1.11 Hemorragia intraplaca sin rotura de placa. N-


cleo lipdico vascularizado con reaccin positiva con CD34 y
CD31 para vasos neoformados con paredes nas hasta otros
con paredes mas gruesas, en asociacin con hemorragia in-
traplaca. Tcnica de la inmunoperoxidasa para neoangiog-
nesis. 200x.

Cpsula Fibrosa Delgada: se ha estudiado el gro-


VRU GH ODV FiSVXODV EURVDV GH ODV SODFDV DWHURVFOH-
rticas de pacientes fallecidos por sndromes coro-
QDULRVDJXGRV\HQPiVGHOGHORVFDVRVHVWRV
Figura 1.9 Placa inestable. Luz con obstruccin no crtica,
SUHVHQWDURQFiSVXODVEURVDVFRQXQJURVRULQIHULRUD
cubierta na (echa) con inltrados y abundante ncleo lip- ORVP(QHVWXGLRVUHDOL]DGRVVREUHSODFDVFDUR-
dico. 40x. (13) WtGHDVHOJURVRUFUtWLFRSDUHFHVHUP\HQSODFDV
DyUWLFDV  P (O DGHOJD]DPLHQWR GH ODV FiSVXOD
est causado por la disminucin del colgeno, produ-
FLGRSRUIHQyPHQRV
Disminucin de CMLs en la cpsula, que se debe
a la apoptosis de las mismas. Siendo las CMLs las
SULQFLSDOHVSURGXFWRUDVGHODPDWUL]H[WUDFHOXODUGH
la cpsula, se produce una disminucin del espesor
de la misma.
,QOWUDFLyQ GH OD FiSVXOD SRU PDFUyIDJRV TXH
producen metaloproteinasas que degradan la matriz.
Figura 1.10 Ejemplo de ruptura de placa inminente. Cubier-
tas con gran inltrado de macrfagos (CD68+) linfocitos-T y
1~FOHRULFRHQOtSLGRVHOWDPDxRGHOQ~FOHROLSt-
escasas clulas B. Estas placas, con grandes cantidades de l- dico parece tener una relacin directa con el riesgo
pidos y cubiertas delgadas y poco brticas son consideradas de ruptura. Si bien no se conocen con precisin los
placas vulnerables Estas cubiertas pueden ulcerarse y en- mecanismos, se supone que la falta de suporte mec-
tonces queda expuesto al ujo sanguneo el centro necrtico
altamente trombognico, resultando en la formacin de un
QLFRSRUODPDWUL]H[WUDFHOXODUWHUQDUtDDODSODFDPiV
trombo. Tcnica de la inmunoperoxidasa para macrfagos. frgil. Por otra parte el ncleo lipdico es altamente
200x. (13) WURPERJpQLFRDOVHUH[SXHVWR7DPELpQVHHVSHFXOD


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

TXH SRGUtD GHVHPSHxDU DOJ~Q SDSHO HQ OD GHJUDGD-  /DV VXSHUFLHV LQWLPDOHV QR PRVWUDEDQ HYL-
FLyQGHODPDWUL]H[WUDFHOXODU/DKHPRUUDJLDGHQWUR GHQFLDGHGHSyVLWRVSODTXHWDULRVRGHEULQD/DVKH-
del ncleo es otro factor que produce vulnerabilidad. PRUUDJLDV YDULDURQ HQ H[WHQVLyQ GHVGH PLFURVFySL-
7DPDxRGHOD3ODFDVLELHQVHREVHUYyTXHODVSOD- cas, microfocales o en hendidura hasta hemorragias
cas ms grandes son ms proclives a los accidentes, PDVLYDV FRQ HOHYDFLyQ \ GHVSOD]DPLHQWR GH OD FX-
HVWRHQUHDOLGDGWLHQHPiVUHODFLyQFRQHOWDPDxRGHO ELHUWDRFDVLRQDQGRHVWHQRVLVRFOXVLYDRVXERFOXVLYD 
Q~FOHROLStGLFRTXHFRQHOWDPDxRGHODSODFDHQVt 3ODFDGXUDHVWDEOHQRFRPSOLFDGDQ   
7LSRGH5HPRGHODFLyQVHUHHUHDVLHOUHPRGH- (VWDEDQFRQVWLWXLGDVSRUOiPLQDVGHWHMLGRFRQHFWLYR
lamiento de la pared arterial consecuente a la pre- EURVR SHTXHxRV Q~FOHRV OLStGLFRV GHWULWXV FHOXOD-
sencia de la placa hace que sta crezca hacia la luz, UHV\PDVDVLUUHJXODUHVGHPDWHULDOFDOFLFDGR
SURGXFLHQGRPD\RUHVWHQRVLV UHPRGHODPLHQWRFRQV- 7. Placa inestable blanda, no complicada: n =
WULFWLYR  R KDFLD DIXHUD SURGXFLHQGR DXPHQWR GHO     )LJXUD   6H FDUDFWHUL]DURQ SRU WH-
GLiPHWUR GH OD DUWHULD UHPRGHODPLHQWR H[SDQVLYR  QHU FiSVXODV EURVDV \ XQ ULFR Q~FOHR OLStGLFR FRQ
(OUHPRGHODPLHQWRH[SDQVLYRVHUHODFLRQDPiVFRQ H[WHQVD YDVFXODUL]DFLyQ OR TXH ODV KDFtD SURSHQ-
ORVDFFLGHQWHVGHSODFDSHURHVWRVHH[SOLFDUtDSRU- sas a padecer hemorragia y trombosis en el futuro.
TXHODVSODFDVH[SDQVLYDVWLHQHQQ~FOHRVOLStGLFRVGH /DV SODFDV VH FODVLFDURQ HQ GRV VXEJUXSRV D 
PD\RUWDPDxRPLHQWUDVTXHODVFRQVWULFWLYDVVXHOHQ &RPSOLFDGDV ORV SULPHURV  WLSRV PRUIROyJLFRV 
WHQHUPiVEURVLV \ E  QR FRPSOLFDGDV \   FRQ UXSWXUD ORV SULPH-
,QOWUDGR ,QDPDWRULR HO LQOWUDGR PRQRQXFOHDU URV  WLSRV PRUIROyJLFRV  \   SODFDV VLQ UXSWXUD
en la placa se correlaciona con los accidentes de la Placas complicadas vs. no complicadas. Las placas
misma. Esto estara relacionado con la degradacin de FRPSOLFDGDV  SUHVHQWDURQXQLQOWUDGRPR-
ODPDWUL]H[WUDFHOXODUTXHORVPDFUyIDJRVSURGXFHQ QRQXFOHDUHQODSHULIHULDKRPEURV\EDVHHQ
Presencia de Neovasos: es otro factor que se ha  GHORVFDVRVDGLIHUHQFLDGHODVSODFDVQRFRP-
asociado a la ruptura de placa. SOLFDGDVGRQGHVyOR  SUHVHQWDURQLQOWUD-
GRV S 
ATEROESCLEROSIS CAROTDEA Adems, las placas complicadas presentaban va-
sos de neoformacin en la periferia, hombros y base
/DDWHURHVFOHURVLVFDURWtGHDHVXQEXHQHMHPSORSDUD HQ    GH ORV FDVRV PLHQWUDV TXH HVWRV
comprender la importancia de las lesiones en la g- YDVRVVHHQFRQWUDURQHQVyOR  GHODVSOD-
QHVLV GH ODV FRPSOLFDFLRQHV FOtQLFDV (Q XQ WUDEDMR FDVQRFRPSOLFDGDV S 
GHQXHVWURODERUDWRULRHVWXGLDPRVHQGDUWHUHFWR- Placas con ruptura vs. sin ruptura. Las pla-
PtDVGHSDFLHQWHVGHJpQHURPDVFXOLQR\ FDV FRQ UXSWXUD \ VLQ UXSWXUD SUHVHQWDEDQ LQO-
GHOIHPHQLQRHUDQVLQWRPiWLFRV\DVLQWRPi- WUDGRV HQ OD FXELHUWD \ KRPEURV   
WLFRV  /DVSODFDVVHGLYLGLHURQHQJUXSRV \    UHVSHFWLYDPHQWH S 
5RWXUDGHSODFDPiVWURPERVLVQ   /D $UWHULDFDUyWLGDH[WHUQD
cubierta tena un espesor variable. La zona de rotura Estas arterias presentaban la tpica histopatologa
estaba cubierta por un trombo y en varios casos, el GHODDWHURPDWRVLVDYDQ]DGDHQVRORHO  
WURPERVHH[WHQGtDKDFLDHOQ~FOHROLStGLFRHQUHOD- GH ORV FDVRV 6RODPHQWH  GH  FDVRV DIHFWDGRV
FLyQ GLUHFWD FRQ HO GHSyVLWR GH OtSLGRV H[WUDFHOXOD- presentaban una placa complicada. Esto resulta en
UHV/RVERUGHVGHODOHVLyQHVWDEDQLQOWUDGRVSRUXQ XQD GLIHUHQFLD VLJQLFDWLYD FXDQGR VH OD FRPSDUD
gran nmero de macrfagos. con las placas complicadas de la arteria cartida in-
 5RWXUD GH SODFD PiV KHPRUUDJLD LQWUDSODFD WHUQD YVS (OEDMRFRPSUR-
\ WURPERVLV Q     $TXt VH DJUHJDED XQD miso en la lesin ateromatosa y sus escasas conse-
H[WHQVD GLVUXSFLyQ SRU OD KHPRUUDJLD LQWUDSODFD FXHQFLDVVHH[SOLFDUtDQSRUSHUOHVGHXMRGHEDMD
 5RWXUD GH SODFD PiV KHPRUUDJLD LQWUDSODFD Q  velocidad y menor shear stress de la pared en la
   (VWDV OHVLRQHV SUHVHQWDURQ XQD H[WHQVD FDUyWLGD H[WHUQD FRPSDUDGD FRQ OD LQWHUQD  
hemorragia en el interior de la placa con separacin Hallazgos inmunohistoqumicos.
de sus distintos componentes y desgarro intimal. (QHOVLWLRGHODUXSWXUDODFDSDEURVDPRVWUyXQD
 3ODFD GXUD XOFHUDGD Q    (VWDV SODFDV VXSHUFLHHURVLRQDGDFDUDFWHUL]DGDSRUODSpUGLGDGHO
prcticamente carecan de ncleos lipdicos y esta- UHYHVWLPLHQWRHQGRWHOLDO3RUHOFRQWUDULRODVVXSHU-
EDQIRUPDGDVSRUWHMLGRFRQHFWLYRODPLQDGRFRQOD cies conservadas mantuvieron el revestimiento sin le-
FDSDEURVDHURVLRQDGD\H[WHQVDViUHDVFDOFLFDGDV sin de las cubiertas ni de las clulas endoteliales. La
 +HPRUUDJLD LQWUDSODFD VLQ UXSWXUD +,3  Q   continuidad de la capa de clulas endoteliales marca-


CAPTULO 1 1XHYRVDVSHFWRVHQODVLRSDWRORJtDGHODSODFDDWHURHVFOHURWLFD

GDVFRQ)DFWRUDQWL9,,,DQWL&'\DQWL&'HVWDED /DW~QLFDPHGLDHVWDEDFRPSXHVWDSRUVyORDKLOH-
LQWHUUXPSLGDHQHOVLWLRGHODUXSWXUD/DVFpOXODVLQD- UDVGHFpOXODVPXVFXODUHVOLVDVFRQVXHMHORQJLWXGLQDO
PDWRULDVFRQVLVWHQWHVHQPDFUyIDJRV &' FRQVWL- orientado circunferencialmente. Como lo demostr la
WXtDQORVGHOWRWDOGHORVLQOWUDGRVPLHQWUDVTXHHO
UHVWDQWHHUDQOLQIRFLWRV7\XQRVSRFRVOLQIRFLWRV%
/DVFpOXODV&'SUHGRPLQDEDQHQWUHORVOLQIRFLWRV
7PLHQWUDVTXHODV&'HUDQPX\HVFDVDV(VWDLPD-
JHQIXHREVHUYDGDHQGHODVSODFDVFRQUXSWXUD
Se reconocieron dos tipos diferentes de depsitos de
lpidos. Los ncleos lipdicos vascularizados presenta-
EDQXQDUHDFFLyQSRVLWLYDFRQ&'\&'\WHQtDQ
GHVGHYDVRVQHRIRUPDGRVFRQSDUHGHVQDVKDVWDRWURV
con paredes gruesas, en asociacin con hemorragia in-
WUDSODFD )LJXUD /RVYDVRVGHQHRIRUPDFLyQH[-
SUHVDURQPiVLQWHQVDPHQWH&'DQWtJHQRSUHVHQWHHQ
FpOXODVHQGRWHOLDOHV\SURJHQLWRUDVTXH&'HOFXDO
HVXQDPROpFXODGHDGKHVLyQGHH[SUHVLyQYDULDEOH6H
demostr una estrecha relacin entre los linfocitos T
y los neovasos y se evidenciaron imgenes de migra-
cin transendotelial. Las clulas espumosas del ncleo
OLStGLFRH[SUHVDURQWDPELpQHODQWtJHQR&' )LJXUD
 3RUHOFRQWUDULRSODFDVHVWDEOHVQRFRP-
SOLFDGDVFRQWHQtDQWHMLGREURVRGHQVRFRQSHTXHxDV
FDQWLGDGHVGHOtSLGRV\HVWDEDQLQWHQVDPHQWHLQOWUDGDV
SRUFpOXODVGHOP~VFXOROLVR ++)  )LJXUD 
(Q  GH    GH ORV FDVRV OD EDVH \ ORV
hombros de las placas mostraban vasos de pare-
GHV QDV R IRUPDFLRQHV QXHYDV GH SDUHGHV JUXH-
VDV \ YDVRV SRVLWLYRV SDUD OD UHDFFLyQ FRQ &' \
++) TXH HVWDEDQ URGHDGRV GH LQOWUDGRV PRGH-
UDGRV D H[WHQVRV PDFUyIDJRV \ OLQIRFLWRV7 SULQ- Figura 1.12 Las clulas espumosas del ncleo lipdico expre-
FLSDOPHQWH &'    /DV SODFDV HVWDEOHV QR san tambin el antgeno CD68. Tcnica de la inmunoperoxi-
FRPSOLFDGDV WHQtDQ HVFDVR LQOWUDGR LQDPDWRULR dasa para macrfagos. 400x

Figura 1.13 Placas estable no-complicadas, con tejido broso denso, pequeas cantidades de lpidos e intensa inltracin de la
capa intima por clulas del msculo liso (HF35+) (echa) Tcnica de la inmunoperoxidasa para CML 20x.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

inmunomarcacin para actina, el borde de la endarte- TXHDSHVDUTXHHVWHWHUUHQRHVH[WUHPDGDPHQWHDSWR


rectoma pasaba a ese nivel con una abundante can- para la instalacin de un proceso trombtico, la rup-
WLGDGGHFDSLODUHVQRUPDOHVGHSDUHGQDRULHQWDGRV tura de las placas carotdeas en nuestros especme-
ORQJLWXGLQDOPHQWHVLJXLHQGRDOHMHPD\RUGHODVFpOX- QHV FDXVy WURPERVLV HQ VROR HO  GH ORV FDVRV
las musculares. Aunque esta tnica no pertenece a la Clsicamente las hemorragias se atribuyeron al des-
placa en s misma, es de particular importancia por su garro por el estrs mecnico de los frgiles vasos
vascularizacin. Se pudo realizar una clara distincin QHRIRUPDGRVDOXMRWXUEXOHQWR\DODYLEUDFLyQGH
entre los neovasos de las bases y periferia de la placa la pared engrosada de la arteria cartida por la pre-
ateromatosa y los capilares adyacentes de la media ori- VHQFLDGHODSODFD(QRWURVWUDEDMRVOD+,3HVWXYR
JLQDGRVHQORVYDVDYDVRUXP   asociada con un aumento de la metaloproteinasa-1 de
Las placas carotdeas con ruptura, estaban carac- ODPDWUL]\ORVPDFUyIDJRVHQODFDSDEURVDVXJL-
WHUL]DGDVSRUXQDH[WHQVDLQOWUDFLyQGHPDFUyIDJRV ULHQGRHOSDSHOGHORVPHGLDGRUHVLQDPDWRULRVHQOD
en el sitio de la erosin, indicando la presencia de un lesin de los vasos. Finalmente se debe destacar que
SURFHVRLQDPDWRULRTXHDWUDYpVGHODGHJUDGDFLyQ las HIP pueden ocurrir en cualquier momento de la
HQ]LPiWLFDGHODFXELHUWDEURVDSRUORVPDFUyIDJRV KLVWRULDGHODSODFDFDURWtGHD  
la desestabiliza y, de esta manera debilita el sitio que (QHOGHORVHVSHFtPHQHVGHODVHQGDUWHUHFWR-
SUHVHQWDUiODSRVWHULRUUXSWXUD )LJXUD  mas estaba presente la ruptura de la placa. Sin embar-
/DUXSWXUDGHODFDSDEURVD GHORVFDVRV  JRVyOR  GHORVFDVRVSHUWHQHFtDQDSD-
FDXVy WURPERVLV HQ HO  KHPRUUDJLD LQWUDSODFD cientes sintomticos. Por otro lado una alta proporcin
+,3  FRQ WURPERVLV HQ HO  \ KHPRUUDJLD LQ- GHSDFLHQWHVDVLQWRPiWLFRV  SUHVHQWDEDQSODFDV
WUDSODFD DLVODGD HQ HO  (V LQWHUHVDQWH GHVWDFDU FRPSOLFDGDVVHxDODQGRODIDOWDGHFRUUHODFLyQHQWUH
SODFDFRPSOLFDGD \ OD VLQWRPDWRORJtDFHUHEUDO  
&RLQFLGLHQGR FRQ HVWH KHFKR VH KDQ LGHQWLFDGR
rupturas de placas coronarias en pacientes fallecidos
por causas no cardacas, por lo que el hallazgo de
rupturas de placa con/sin hemorragia en las arterias
cartidas, que cursen sin manifestaciones sintomti-
cas parece ser un hecho probable en esta patologa.
El estudio NASCET demostr que la mayora de los
ACV por enfermedad carotdea ocurren sin sntomas
SUHYLRV\VyORHOGHORVSDFLHQWHVH[SHULPHQ-
tan un ataque isqumico transitorio como sntoma
prodrmico del ACV. Por lo tanto la ausencia de sn-
tomas no debiera considerarse como un factor esen-
cial para decidir la intervencin quirrgica.
$SUR[LPDGDPHQWH  GH ORV HVSHFtPHQHV RE-
tenidos de endarterectomas carotdeas tenan en las
placas trombos, hemorragias o ambos. La trombosis
se observ en un cuarto de los casos mientras que la
hemorragia intraplaca estaba presente en por lo me-
nos los dos tercios de los mismos. Sesenta y cuatro
por ciento de los especmenes present neovasculari-
zacin de la placa.
No fue posible demostrar que las placas compli-
FDGDV UXSWXUD GH OD SODFD WURPERVLV \ KHPRUUDJLD
LQWUDSODFD  HVWXYLHVHQ DVRFLDGDV VLJQLFDWLYDPHQWH
Figura 1.14 Corte frontal de arterias cartidas. Ruptura de la
placa (echa). Estas placas con ruptura, estn caracterizadas
con los sntomas cerebrales y, de acuerdo a nuestros
por una extensa inltracin de macrfagos en el sitio de la UHVXOWDGRVSDUHFHUD]RQDEOHDUPDUTXHHVWRVWLSRV
erosin, indicando la presencia de un proceso inamatorio de placas pueden ocurrir en cualquier momento de la
que a travs de la degradacin enzimtica de la cubierta - evolucin del paciente sin manifestaciones clnicas.
brosa por los macrfagos la desestabiliza y, de esta manera
debilita el sitio que presentar la posterior ruptura. El asterisco
3RU OR WDQWR FRQVLGHUDQGR TXH HO EHQHFLR GH OD
seala un trombo parietal y entre echas se observa una he- ciruga en el estudio NASCET fue mayor en los casos
morragia intraplaca. 20x. (13) de ms alto grado de estenosis, nuestros hallazgos nos


CAPTULO 1 1XHYRVDVSHFWRVHQODVLRSDWRORJtDGHODSODFDDWHURHVFOHURWLFD

permiten aseverar que la placa carotdea complicada evolucin. En consecuencia, la indicacin quirrgica
podra pasar desapercibida en pacientes asintomti- deber basarse en el grado de estenosis independiente-
cos y desarrollar un ACV en cualquier momento de la PHQWHGHODH[LVWHQFLDRQRGHVtQWRPDVSUHYLRV

BIBLIOGRAFA
1. Milei J, Ottaviani G, Lavezzi AM, Grana DR, Stella I, Matturri L. Perinatal and infant early atherosclerotic coronary
OHVLRQV&DQ-&DUGLRO
 Milei J, Grana DR. Lesiones ateroesclerticas: Aterognesis. En: Sndrome metablico y riesgo vascular. Vol 1.
:DVVHUPDQQ$*URVVR&(GLWRUHVHGLFLyQ%XHQRV$LUHV)(35(9$SS%XHQRV$LUHV
 *XHUUL*XWWHQEHUJ5$&DVWLOOD5)UDQFRV*&0OOHU$$PEURVLR*0LOHL-7UDQVIRUPLQJ*URZWK)DFWRUDQG
&RURQDU\,QWLPDO+\SHUSODVLDLQ3HGLDWULF3DWLHQWV:LWK&RQJHQLWDO+HDUW'LVHDVH&DQ-&DUGLRO
 Fernndez Alonso G, Grana DR, Turconi P, Colombo B, Lavezzi AM, Milei J, Matturri L. Proliferative activity and
FKURPRVRPDODOWHUDWLRQVRIVPRRWKPXVFOHFHOOVLQDWKHURVFOHURVLV0HGLFLQD %$LUHV 
 /DYH]]L$0 0LOHL - *UDQD '5 )OHQGD ) %DVHOOLQL$ 0DWWXUUL / ([SUHVVLRQ RI FIRV S DQG 3&1$ LQ WKH
XQVWDEOHDWKHURVFOHURWLFFDURWLGSODTXH,QW-&DUGLRO
 0LOHL-*UDQD'51DYDUL&$]]DWR)*XHUUL*XWWHQEHUJ5$$PEURVLR*&RURQDU\LQWLPDOWKLFNHQLQJLQQHZERUQ
EDELHVDQGRU \HDUROGLQIDQWV$QJLRORJ\  
7. Benditt EP, Benditt JM. Evidence for a monoclonal origin of human atherosclerotic plaques. Prot Natl Acad Sci USA

 &DPSEHOO*5&DPSEHOO-+7KHSKHQRW\SHVRIVPRRWKPXVFOHFHOOVH[SUHVVHGLQKXPDQDWKHURPD$QQ1<$FDG
6FL
9. Matturri L, Cazzullo A, Turconi P, Lavezzi AM, Vandone PL, Gabrielli L,Fernndez Alonso G, Grana D, Milei J.
&KURPRVRPDODOWHUDWLRQVLQDWKHURVFOHURWLFSODTXHV$WKHURVFOHURVLV)HE  3XE0HG30,'

 Milei J, Parodi JC, Fernndez Alonso G, Barone A, Grana D, Matturri L. Carotid rupture and intraplaque hemorrhage:
,PPXQRSKHQRW\SHDQGUROHRIFHOOVLQYROYHG$P+HDUW-
11. Milei J, Parodi JC, Ferreira M, Barone A, Grana DR, Matturri L. Atherosclerotic plaque rupture and intraplaque
KHPRUUKDJHGRQRWFRUUHODWHZLWKV\PSWRPVLQFDURWLGDUWHU\VWHQRVLV-9DVF6XUJ
 Milei J, Parodi JC, Fernndez Alonso G, Barone A, Beigelman R, Ferreira LM, et al. Carotid atherosclerosis:
immunocytochemical analysis of the vascular and cellular composition in endarterectomies. Cardiologia

 Milei J, Rodrguez Granillo GA, Cap 1 en Rodriguez Granillo GA y col. TC y RM cardiovascular. Fundamentos
FOtQLFRV(G-RXUQDO%XHQRV$LUHV$UJHQWLQD


&$378/2

DIAGNSTICO POR IMGENES


EN PREVENCIN PRIMARIA
GASTN A. RODRGUEZ GRANILLO

INTRODUCCIN incluso en presencia de una carga de placa ateroescle-


UyWLFD LPSRUWDQWH HO UHPRGHODPLHQWR FRURQDULR H[-
&RQPLOORQHVGHPXHUWHVSRUDxRODHQIHUPHGDG pansin gradual del vaso ante la progresin de ateroes-
FDUGLRYDVFXODU (&9  FRQWLQ~D VLHQGR OD SULQFLSDO FOHURVLVVXE\DFHQWH HYLWDODREVWUXFFLyQOXPLQDOKDVWD
causa de muerte a nivel global, siendo la enfermedad HVWDGtRV WDUGtRV GH OD HQIHUPHGDG>@ 3RU OR WDQWR
FRURQDULD (&  UHVSRQVDEOH GH DSUR[LPDGDPHQWH OD DSUR[LPDGDPHQWHHQODPLWDGGHORVFDVRVODPDQLIHV-
PLWDGGHODVPXHUWHV>@$SHVDUGHTXHODPRUWDOLGDG tacin inicial de la EC es el IAM o la muerte sbita,
de la ECV ha disminuido, la prevalencia de factores de presentando la mayora de los pacientes ausencia de an-
riesgo como la obesidad y la diabetes se encuentra en WHFHGHQWHV\HVWXGLRVIXQFLRQDOHVSUHYLRVQRUPDOHV>@
niveles muy elevados y contina en aumento. Slo en Por otra parte, si bien la instauracin de estra-
ORV(VWDGRV8QLGRVOD(&9FDXVD!PXHUWHV tegias de revascularizacin y terapias farmacolgi-
SRUDxRFRPSDUDGRFRQaGHOFiQFHUGHSUyVWD- FDV KDQ PHMRUDGR VLJQLFDWLYDPHQWH HO SURQyVWLFR
WDaGHOFiQFHUGHPDPD\aGHOFiQFHU GH SDFLHQWHV FRQ HQIHUPHGDG FRURQDULD H[LVWH XQD
GH FRORQ>@ (V SDUDGyMLFR TXH OD$PHULFDQ &DQFHU proporcin sustancial de pacientes con recurrencia
Society recomiende el screening de cncer de mama de eventos isqumicos, originados ya sea a nivel de
GHVGHORVDxRVFRQXQDPDPRJUDItDDQXDOGHVGH la lesin culpable originalmente tratada, en lesiones
ORV  DxRV PLHQWUDV TXH QR H[LVWH XQD UHFRPHQGD- originalmente no culpables, o por progresin de ate-
cin concreta y efectiva sobre el screening mediante roesclerosis de novo.
estudios de imgenes para la prevencin de la ECV, /D HVWUDWLFDFLyQ GH ULHVJR FRQYHQFLRQDO SUHGLFH
cuyo impacto es claramente mucho mayor que el del VyORXQGHORVHYHQWRV\DSHQDVHOGH
FiQFHUGHPDPDLQFOXVRHQPXMHUHV>@ ORV SDFLHQWHV TXH GHEXWDQ FRQ ,$0 DQWHV GH ORV 
Las ltimas dcadas han sido testigo de la irrup- DxRVKDEUtDQFDOLFDGRSDUDWUDWDPLHQWRFRQHVWDWLQDV
cin de los mtodos de diagnstico por imgenes en VHJ~QHOVFRUHGH)UDPLQJKDP )56 >@(VLPSRUWDQ-
la evaluacin de pacientes coronarios. Sin embargo, WHHQWRQFHVPHMRUDUODHVWUDWLFDFLyQGHULHVJRHLGHQ-
incluso con enormes avances obtenidos en cuanto a WLFDUFDUDFWHUtVWLFDVGHODVSODFDVDWHURHVFOHUyWLFDVGH
la evaluacin ex vivo e in vivo, el conocimiento de la alto riesgo que nos permitan implementar medidas de
historia natural de la ateroesclerosis coronaria conti- prevencin que permitan reducir el riesgo residual.
na siendo pobremente elucidado.
Numerosos estudios retrospectivos han establecido HISTORIA NATURAL DE LA
que la gran mayora de los eventos trombticos agudos ENFERMEDAD CORONARIA
FRURQDULRVVHRULJLQDQHQOHVLRQHVDQJLRJUiFDPHQWH
PLHQWUDVTXHDSHQDVXQGHORVSDFLHQWHVFRQ La historia natural de las placas coronarias de alto ries-
,$0WLHQHQFRPRVXVWUDWROHVLRQHV!>@ go contina siendo prcticamente desconocida a pesar
Debido a mecanismos compensatorios intrnsecos, de grandes avances en los mtodos diagnsticos. En


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

las ltimas dcadas se impuso el concepto de que la res de riesgo como el FRS y el SCORE. Estos sco-
mayora de las muertes cardacas se asocian a ruptura res de riesgo utilizan factores de riesgo tradicionales
de una placa. Sin embargo, estudios post-mortem han \ WLHQHQ OD FDSDFLGDG GH LGHQWLFDU LQGLYLGXRV FRQ
establecido que no es infrecuente observar en estos pa- PX\EDMRULHVJRRFRQPX\DOWRULHVJRGHGHVDUUROODU
cientes una segunda o incluso tercera ruptura de placa HYHQWRVDDxRV6LQHPEDUJRODPD\RUSDUWHGHOD
FRQ WURPERVLV PXUDO QR RFOXVLYD  VXE\DFHQWH IXHUD poblacin en la cual se producen los eventos es de
GHODOHVLyQFXOSDEOH>@3RURWUDSDUWHHVWXGLRV riesgo intermedio, donde el valor predictivo de estos
DQJLRJUiFRV KDQ GHPRVWUDGR TXH ORV SDFLHQWHV FRQ scores es apenas moderado. Por lo tanto, un gran n-
6&$VXHOHQSUHVHQWDUSODFDVFRPSOHMDVIXHUDGHODOH- mero de individuos con riesgo de desarrollar eventos
sin culpable, y que dichas lesiones son predictores in- QRVHUtDQLGHQWLFDGRVHLQWHUYHQLGRVDSURSLDGDPHQ-
GHSHQGLHQWHVGHHYHQWRV>@0iVUHFLHQWHPHQWH te, mientras que otros individuos seran errneamen-
la utilizacin de herramientas diagnsticas invasivas WHFODVLFDGRVFRPRGHDOWRULHVJR\PHGLFDGRVSRU
HVSHFtFDVSHUPLWLyH[WHQGHUHVWRVKDOOD]JRVUHFRQR- WLHPSRLQGHWHUPLQDGR>@
ciendo actualmente a los SCA como procesos de ines- &RQVHQVRVGHH[SHUWRVGHO$PHULFDQ+HDUW$VVR-
WDELOLGDGFRURQDULDPXOWLIRFDO>@ ciation, el National Cholesterol Education Program
(QHODxRVHSXEOLFyXQHVWXGLRTXHHYDOXy 1&(3  HO (XURSHDQ 7KLUG -RLQW 7DVN )RUFH \ GH
por primera vez la prevalencia de la ruptura de placa la Sociedad Argentina de Cardiologa reconocen es-
en pacientes con SCA mediante ultrasonido intra- tas limitaciones y recomiendan el uso de mtodos de
YDVFXODU ,986  HQ ORV WUHV YDVRV HQFRQWUDQGR XQ diagnstico por imagen como herramientas de scree-
SURPHGLRGHSODFDVURWDVSRUSDFLHQWH>@0iV ning no invasivas en individuos con riesgo interme-
LQWHUHVDQWHIXHHOKDOOD]JRGHTXHFHUFDGHOGH GLR>@ (VWDV KHUUDPLHQWDV LQFOX\HQ HO HVSHVRU
los pacientes presentaron placas rotas fuera de la le- LQWLPDPHGLDFDURWtGHR (,0 PHGLDQWHXOWUDVRQLGR
VLyQFXOSDEOH\FHUFDGHOHQYDVRVQRFXOSD- HOVFRUHGHFDOFLRFRURQDULR &$& SRU7&PXOWLGH-
bles. Recientemente, un estudio que evalu los tres tector, y la evaluacin de disfuncin endotelial por
vasos epicrdicos mediante IVUS-Histologa Virtual XOWUDVRQLGR 7DEOD 
GHPRVWUyWDPELpQXQGHSUHYDOHQFLDGHUXSWXUD
GHSODFDHQSDFLHQWHVFRQDQJLQDFUyQLFDHVWDEOH>@ DIFERENCIA ENTRE DETECCIN
En lnea con estos hallazgos, Arbustini y colabora- DE ATEROESCLEROSIS
dores encontraron estenosis crtica u oclusin en un CORONARIA Y DETECCIN DE
  GH FRUD]RQHV GH SDFLHQWHV KRVSLWDOL]DGRV TXH ENFERMEDAD OBSTRUCTIVA
IDOOHFLHURQGHFDXVDQRFDUGtDFD>@ CORONARIA
Con respecto a la prevalencia, los estudios histopa-
WROyJLFRVKDQUHSRUWDGRXQDPHGLDGH)$&) EURD- Hasta la incorporacin del CAC, la utilizacin de m-
WHURPDGHFXELHUWDQD SRUFRUD]yQHQSDFLHQWHVFRQ todos de diagnstico por imgenes cardacos orientados
muerte sbita, mientras que los estudios in vivo que eva- hacia la prevencin primaria se haba concentrado en la
luaron el rbol coronario mediante herramientas invasi- deteccin de isquemia silente de miocardio.
YDV KDQ HQFRQWUDGR XQ SUHYDOHQFLD VLJQLFDWLYDPHQWH Ante la presencia de una estenosis hemodin-
mayor. Se debe destacar que, amn de las limitaciones PLFDPHQWH VLJQLFDWLYD H[LVWHQ GLVWLQWRV tQGLFHV
de los mtodos invasivos, los estudios histopatolgicos, isqumicos o marcadores de isquemia que van a ver-
DOVHFFLRQDUORVYDVRVFDGDDPPVHJXUDPHQWHVXE- se afectados ms o menos precozmente. El primer
estimen la verdadera prevalencia de las lesiones, ya que marcador de isquemia es la alteracin en la perfusin
estas pueden abarcar apenas un par de cientos de micro- PLRFiUGLFD HYDOXDGR SRU WRPRJUDItD SRU HPLVLyQ
QHV GH ODUJR>@$GHPiV QR VyOR HV LPSUHGHFLEOH OD GHIRWyQ~QLFR63(&7WRPRJUDItDSRUHPLVLyQGH
asociacin directa entre el accidente de placa y el evento SRVLWURQHV 3(7 R UHVRQDQFLD PDJQpWLFD FDUGtDFD
clnico, sino tambin la cronologa entre ambos even- 50&  VHJXLGR SRU DOWHUDFLRQHV HQ HO PHWDEROLVPR
WRVKDELpQGRVHUHSRUWDGRTXHHQDOPHQRVGHORV 3(7 ODIXQFLyQGLDVWyOLFD HFRGRSSOHUR50& \
pacientes con IAM con supradesnivel del segmento ST, ODIXQFLyQVLVWyOLFD HFRHVWUpV50& /RVFDPELRV
ORVWURPERVWLHQHQGtDVRVHPDQDVGHGHVDUUROOR>@ HOHFWURFDUGLRJUiFRV \ ORV VtQWRPDV VH PDQLHVWDQ
recin en estadios ms tardos de la enfermedad. La
RECOMENDACIONES ACTUALES comprensin de la cascada isqumica es importante
ya que va a permitir discriminar entre distintos gra-
Las guas actuales en prevencin primaria recomien- GRV GH LVTXHPLD XQ HVWXGLR IXQFLRQDO FRQ GHIHFWR
GDQODHVWUDWLFDFLyQGHULHVJRLQLFLDOPHGLDQWHVFR- de perfusin pero sin alteraciones en la motilidad pa-


CAPTULO 2 Diagnstico por imgenes en prevencin primaria

Tabla 2.1 Caractersticas del score de calcio coronario por TC multidetector (CAC), del espesor ntimo-media carotdeo por
ultrasonido (EIM), y de la vasodilatacin de la arteria braquial mediada por ujo (VMF).

CAC EIM VMF


Ateroesclerosis Ateroesclerosis
Objetivo Disfuncin endotelial
coronaria carotdea
Requerimientos previos/preparacin - - +++
Contraste endovenoso - - -
Rapidez +++ ++ +
Radiacin + (~1.0-1.5 mSv) - -
Costo aproximado USD 100-200 USD 50-100 USD 50-100
Reproducibilidad +++ ++ +
Valor predictivo +++ + +
Incidencia de eventos a 5 aos en
~0.5 % ND ND
pacientes con estudio negativo
Puntos de corte establecidos mediante 0; 1-10; 11-99; 100-
1 mm ND
MBE 399; 400-999; t1000
Percentil de acuerdo a sexo y edad Si Si ND
Nivel de indicacin en asintomticos IIa IIa ND

CAC: score de calcio coronario; EIM: espesor intima-media carotdeo; VMF: vasodilatacin mediada por ujo; MBE: medicina
basada en la evidencia.

rietal representar una isquemia de menor grado res- mamografa, la deteccin de sangre oculta en materia
SHFWRDODSUHVHQFLDGHDOWHUDFLRQHVGHODPRWLOLGDG 
fecal y/o videocolonoscopa, y el antgeno prosttico
asociados a su vez al pronstico clnico. HVSHFtFRHQWUHRWURV
(OXMR 4 FRURQDULREDVDOQRGLVPLQX\HVLJQL- A pesar de que a nivel global la ECV causa ms
FDWLYDPHQWH KDVWD TXH QR VH DOFDQ]D XQ HVWUHFKD-
muertes en s misma que la suma de todos los tipos de
PLHQWROXPLQDOGHXQ/DUHVHUYDFRURQDULD 4 cncer, no se ha adoptado de manera concreta al da
Pi[LPR DQWH XQ HVWtPXOR YDVRGLODWDGRU  4 EDVDO 
de la fecha una herramienta de screening que permita
FRPLHQ]DDDOWHUDUVHDSDUWLUGHXQDHVWHQRVLVGHOdetectar precozmente la ateroesclerosis coronaria.
\FDHVLJQLFDWLYDPHQWHDSDUWLUGHXQ3RU ([LVWHHYLGHQFLDFRQFOX\HQWHTXHGHWHUPLQDXQD
otra parte, la longitud de la lesin es un factor de- HVWUHFKDUHODFLyQHQWUHHOJUDGRGHFDOFLFDFLyQDUWH-
terminante, pudiendo una lesin moderada de largo rial coronaria estimado mediante tomografa compu-
trayecto ser igual o hemodinmicamente ms signi- WDGD &$& \ODFDUJDDWHURHVFOHUyWLFDVXE\DFHQWH
FDWLYDTXHXQDOHVLyQIRFDOVHYHUDDVtFRPRODSUH- Si bien pueden realizarse adquisiciones de CAC con
VHQFLDGHOHVLRQHVHQWiQGHP>@ WRPyJUDIRVKHOLFRLGDOHVRGHODVGHGHWHFWRUHVORV
Habiendo descripto sucintamente el concepto de tomgrafos ms comnmente utilizados actualmente
cascada isqumica, se desprende del mismo el hecho VRQORVGHRPiVODVGHGHWHFWRUHV/DDGTXLVLFLyQ
de que pesquisar la presencia de isquemia en preven- no requiere administracin de contraste por va endo-
FLyQSULPDULDHVSDUDGyMLFRHLQFRPSDWLEOHFRQHORE- venosa ni administracin de betabloqueantes, se realiza
MHWLYRGHGHWHFWDUSUHFR]PHQWHODHQIHUPHGDG HQPHQRVGHVHJXQGRV\VHDVRFLDDXQDGRVLVGH
Por lo tanto, se requieren herramientas que per- UDGLDFLyQHIHFWLYDGHDSUR[LPDGDPHQWHaP6Y
mitan detectar precozmente la presencia de ateroes- XQDGRVLVLQIHULRUDODGRVLVDPELHQWDODQXDO P6Y \
clerosis coronaria, no de herramientas que detecten laQRPXFKRPD\RUTXHODGRVLVGHXQDPDPRJUDItD a
presencia enfermedad obstructiva coronaria. P6Y $XQTXHH[LVWHQGLVWLQWRVPpWRGRVRVFRUHVYDOL-
dados, la estimacin de CAC se realiza generalmente
SCORE DE CALCIO CORONARIO PHGLDQWHHOVFRUHGH$JDWVWRQ )LJXUD 6HKDQHVWD-
EOHFLGRSXQWRVGHFRUWHSDUDGHQLUGLVWLQWRVQLYHOHVGH
&RPR VH PHQFLRQy SUHYLDPHQWH H[LVWHQ P~OWLSOHV ULHVJR GHPX\EDMRDPX\DOWRULHVJRGHHYHQWRV&$&
herramientas de screening con aplicacin clnica es- &$&&$&&$&\&$&
tablecida para la deteccin precoz de distintas pato-  VLELHQHVLPSRUWDQWHFRQVLGHUDUHOSHUFHQWLOGH
logas con mucho menor impacto global que la enfer- DFXHUGRDOVH[R\DOJUXSRHWiUHRVLHQGRHOSHUFHQWLO!
PHGDGFDUGLRYDVFXODU (&9 7DOHVVRQHOFDVRGHOD XQSUHGLFWRULQGHSHQGLHQWHGH,$0\PXHUWH>@(Q


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 2.1 Principales tipos de calcicaciones que se pueden observar a nivel del rbol coronario mediante score de calcio co-
ronario (CAC) por tomografa computada multidetector: calcicaciones focales en tronco coronario izquierdo y tercio proximal
de la arteria descendente anterior (panel a); calcicaciones espiculadas en tronco coronario izquierdo y tercio proximal de la
arteria descendente anterior (panel b); y calcicacin difusa de la arteria descendente anterior (panel c).

este respecto, se debe conocer a modo estimativo la pre-


YDOHQFLDGH&$&HQODSREODFLyQGHDFXHUGRDOVH[R(O
estudio poblacional Multi-Ethnic Study of Atheroscle-
URVLV 0(6$ GHWHUPLQyTXHHQKRPEUHVDVLQWRPiWLFRV
FRQXQDHGDGPHGLDGHDxRVHOGHORVFDXFi-
VLFRV \ HO   GH ORV KLVSDQRV UHVLGHQWHV HQ 86$ 
SUHVHQWDDOJ~QWLSRGH&$&PLHQWUDVTXHHQPXMHUHV
GHOPLVPRJUXSRHWiUHRHOGHODVFDXFiVLFDV\HO
GHODVKLVSDQDVSUHVHQWDDOJ~QWLSRGH&$&>@
La evidencia a favor del valor pronstico del sco-
re de calcio es robusta y consistente en concluir que
la presencia de CAC es un factor predictor de even-
tos cardacos mayores y de mortalidad total indepen-
diente de los factores de riesgo coronario tradicio-
QDOHVGHODHWQLD\GHHVWXGLRVIXQFLRQDOHV>@
(QSDUWLFXODUXQFRQVHQVRGHH[SHUWRVGHO$PHULFDQ
College of Cardiology/American Heart Association
SXEOLFDGRHQHODxRFRQFOX\HORTXHKR\VHFR-
noce con mayor precisin, que la mayor utilidad de Figura 2.2 Score de calcio coronario (CAC) en paciente asin-
la evaluacin de CAC es para incrementar el valor tomtico de sexo masculino, de 55 aos de edad, con mlti-
pronstico en individuos asintomticos con riesgo ples factores de riesgo coronario: hipertensin, dislipidemia,
LQWHUPHGLRVHJ~QHO)56>@ estrs, y antecedentes heredofamiliares. Se puede observar la
(QXQDQiOLVLVVHFXQGDULRGHHVWXGLRVFRQSDFLHQ- ausencia de calcicaciones (CAC 0).
WHVFRQ)56LQWHUPHGLR>@ODLQFLGHQFLDDQXDOGH
PXHUWHFDUGtDFDR,$0IXHGH\
SDUDSDFLHQWHVFRQ&$&&$&\&$& LQGLYLGXRVDVLQWRPiWLFRVFRQ&$&VXIULHURQHYHQWRV
UHVSHFWLYDPHQWHVLWXDQGRDORVLQGLYLGXRVFRQ FDUGtDFRVFRPSDUDGRFRQGH  LQ-
&$&HQXQDVLWXDFLyQGHULHVJRHTXLYDOHQWHDOD GLYLGXRVDVLQWRPiWLFRVFRQ&$&! S >@
de individuos con enfermedad coronaria establecida. Basado en la evidencia descripta, en individuos
Especial inters tiene el valor pronstico de la au- asintomticos, el CAC se ha posicionado como el
VHQFLDGHFDOFLFDFLRQHV &$&  )LJXUD 6DUZDU recurso diagnstico de mayor valor predictivo nega-
\ FRODERUDGRUHV SXEOLFDURQ HQ HO DxR  XQ PHWD tivo, por sobre los factores de riesgo y scores de ries-
DQiOLVLV TXH LQFOX\y  HVWXGLRV TXH HVWXGLDURQ SURV- go tradicionales, as como de biomarcadores sricos.
SHFWLYDPHQWH  LQGLYLGXRV DVLQWRPiWLFRV 7UDV >@/DDXVHQFLDGHFDOFLFDFLRQHVFRURQDULDVHQ
XQVHJXLPLHQWRGHPHVHVGH   LQGLYLGXRV DVLQWRPiWLFRV FRQHUH XQ PDUJHQ VHJX-


CAPTULO 2 Diagnstico por imgenes en prevencin primaria

ULGDG UHODWLYR GH DSUR[LPDGDPHQWH  DxRV FRQ XQ GHSDFLHQWHVGHEDMRULHVJRVXEJUXSRVGHPD\RUULHV-


ULHVJRDQXDOGHHYHQWRVGHFHUFDGH> go como aquellos con antecedentes heredofamiliares
@ GHHQIHUPHGDGFRURQDULDSUHPDWXUD>@&LHUWD-
(OGRFXPHQWRGHFRQVHQVRGHH[SHUWRVGHO$PHUL- mente, las guas de criterios de uso apropiado de to-
can College of Cardiology/American Heart Association mografa computada cardaca publicadas de manera
OHRWRUJDDO&$&XQDLQGLFDFLyQGHFODVH,,D HVUD]R- FRQMXQWD SRU P~OWLSOHV VRFLHGDGHV HQ HO DxR 
QDEOH VX XWLOL]DFLyQ  HQ LQGLYLGXRV DVLQWRPiWLFRV FRQ adems de la mencionada indicacin en individuos
ULHVJRLQWHUPHGLRGHHYHQWRVDDxRV )LJXUD 6LQ asintomticos de riesgo intermedio, tambin consi-
HPEDUJRGLFKRGRFXPHQWRQRHQFRQWUyVXFLHQWHHYL- GHUDQDSURSLDGRHOXVRGH&$&HQLQGLYLGXRVGHEDMR
dencia para otorgar una recomendacin favorable en in- ULHVJRTXHWHQJDQDQWHFHGHQWHVKHUHGRIDPLOLDUHV>@
GLYLGXRVFRQULHVJREDMRQLHQDTXHOORVFRQULHVJRDOWR Adems del valor pronstico mencionado, la rea-
quienes ya presentan per se indicacin de implementar lizacin de CAC se asocia a un incremento en los
HVWUDWHJLDVDJUHVLYDVGHSUHYHQFLyQ>@&DEHGHVWDFDU niveles de adherencia al tratamiento sistmico y a la
que ningn otro mtodo diagnstico por imgenes car- PHMRUtDHQHOHVWLORGHYLGDHQLQGLYLGXRVFRQ&$&
GtDFR QL SUXHED IXQFLRQDO HUJRPHWUtD 63(&7 3(7 HOHYDGR>@
eco-estrs, ni angiografa coronaria por TC multidetec-
WRU DOFDQ]DHVWHQLYHOGHUHFRPHQGDFLyQHQLQGLYLGXRV COSTO-EFECTIVIDAD
asintomticos.
(QFXDQWRDORVLQGLYLGXRVDVLQWRPiWLFRVGHEDMR Si se propone instaurar de manera globalizada una
ULHVJRQRH[LVWHD~QUHFRPHQGDFLyQSDUDHYDOXDFLyQ herramienta de screening como el CAC, que invo-
mediante CAC. La distribucin del riesgo mediante OXFUDUtD SRU HMHPSOR DSUR[LPDGDPHQWH HO   GH
HO)56HVPX\YDULDEOHGHDFXHUGRDOVH[R\ODHGDG ORV KRPEUHV GH HQWUH  \  DxRV GHEH HYDOXDUVH
SULQFLSDOPHQWH 6L ELHQ PiV GHO   GH ORV KRP- si el estudio en cuestin no iniciar una cascada de
EUHVPD\RUHVGHDxRVVHUtDQFDQGLGDWRVSDUDHV- estudios innecesarios. El estudio EISNER evalu el
WUDWLFDFLyQ GH ULHVJR DGLFLRQDO FRQ PpWRGRV FRPR LPSDFWRGHO&$&VREUHHOPDQHMRWHUDSpXWLFRVXEVL-
HO&$&WDQWRHOGHODVPXMHUHVGHHQWUH\ JXLHQWH\FRQVXPRGHUHFXUVRVDMXVWDGRSRUODLQD-
DxRVFRPRHOGHORVKRPEUHVGHHQWUH\ FLyQGXUDQWHXQVHJXLPLHQWRGHDxRVGHPRVWUDQGR
DxRVDOVHUFODVLFDGRVFRPRGHEDMRULHVJRSRU una mnima utilizacin de recursos en individuos
HO)56VHUtDQH[FOXLGRVGHWRGDHYDOXDFLyQGHscree- DVLQWRPiWLFRVFRQ&$& 8'DQXDOHV 
ning>@'HVGHDOJXQRVVHFWRUHVVHVXJLHUHTXHHV- TXLHQHVUHSUHVHQWDQHOGHODSREODFLyQHVWXGLD-
tas limitaciones de los scores de riesgo tradicionales GD REVHUYDQGR XQ FRVWR DQXDO VLJQLFDWLYDPHQWH
GHELHUDQFRPSHQVDUVHLGHQWLFDQGRGHQWURGHOJUXSR PD\RUHQLQGLYLGXRVFRQ&$&!GHVWDFiQGRVH

a b c
CD

*
DA
DA

CX

Figura 2.3 Paciente asintomtico de sexo masculino, de 74 aos de edad, con los siguientes factores de riesgo coronario: hi-
pertension, dislipidemia, y ex tabaquista. Se observa calcicacin difusa del rbol coronario, con extensa calcicacin de la
arteria descendente anterior, de la primera septal (*, panel b), y calcicaciones focales del ostium de la arteria circuneja (panel
a) y del tercio proximal de la arteria coronaria derecha (panel c). Se calcula un score de calcio coronario (CAC) de 1058, en el
percentil 83 % de acuerdo al sexo y al grupo etreo.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

TXH HVWRV ~OWLPRV UHSUHVHQWDQ DSHQDV HO   GH OD Pi[LPR\GHPPSDUDHO(,0PHGLRHYD-


SREODFLyQEODQFR>@ OXDGRVHQODFDUyWLGDFRP~Q>@
([LVWHQ DFWXDOPHQWH GRV IRUPDV GH UHSRUWDU HO
ESPESOR INTIMO MEDIA (,0 XWLOL]iQGROR FRPR XQD YDULDEOH FRQWLQXD FRQ
CAROTDEO XPEUDOHVSURQyVWLFRVSUHGHWHUPLQDGRV VLHQGRPP
HO XPEUDO PiV XWLOL]DGR  R PHGLDQWH SHUFHQWLORV GH
(OHVSHVRULQWLPRPHGLDFDURWLGHR (,0 SHUPLWHHV- DFXHUGRDOVH[R\DODHGDGGHOLQGLYLGXR\DTXHFRPR
timar con precisin la carga de placa ateroesclertica todos los marcadores subclnicos de ateroesclerosis,
DQLYHOGHODDUWHULDFDUyWLGDFRP~Q )LJXUD /D HO(,0VHLQFUHPHQWDFRQODHGDG3DUDVLPSOLFDUOD
utilizacin de este marcador de ateroesclerosis sub- estandarizacin y conocimiento de los valores norma-
clnica mediante ultrasonido carotdeo en modo B se les de EIM, Jagr y colaboradores desarrollaron una
KDLQFUHPHQWDGRH[SRQHQFLDOPHQWHHQORV~OWLPRV HFXDFLyQ VLPSOLFDGD GpFDGD GH YLGD  PP 
DxRVVLHQGRXQPpWRGRVHJXURUiSLGREDUDWR\UH- SDUDFDOFXODUHO(,0PHGLRGHDFXHUGRDODHGDG>@
SURGXFLEOHSUHVHQWDQGRXQDH[FHOHQWHFRQFRUGDQFLD A pesar de que la evidencia inicial posicion al
con las mediciones por angiotomografa computada EIM como una herramienta con gran valor pronsti-
PXOWLGHWHFWRU>@ FRSDUDODHVWUDWLFDFLyQGHULHVJRGHHYHQWRVFDUGLR-
Si bien en sus inicios las mediciones de EIM vasculares en individuos asintomticos, numerosos
se realizaban manualmente, se demostr que la estudios prospectivos recientes a gran escala han fa-
deteccin automtica o semi-automtica de bordes llado en demostrar de manera consistente dicha aso-
PHMRUD VLJQLFDWLYDPHQWH OD UHSURGXFLELOLGDG GHO ciacin, o detectado un efecto de magnitud menor al
PpWRGR>@ (O (,0 SXHGH HYDOXDUVH HQ GLVWLQWRV HVSHUDGR>@
segmentos de la arteria cartida, siendo la carti- (QHO+HLQ]1L[GRUI5HFDOOVWXG\GHVSXpVGHFR-
GD FRP~Q HO VHJPHQWR GH PHMRU YLVXDOL]DFLyQ GH rregir para factores de riesgo tradicionales, el valor
PRGR TXH OD HVWLPDFLyQ GHO (,0 Pi[LPR VXHOH SUHGLFWLYR GHO (,0 SDUD SUHGHFLU VWURNH IXH DSHQDV
efectuarse de rutina en dicho segmento. En cuanto PRGHUDGR  SRU FDGD  PP &,   
a la reproducibilidad, cabe destacarse tambin que  FRPSDUDGRFRQRWURVIDFWRUHVGHULHVJRFRPR
ODVPHGLFLRQHVGH(,0SXHGHQYDULDUHQWUHXQ\ ODHGDG SRUFDGDDxRV&, 
XQGXUDQWHXQPLVPRFLFORFDUGtDFR(VWRKD ODSUHVLyQVLVWyOLFD SRUFDGDPP+J&,
llevado a la utilizacin en algunos medios del ga-  \HOWDEDTXLVPR &,
WLOODGRHOHFWURFDUGLRJUiFRREWHQLpQGRVHLPiJHQHV  >@
PiVUHSURGXFLEOHVVLQFURQL]DGDVFRQODRQGD5>@ En la misma lnea, un metanlisis reciente que
OLeary y colaboradores reportaron una variabili- LQFOX\y  HVWXGLRV SURVSHFWLYRV FRQ  LQGL-
GDGLQWHUREVHUYDGRUGHPPSDUDHO(,0 viduos asintomticos evaluados mediante EIM con
VHJXLPLHQWRORQJLWXGLQDOGHDxRVSDUDODRFXUUHQ-
FLD GH LQIDUWR GH PLRFDUGLR \R VWURNH UHSRUWy TXH
la adicin de EIM al FRS se asoci a una muy leve
PHMRUtDHQODFDSDFLGDGSUHGLFWLYDSRVLEOHPHQWHGH
VLJQLFDQFLDFOtQLFDGXGRVD>@
(Q FXDQWR D OD HYDOXDFLyQ VHULDO GHO (,0 H[LV-
te controversia acerca de si el cambio en la tasa de
progresin del EIM inducido por intervenciones te-
raputicas farmacolgicas se traducir en cambios
en la tasa de eventos cardiovasculares, si bien en el
HVWXGLR 0(7(25 OD DGPLQLVWUDFLyQ GH  PJG GH
URVXYDVWDWLQD HQ LQGLYLGXRV DVLQWRPiWLFRV GH EDMR
ULHVJR VH DVRFLy D XQD UHGXFFLyQ VLJQLFDWLYD HQ OD
WDVDGHSURJUHVLyQGHO(,0Pi[LPRDGRVDxRVGHVH-
JXLPLHQWR>@(QHIHFWRXQPHWDDQiOLVLVSXEOLFDGR
Figura 2.4 Espesor intima-media de la cartida comn iz- UHFLHQWHPHQWHTXHLQFOX\yHVWXGLRVSURVSHFWLYRV
quierda. En el centro de la imagen se puede observar el cur- FRQSDFLHQWHVHYDOXDGRVPHGLDQWH(,0VHULD-
sor/regla que se extiende de forma perpendicular incluyendo OHVVHSDUDGRVSRUXQDPHGLDQDGHDxRVODSURJUH-
la ntima y la media en la medicin. Con el permiso de Ta- sin del EIM no se asoci a un incremento del riesgo
hmasebpour H R et al. Radiographics 2005;25:1561-1575. GHHYHQWRV &, >@


CAPTULO 2 Diagnstico por imgenes en prevencin primaria

Similarmente, otro meta-anlisis publicado por mnmente utilizada para evaluar la funcin endote-
&RVWDQ]R \ FRODERUDGRUHV TXH LQFOX\y  HVWXGLRV lial. La disfuncin endotelial precede la ateroesclero-
\  LQGLYLGXRV QR HQFRQWUy DVRFLDFLyQ DOJXQD sis, de modo que la una reduccin en la VMF es un
entre la regresin del EIM y la incidencia de eventos marcador precoz de ateroesclerosis subclnica.
FDUGLRYDVFXODUHV>@ El fundamento del mtodo es el incremento de la
A pesar de las limitaciones mencionadas, las guas ELRGLVSRQLELOLGDGGHy[LGRQtWULFR 12 \RWURVIDF-
GHHVWUDWLFDFLyQGHULHVJRHQLQGLYLGXRVDVLQWRPiWLFRV WRUHVUHODMDQWHVGHOHQGRWHOLRHQUHVSXHVWDDODXPHQWR
del American College of Cardiology/American Heart GHODIXHU]DGHFL]DOODPLHQWRWUDQVYHUVDO>@'LFKR
Association y de la Sociedad Argentina de Cardiologa DXPHQWR VH SURGXFH FXDQGR HO XMR VDQJXtQHR GHO
OHDVLJQDURQDO(,0XQDLQGLFDFLyQGHWLSR,,D HVUD- antebrazo aumenta durante la hiperemia reactiva ob-
]RQDEOHVXXWLOL]DFLyQ HQLQGLYLGXRVDVLQWRPiWLFRVFRQ tenida luego de un breve perodo de isquemia distal.
ULHVJRLQWHUPHGLRVHJ~QHO)56>@ La inyeccin de agentes agonistas dependientes
Un prrafo aparte merece el hecho de que el ultra- del endotelio como la acetilcolina es un mtodo in-
VRQLGRFDURWtGHRSHUPLWHHYDOXDUSODFDVQRFDOFLFD- YDVLYR\QRH[HQWRGHFRPSOLFDFLRQHVSDUDODHYDOXD-
GDV(VFRQRFLGRTXHODDWHURPDWRVLVFDUyWLGHDGLH- cin de la funcin endotelial. En contraste, la VMF
UHVLRSDWROyJLFDPHQWHGHODDWHURPDWRVLVFRURQDULD HVXQPpWRGRQRLQYDVLYRTXHLPSOLFDODLQVXDFLyQ
con factores de riesgo tradicionales que presentan un de un manguito en el antebrazo a un nivel de presin
impacto distinto. De todas maneras, se ha observado VXSUDVLVWyOLFDSRUPLQXWRV$OGHVLQDUUiSLGDPHQ-
TXHHQSDFLHQWHVFRQDXVHQFLDGHFDOFLFDFLRQHVFR- te el manguito se observa una hiperemia reactiva que
URQDULDVSDUWLFXODUPHQWHHQMyYHQHV\RPXMHUHVVH LQFUHPHQWDVLJQLFDWLYDPHQWHHOXMR\HQFRQVHFXHQ-
puede observar evidencia de ateromatosis carotdea cia la fuerza de cizallamiento transversal, dando como
PHGLDQWHHO(,0HQXQSRUFHQWDMHDSUHFLDEOHGHSD- resultado la activacin de la eNOS para que libere NO
FLHQWHV>@3RUORWDQWRHO(,0SRGUtDVHUXQDPHMRU DWUDYpVGHOD/DUJLQLQD(O12QDOPHQWHYDDFRQ-
RSFLyQ TXH HO &$& HQ LQGLYLGXRV MyYHQHV HQ TXLH- GXFLUDODUHODMDFLyQGHOP~VFXOROLVR\YDVRGLODWDFLyQ
nes se desee pesquisar la presencia de ateroesclerosis /D90)HVWtSLFDPHQWHH[SUHVDGDFRPRHOLQFUH-
subclnica. Sin embargo, una vez presente, el valor mento relativo del dimetro arterial observado entre
predictivo del CAC es mucho mayor que el del EIM. HOHVWDGREDVDO\ODKLSHUHPLDUHDFWLYD )LJXUDV
Finalmente, con respecto a la edad, se debe mencio- \   6LQ HPEDUJR GHVGH XQ SXQWR GH YLVWD SUiF-
nar que dado que los ancianos suelen presentar hiper- WLFRH[LVWHQXQDVHULHGHUHTXHULPLHQWRVTXHGHEHQ
WURDGHODW~QLFDPHGLDHO(,0SXHGHHQFRQWUDUVH ser respetados para obtener resultados reproducibles,
falsamente elevado en dichos individuos. WDQWRGHSHQGLHQWHVGHOSDFLHQWH DEVWHQFLyQGHHMHU-
FLFLRWDEDFR\GURJDVYDVRPRWRUDVSRUKVUHSR-
VASODILATACIN MEDIADA POR VRHQGHF~ELWRVXSLQRGXUDQWHPLQXWRVSUHYLRDO
FLUJO estudio, realizacin de estudios seriados en similares
condiciones de temperatura, ciclo menstrual y hora
La vasodilatacin de la arteria braquial mediada por GHOGtDSDUDUHVSHWDUHOFLFORFLUFDGLDQR FRPRGHV-
XMR 90)  HV OD KHUUDPLHQWD GLDJQyVWLFD PiV FR- GH HO SXQWR GH YLVWD WpFQLFR IUHFXHQFLD JDQDQFLD

Figura 2.5 Eco-doppler de la arteria braquial basal y 60 segundos post-isquemia. Se puede observar un importante incremento
en el ujo, sin cambios signicativos en el dimetro en este caso.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Desafortunadamente, a pesar de que a nivel glo-


Percentil 75 %
bal la ECV causa ms muertes en s misma que la
Percentil 50 %
suma de todos los tipos de cncer, no se ha adoptado
an de manera concreta una herramienta de scree-
Percentil 25 % ning que permita detectar precozmente la ateroescle-
rosis coronaria.
/RV VFRUHV FRQYHQFLRQDOHV GH HVWUDWLFDFLyQ GH
riesgo cardiovascular tienen un gran valor predictivo
SDUDORVLQGLYLGXRVGHPX\EDMRULHVJR\SDUDDTXHOORV
de riesgo elevado. Sin embargo, su capacidad predic-
WLYDSDUDODPD\RUtDGHORVDGXOWRVHQWUH\DxRV
Figura 2.6 Nomograma para determinar la vasodilatacin me- HVPRGHUDGD>@3RUORWDQWRHVHVHQFLDOPHMRUDUOD
diada por ujo (VMF) segn el dimetro basal de la arteria HVWUDWLFDFLyQ GH ULHVJR LQFRUSRUDQGR KHUUDPLHQWDV
humeral. Se evidencia la relacin inversa lineal entre el di- como las descriptas en el presente captulo.
metro basal y la vasodilatacin mediada por ujo. Para un /DV 6FUHHQLQJ IRU +HDUW $WWDFN 3UHYHQWLRQ DQG
dimetro basal especco, puede estimarse la vasodilatacin (GXFDWLRQ 6+$3(  JXLGHOLQHV SURSRQHQ HYDOXDU
mediada por ujo. Con permiso de Arrebola-Moreno AL et mediante estudios adicionales a todo hombre asinto-
al.[60] PiWLFRGHHQWUH\DxRV\PXMHUGHHQWUH\
DxRVH[FHSWRDTXHOORVGHPX\EDMRULHVJR>@(VWH
REMHWLYRDOPHQRVHQODDFWXDOLGDGSDUHFHGHPDVLD-
SRVLFLyQ iQJXOR  /D DXVHQFLD GH XQ SXQWR GH FRU- GRDPELFLRVR\TXL]iXQWDQWRLQHVSHFtFRFDUHQWH
te determinado con valor pronstico concluyente ha de sustento en evidencia prospectiva, y difcilmente
OOHYDGRDORVLQYHVWLJDGRUHVDXWLOL]DUODVPHGLDQDV R costo-efectivo. Por otra parte, si bien se pueden es-
WHUWLORV  GH VXV SURSLDV SREODFLRQHV FRPR SXQWR GH grimir argumentos a favor del screening en pacientes
corte, o a darle ms utilidad al mtodo al comparar !DxRVHQWpUPLQRVJHQHUDOHVVXDSOLFDFLyQQRVH-
poblaciones o en evaluaciones seriadas en un mismo ra costo-efectiva.
individuo. $OHOHJLURMX]JDUXQDKHUUDPLHQWDGHscreening,
A pesar de dichas limitaciones, la VDF, adems de se deben tener en cuenta numerosos factores: su valor
SUHVHQWDUXQDFRUUHODFLyQVLJQLFDWLYDFRQODHVWLPD- pronstico y la evidencia que lo sostiene, su disponi-
cin invasiva mediante administracin de adenosina bilidad, su reproducibilidad, su costo, y su seguridad.
intracoronaria, se ha posicionado como un mtodo Los dos mtodos con mayor evidencia en su fa-
de rutina para la evaluacin de la funcin endotelial, vor para la evaluacin no invasiva de ateroesclerosis
utilizndose incluso como marcador subrrogante en subclnica son el CAC y el espesor intimo-media ca-
QXPHURVRVHVWXGLRVFOtQLFRVUHFLHQWHV>@ rotdeo por eco-doppler.
Adems, mltiples estudios prospectivos han de- Con el conocimiento de que el FACF es el prin-
mostrado una asociacin entre la presencia de disfun- cipal substrato de la ruptura de placa y, consecuente-
cin endotelial evaluada mediante VMF con eventos mente, de la oclusin trombtica aguda coronaria, la
FDUGLRYDVFXODUHV LQGHSHQGLHQWHPHQWH GHO VH[R \ GH herramienta ideal sera aquella capaz de detectar el
factores de riesgo tradicionales, e incluso la mortali- )$&)GHPDQHUDQRLQYDVLYDVHJXUDHFD]\SRFR
GDGWRWDOHQSREODFLRQHVVHOHFFLRQDGDV>@ FRVWRVD>@
Dos de los tres criterios mayores del FACF, core
CONSIDERACIONES FINALES Y lipdico y remodelamiento positivo, son valorables
PERSPECTIVAS FUTURAS mediante mtodos no invasivos como la angiografa
coronaria por tomografa computada multidetector
Desde hace tiempo se ha incorporado incluso a $&7&0  OD FXDO SUHVHQWD XQD JUDQ FRQFRUGDQFLD
nivel de polticas sanitarias la utilizacin rutinaria de con el IVUS en cuanto a la evaluacin del ndice
mltiples herramientas de screening con aplicacin de remodelamiento, el cual a su vez se correlacio-
clnica establecida para la deteccin precoz de dis- na estrechamente con la composicin de la placa.[7,
tintas patologas con mucho menor impacto global @3RURWUDSDUWHODSUHVHQFLDGHFDOFLFDFLRQHV
TXHOD(&96HSXHGHQFLWDUFRPRHMHPSORVODPD- HVSLFXODGDVSDUWLFXODUPHQWHPPVHDVRFLDDOD
mografa, la deteccin de sangre oculta en materia presencia de placas con fenotipos de alto riesgo y con
fecal y/o videocolonoscopa, y el antgeno prosttico ODSUHVHQFLDGH)$&)>@
HVSHFtFRHQWUHRWURV Si bien los tomgrafos de ltima generacin per-


CAPTULO 2 Diagnstico por imgenes en prevencin primaria

miten adquisiciones de ACTCM con dosis de radia- La gran cantidad de evidencia a su favor ha lle-
FLyQHIHFWLYDPX\EDMDVQRGHMDUtDGHVHUXQHVWXGLR vado a mltiples sociedades de cardiologa interna-
con requerimiento de administracin de contraste por cionales a otorgar tanto al CAC como al EIM carot-
YtD HQGRYHQRVD> @$GHPiV VX HOHYDGR FRVWR deo una indicacin de clase IIa para su utilizacin en
relativo actual en relacin con la enorme poblacin LQGLYLGXRVDVLQWRPiWLFRVFRQULHVJRLQWHUPHGLR>@
EODQFRORH[FOX\HFRPRKHUUDPLHQWDGHscreening, si Desafortunadamente, a los mismos colegas de espe-
bien se podra argumentar el caso de la videocolonos- cialidad les lleva tiempo la incorporacin de nuevas
FRStD GHFRVWRHOHYDGR HQVXIDYRU metodologas, aferrndose a veces a prcticas no fun-
El CAC se posiciona entonces como una herra- damentadas en la evidencia. Se espera entonces que
mienta rpida, segura, con gran valor predictivo, que HQORVSUy[LPRVDxRVVHSXHGDREVHUYDUXQDPRGL-
PHMRUDVLJQLFDWLYDPHQWHODHVWUDWLFDFLyQGHULHVJR cacin en la tendencia, para poder poner a prueba en
mediante scores convencionales. Adems, su costo de- el escenario real si la implementacin menos restric-
EHUtDVHUEDMRLQIHULRUDOGHXQDWRPRJUDItDGHWyUD[\D tiva de estas metodologas tendra o no un impacto
que consume menos segundos de tubo de rayos. VDQLWDULRVLJQLFDWLYR

BIBLIOGRAFA

1. :RUOG +HDOWK 2UJDQL]DWLRQ :RUOG +HDUW )HGHUDWLRQ :RUOG 6WURNH 2UJDQL]DWLRQ *OREDO DWODV RQ FDUGLRYDVFXODU
disease prevention and control: policies, strategies, and interventions. Available at: htpp://www.who.int/
FDUGLRYDVFXODUBGLVHDVHVSXEOLFDWLRQVDWODVBFYGHQ$FFHVVHG$XJXVW 3XEOLVKHG
 8QLWHG 6WDWHV &DQFHU 6WDWLVWLFV  ,QFLGHQFH DQG 0RUWDOLW\ &HQWHUV IRU 'LVHDVH &RQWURO DQG 3UHYHQWLRQ:HE
6LWH &HQWHUVIRU'LVHDVH&RQWURODQG3UHYHQWLRQ8'R+D+6$YDLODEOHDWKWWSZZZFGFJRYFDQFHUQSFU
XVFV$FFHVR2FWXEUH
 $PEURVH-$7DQQHQEDXP0$$OH[RSRXORV'HWDO$QJLRJUDSKLFSURJUHVVLRQRIFRURQDU\DUWHU\GLVHDVHDQGWKH
GHYHORSPHQWRIP\RFDUGLDOLQIDUFWLRQ-$P&ROO&DUGLRO
 *ODVHU 5 6HO]HU ) )D[RQ '3 HW DO &OLQLFDO SURJUHVVLRQ RI LQFLGHQWDO DV\PSWRPDWLF OHVLRQV GLVFRYHUHG GXULQJ
FXOSULWYHVVHOFRURQDU\LQWHUYHQWLRQ&LUFXODWLRQ
 Glagov S, Weisenberg E, Zarins CK, et al. Compensatory enlargement of human atherosclerotic coronary arteries.
1(QJO-0HG
 Rodriguez-Granillo GA, de Winter S, Bruining N, et al. Effect of perindopril on coronary remodelling: insights from
DPXOWLFHQWUHUDQGRPL]HGVWXG\(XU+HDUW-
7. Rodriguez-Granillo GA, Serruys PW, Garcia-Garcia HM, et al. Coronary artery remodelling is related to plaque
FRPSRVLWLRQ+HDUW
 5RVDPRQG:)OHJDO.)XULH.HWDO+HDUWGLVHDVHDQGVWURNHVWDWLVWLFVXSGDWHDUHSRUWIURPWKH$PHULFDQ
+HDUW$VVRFLDWLRQ6WDWLVWLFV&RPPLWWHHDQG6WURNH6WDWLVWLFV6XEFRPPLWWHH&LUFXODWLRQH
9. $NRVDK .2 *RZHU ( *URRQ / HW DO 0LOG K\SHUFKROHVWHUROHPLD DQG SUHPDWXUH KHDUW GLVHDVH GR WKH QDWLRQDO
FULWHULDXQGHUHVWLPDWHGLVHDVHULVN"-$P&ROO&DUGLRO
 9LUPDQL5.RORGJLH)'%XUNH$3HWDO/HVVRQVIURPVXGGHQFRURQDU\GHDWKDFRPSUHKHQVLYHPRUSKRORJLFDO
FODVVLFDWLRQVFKHPHIRUDWKHURVFOHURWLFOHVLRQV$UWHULRVFOHU7KURPE9DVF%LRO
11. )DON(6KDK3.)XVWHU9&RURQDU\SODTXHGLVUXSWLRQ&LUFXODWLRQ
 $UEXVWLQL(*UDVVR0'LHJROL0HWDO&RURQDU\WKURPERVLVLQQRQFDUGLDFGHDWK&RURQ$UWHU\'LV

 Wang JC, Normand SL, Mauri L, et al. Coronary artery spatial distribution of acute myocardial infarction occlusions.
&LUFXODWLRQ
 %XIIRQ$%LDVXFFL/0/LX]]R*HWDO:LGHVSUHDGFRURQDU\LQDPPDWLRQLQXQVWDEOHDQJLQD1(QJO-0HG

 Maehara A, Mintz GS, Bui AB, et al. Morphologic and angiographic features of coronary plaque rupture detected by
LQWUDYDVFXODUXOWUDVRXQG-$P&ROO&DUGLRO
 Rodriguez-Granillo GA, Garcia-Garcia HM, Valgimigli M, et al. Global characterization of coronary plaque rupture
SKHQRW\SHXVLQJWKUHHYHVVHOLQWUDYDVFXODUXOWUDVRXQGUDGLRIUHTXHQF\GDWDDQDO\VLV(XU+HDUW-
17. Rioufol G, Finet G, Ginon I, et al. Multiple atherosclerotic plaque rupture in acute coronary syndrome: a three-vessel
LQWUDYDVFXODUXOWUDVRXQGVWXG\&LUFXODWLRQ


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 )DUE$7DQJ$/%XUNH$3HWDO6XGGHQFRURQDU\GHDWK)UHTXHQF\RIDFWLYHFRURQDU\OHVLRQVLQDFWLYHFRURQDU\
OHVLRQVDQGP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
19. 5LWWHUVPD6=YDQGHU:DO$&.RFK.7HWDO3ODTXHLQVWDELOLW\IUHTXHQWO\RFFXUVGD\VRUZHHNVEHIRUHRFFOXVLYH
coronary thrombosis: a pathological thrombectomy study in primary percutaneous coronary intervention. Circulation,

 7KLUG5HSRUWRIWKH1DWLRQDO&KROHVWHURO(GXFDWLRQ3URJUDP 1&(3 ([SHUW3DQHORQ'HWHFWLRQ(YDOXDWLRQDQG
7UHDWPHQW RI +LJK %ORRG &KROHVWHURO LQ$GXOWV $GXOW7UHDWPHQW 3DQHO ,,,  QDO UHSRUW &LUFXODWLRQ  

 Grundy SM, Cleeman JI, Merz CN, et al. Implications of recent clinical trials for the National Cholesterol Education
3URJUDP$GXOW7UHDWPHQW3DQHO,,,JXLGHOLQHV&LUFXODWLRQ
 Smith SC, Greenland P, Grundy SM. AHA Conference Proceedings. Prevention conference V: Beyond secondary
SUHYHQWLRQ,GHQWLI\LQJWKHKLJKULVNSDWLHQWIRUSULPDU\SUHYHQWLRQH[HFXWLYHVXPPDU\$PHULFDQ+HDUW$VVRFLDWLRQ
&LUFXODWLRQ
 &RQVHQVRGH3UHYHQFLyQ&DUGLRYDVFXODU6RFLHGDG$UJHQWLQDGH&DUGLRORJtD5HY$UJHQW&DUGLRO6HSW
Oct.
 'HWU\-07KHSDWKRSK\VLRORJ\RIP\RFDUGLDOLVFKDHPLD(XU+HDUW-6XSSO*
 Detrano R, Guerci AD, Carr JJ, et al. Coronary calcium as a predictor of coronary events in four racial or ethnic
JURXSV1(QJO-0HG
 (UEHO 5 0RKOHQNDPS 6 0RHEXV 6 HW DO &RURQDU\ ULVN VWUDWLFDWLRQ GLVFULPLQDWLRQ DQG UHFODVVLFDWLRQ
LPSURYHPHQWEDVHGRQTXDQWLFDWLRQRIVXEFOLQLFDOFRURQDU\DWKHURVFOHURVLVWKH+HLQ]1L[GRUI5HFDOOVWXG\-$P
&ROO&DUGLRO
 *UHHQODQG3%RQRZ52%UXQGDJH%+HWDO$&&)$+$FOLQLFDOH[SHUWFRQVHQVXVGRFXPHQWRQFRURQDU\
DUWHU\ FDOFLXP VFRULQJ E\ FRPSXWHG WRPRJUDSK\ LQ JOREDO FDUGLRYDVFXODU ULVN DVVHVVPHQW DQG LQ HYDOXDWLRQ RI
SDWLHQWV ZLWK FKHVW SDLQ D UHSRUW RI WKH$PHULFDQ &ROOHJH RI &DUGLRORJ\ )RXQGDWLRQ &OLQLFDO ([SHUW &RQVHQVXV
7DVN)RUFH $&&)$+$:ULWLQJ&RPPLWWHHWR8SGDWHWKH([SHUW&RQVHQVXV'RFXPHQWRQ(OHFWURQ%HDP
&RPSXWHG7RPRJUDSK\ GHYHORSHGLQFROODERUDWLRQZLWKWKH6RFLHW\RI$WKHURVFOHURVLV,PDJLQJDQG3UHYHQWLRQDQG
WKH6RFLHW\RI&DUGLRYDVFXODU&RPSXWHG7RPRJUDSK\-$P&ROO&DUGLRO
 *UHHQODQG 3 $OSHUW -6 %HOOHU *$ HW DO  $&&)$+$ JXLGHOLQH IRU DVVHVVPHQW RI FDUGLRYDVFXODU ULVN LQ
DV\PSWRPDWLFDGXOWVDUHSRUWRIWKH$PHULFDQ&ROOHJHRI&DUGLRORJ\)RXQGDWLRQ$PHULFDQ+HDUW$VVRFLDWLRQ7DVN
)RUFHRQ3UDFWLFH*XLGHOLQHV-$P&ROO&DUGLROH
 $UDG<*RRGPDQ.-5RWK0HWDO&RURQDU\FDOFLFDWLRQFRURQDU\GLVHDVHULVNIDFWRUV&UHDFWLYHSURWHLQDQG
DWKHURVFOHURWLFFDUGLRYDVFXODUGLVHDVHHYHQWVWKH6W)UDQFLV+HDUW6WXG\-$P&ROO&DUGLRO
 *UHHQODQG3/D%UHH/$]HQ63HWDO&RURQDU\DUWHU\FDOFLXPVFRUHFRPELQHGZLWK)UDPLQJKDPVFRUHIRUULVN
SUHGLFWLRQLQDV\PSWRPDWLFLQGLYLGXDOV-$0$
 9OLHJHQWKDUW52XGNHUN0+RIPDQ$HWDO&RURQDU\FDOFLFDWLRQLPSURYHVFDUGLRYDVFXODUULVNSUHGLFWLRQLQWKH
HOGHUO\&LUFXODWLRQ
 LaMonte MJ, FitzGerald SJ, Church TS, et al. Coronary artery calcium score and coronary heart disease events in a
ODUJHFRKRUWRIDV\PSWRPDWLFPHQDQGZRPHQ$P-(SLGHPLRO
 6DUZDU$6KDZ/-6KDSLUR0'HWDO'LDJQRVWLFDQGSURJQRVWLFYDOXHRIDEVHQFHRIFRURQDU\DUWHU\FDOFLFDWLRQ
-$&&&DUGLRYDVF,PDJLQJ
 <HERDK-0F&OHOODQG5/3RORQVN\76HWDO&RPSDULVRQRIQRYHOULVNPDUNHUVIRULPSURYHPHQWLQFDUGLRYDVFXODU
ULVNDVVHVVPHQWLQLQWHUPHGLDWHULVNLQGLYLGXDOV-$0$
 Blaha MJ, Budoff MJ, DeFilippis AP, et al. Associations between C-reactive protein, coronary artery calcium, and
cardiovascular events: implications for the JUPITER population from MESA, a population-based cohort study.
/DQFHW
 Taylor AJ, Bindeman J, Feuerstein I, et al. Coronary calcium independently predicts incident premature coronary
KHDUWGLVHDVHRYHUPHDVXUHGFDUGLRYDVFXODUULVNIDFWRUVPHDQWKUHH\HDURXWFRPHVLQWKH3URVSHFWLYH$UP\&RURQDU\
&DOFLXP 3$&& SURMHFW-$P&ROO&DUGLRO
 5DJJL3&RRLO%&DOOLVWHU748VHRIHOHFWURQEHDPWRPRJUDSK\GDWDWRGHYHORSPRGHOVIRUSUHGLFWLRQRIKDUG
FRURQDU\HYHQWV$P+HDUW-
 6KDZ/-5DJJL36FKLVWHUPDQ(HWDO3URJQRVWLFYDOXHRIFDUGLDFULVNIDFWRUVDQGFRURQDU\DUWHU\FDOFLXPVFUHHQLQJ
IRUDOOFDXVHPRUWDOLW\5DGLRORJ\
 %XGRII0-6KDZ/-/LX67HWDO/RQJWHUPSURJQRVLVDVVRFLDWHGZLWKFRURQDU\FDOFLFDWLRQREVHUYDWLRQVIURPD
UHJLVWU\RISDWLHQWV-$P&ROO&DUGLRO
 *UHHQODQG3%RQRZ52%UXQGDJH%+HWDO$&&)$+$FOLQLFDOH[SHUWFRQVHQVXVGRFXPHQWRQFRURQDU\
DUWHU\ FDOFLXP VFRULQJ E\ FRPSXWHG WRPRJUDSK\ LQ JOREDO FDUGLRYDVFXODU ULVN DVVHVVPHQW DQG LQ HYDOXDWLRQ RI
SDWLHQWV ZLWK FKHVW SDLQ D UHSRUW RI WKH$PHULFDQ &ROOHJH RI &DUGLRORJ\ )RXQGDWLRQ &OLQLFDO ([SHUW &RQVHQVXV
7DVN)RUFH $&&)$+$:ULWLQJ&RPPLWWHHWR8SGDWHWKH([SHUW&RQVHQVXV'RFXPHQWRQ(OHFWURQ%HDP
&RPSXWHG7RPRJUDSK\ &LUFXODWLRQ
 )RUG (6 *LOHV:+ 0RNGDG$+7KH GLVWULEXWLRQ RI <HDU ULVN IRU FRURQDU\ KHDUW GLVHDVH DPRQJ 86 DGXOWV


CAPTULO 2 Diagnstico por imgenes en prevencin primaria

QGLQJVIURPWKH1DWLRQDO+HDOWKDQG1XWULWLRQ([DPLQDWLRQ6XUYH\,,,-$P&ROO&DUGLRO
 1DVLU.0LFKRV('5XPEHUJHU-$HWDO&RURQDU\DUWHU\FDOFLFDWLRQDQGIDPLO\KLVWRU\RISUHPDWXUHFRURQDU\
KHDUWGLVHDVHVLEOLQJKLVWRU\LVPRUHVWURQJO\DVVRFLDWHGWKDQSDUHQWDOKLVWRU\&LUFXODWLRQ
 Nasir K, Budoff MJ, Wong ND, et al. Family history of premature coronary heart disease and coronary artery
FDOFLFDWLRQ0XOWL(WKQLF6WXG\RI$WKHURVFOHURVLV 0(6$ &LUFXODWLRQ
 7D\ORU $- &HUTXHLUD 0 +RGJVRQ -0 HW DO $&&)6&&7$&5$+$$6($61&1$6&,6&$,6&05 
appropriate use criteria for cardiac computed tomography. A report of the American College of Cardiology Foundation
$SSURSULDWH8VH&ULWHULD7DVN)RUFHWKH6RFLHW\RI&DUGLRYDVFXODU&RPSXWHG7RPRJUDSK\WKH$PHULFDQ&ROOHJH
of Radiology, the American Heart Association, the American Society of Echocardiography, the American Society
of Nuclear Cardiology, the North American Society for Cardiovascular Imaging, the Society for Cardiovascular
$QJLRJUDSK\DQG,QWHUYHQWLRQVDQGWKH6RFLHW\IRU&DUGLRYDVFXODU0DJQHWLF5HVRQDQFH-$P&ROO&DUGLRO

 Kalia NK, Miller LG, Nasir K, et al. Visualizing coronary calcium is associated with improvements in adherence to
VWDWLQWKHUDS\$WKHURVFOHURVLV
 Nasir K, McClelland RL, Blumenthal RS, et al. Coronary artery calcium in relation to initiation and continuation of
FDUGLRYDVFXODUSUHYHQWLYHPHGLFDWLRQV7KH0XOWL(WKQLF6WXG\RI$WKHURVFOHURVLV 0(6$ &LUF&DUGLRYDVF4XDO
2XWFRPHV
 Shaw LJ, Min JK, Budoff M, et al. Induced cardiovascular procedural costs and resource consumption patterns after
FRURQDU\DUWHU\FDOFLXPVFUHHQLQJUHVXOWVIURPWKH(,61(5 (DUO\,GHQWLFDWLRQRI6XEFOLQLFDO$WKHURVFOHURVLVE\
1RQLQYDVLYH,PDJLQJ5HVHDUFK VWXG\-$P&ROO&DUGLRO
 6DYLF =1 6ROGDWRYLF ,, %UDMRYLF 0' HW DO &RPSDULVRQ EHWZHHQ FDURWLG DUWHU\ ZDOO WKLFNQHVV PHDVXUHG E\
PXOWLGHWHFWRU URZ FRPSXWHG WRPRJUDSK\ DQJLRJUDSK\ DQG LQWLPDHPHGLD WKLFNQHVV PHDVXUHG E\ VRQRJUDSK\
6FLHQWLF:RUOG-RXUQDO
 .DQWHUV6'$OJUD$YDQ/HHXZHQ06HWDO5HSURGXFLELOLW\RILQYLYRFDURWLGLQWLPDPHGLDWKLFNQHVVPHDVXUHPHQWV
DUHYLHZ6WURNH
 Teynor A, Caviezel S, Dratva J, et al. An automated, interactive analysis system for ultrasound sequences of the
FRPPRQFDURWLGDUWHU\8OWUDVRXQG0HG%LRO
 2/HDU\'+3RODN-):ROIVRQ6.HWDO8VHRIVRQRJUDSK\WRHYDOXDWHFDURWLGDWKHURVFOHURVLVLQWKHHOGHUO\7KH
&DUGLRYDVFXODU+HDOWK6WXG\&+6&ROODERUDWLYH5HVHDUFK*URXS6WURNH
 -DJHU.$6WDXE''LG\RXPHDVXUHWKHLQWLPDPHGLDWKLFNQHVV"8OWUDVFKDOO0HG
 +HUPDQQ'0*URQHZROG-/HKPDQQ1HWDO,QWLPDPHGLDWKLFNQHVVSUHGLFWVVWURNHULVNLQWKH+HLQ]1L[GRUI
5HFDOOVWXG\LQDVVRFLDWLRQZLWKYDVFXODUULVNIDFWRUVDJHDQGJHQGHU$WKHURVFOHURVLV
 'HQ 5XLMWHU +0 3HWHUV 6$ $QGHUVRQ 7- HW DO &RPPRQ FDURWLG LQWLPDPHGLD WKLFNQHVV PHDVXUHPHQWV LQ
FDUGLRYDVFXODUULVNSUHGLFWLRQDPHWDDQDO\VLV-$0$
 (OLDV6PDOH6(.DYRXVL09HUZRHUW*&HWDO&RPPRQFDURWLGLQWLPDPHGLDWKLFNQHVVLQFDUGLRYDVFXODUULVN
VWUDWLFDWLRQRIROGHUSHRSOHWKH5RWWHUGDP6WXG\(XU-3UHY&DUGLRO
 %RWV0/7D\ORU$-.DVWHOHLQ--HWDO5DWHRIFKDQJHLQFDURWLGLQWLPDPHGLDWKLFNQHVVDQGYDVFXODUHYHQWVPHWD
DQDO\VHVFDQQRWVROYHDOOWKHLVVXHV$SRLQWRIYLHZ-+\SHUWHQV
 /RUHQ]0:3RODN-).DYRXVL0HWDO&DURWLGLQWLPDPHGLDWKLFNQHVVSURJUHVVLRQWRSUHGLFWFDUGLRYDVFXODUHYHQWV
LQ WKH JHQHUDO SRSXODWLRQ WKH 352*,07 FROODERUDWLYH SURMHFW  D PHWDDQDO\VLV RI LQGLYLGXDO SDUWLFLSDQW GDWD
/DQFHW
 &RVWDQ]R33HUURQH)LODUGL39DVVDOOR(HWDO'RHVFDURWLGLQWLPDPHGLDWKLFNQHVVUHJUHVVLRQSUHGLFWUHGXFWLRQRI
FDUGLRYDVFXODUHYHQWV"$PHWDDQDO\VLVRIUDQGRPL]HGWULDOV-$P&ROO&DUGLRO
 /HVWHU6-(OHLG0).KDQGKHULD%.HWDO&DURWLGLQWLPDPHGLDWKLFNQHVVDQGFRURQDU\DUWHU\FDOFLXPVFRUHDV
LQGLFDWLRQVRIVXEFOLQLFDODWKHURVFOHURVLV0D\R&OLQ3URF
 $UUHEROD0RUHQR$//DFODXVWUD0.DVNL-&1RQLQYDVLYHDVVHVVPHQWRIHQGRWKHOLDOIXQFWLRQLQFOLQLFDOSUDFWLFH
5HY(VS&DUGLRO (QJO   
 9DOOEUDFKW,VUDQJ .% 0RUJXHW $ 6FKZLPPEHFN 3/ &RUUHODWLRQ RI HSLFDUGLDO DQG V\VWHPLF RZPHGLDWHG
YDVRGLODWLRQLQSDWLHQWVZLWKDW\SLFDODQJLQDEXWQRHYLGHQFHRIDWKHURVFOHURWLFGLVHDVH&DQ-&DUGLRO

 1DND..3DSDWKDQDVVLRX.%HFKOLRXOLV$HWDO5RVLJOLWD]RQHLPSURYHVHQGRWKHOLDOIXQFWLRQLQSDWLHQWVZLWKW\SH
GLDEHWHVWUHDWHGZLWKLQVXOLQ'LDE9DVF'LV5HV
 /XVFKHU7)7DGGHL6.DVNL-&HWDO9DVFXODUHIIHFWVDQGVDIHW\RIGDOFHWUDSLELQSDWLHQWVZLWKRUDWULVNRIFRURQDU\
KHDUWGLVHDVHWKHGDO9(66(/UDQGRPL]HGFOLQLFDOWULDO(XU+HDUW-
 0RHUWO'+DPPHU$6WHLQHU6HWDO'RVHGHSHQGHQWHIIHFWVRIRPHJDSRO\XQVDWXUDWHGIDWW\DFLGVRQV\VWROLF
OHIWYHQWULFXODUIXQFWLRQHQGRWKHOLDOIXQFWLRQDQGPDUNHUVRILQDPPDWLRQLQFKURQLFKHDUWIDLOXUHRIQRQLVFKHPLF
RULJLQDGRXEOHEOLQGSODFHERFRQWUROOHGDUPVWXG\$P+HDUW-H
 6KHFKWHU 0 ,VVDFKDU$ 0DUDL , HW DO /RQJWHUP DVVRFLDWLRQ RI EUDFKLDO DUWHU\ RZPHGLDWHG YDVRGLODWLRQ DQG
FDUGLRYDVFXODUHYHQWVLQPLGGOHDJHGVXEMHFWVZLWKQRDSSDUHQWKHDUWGLVHDVH,QW-&DUGLRO
 6KHFKWHU00DWHW]N\6$UDG0HWDO9DVFXODUHQGRWKHOLDOIXQFWLRQSUHGLFWVPRUWDOLW\ULVNLQSDWLHQWVZLWKDGYDQFHG


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

LVFKDHPLFFKURQLFKHDUWIDLOXUH(XU-+HDUW)DLO
 5RVVL 5 1X]]R$ 2ULJOLDQL * HW DO 3URJQRVWLF UROH RI RZPHGLDWHG GLODWLRQ DQG FDUGLDF ULVN IDFWRUV LQ SRVW
PHQRSDXVDOZRPHQ-$P&ROO&DUGLRO
 Fischer D, Rossa S, Landmesser U, et al. Endothelial dysfunction in patients with chronic heart failure is independently
DVVRFLDWHGZLWKLQFUHDVHGLQFLGHQFHRIKRVSLWDOL]DWLRQFDUGLDFWUDQVSODQWDWLRQRUGHDWK(XU+HDUW-
 1DJKDYL0)DON(+HFKW+6HWDO)URPYXOQHUDEOHSODTXHWRYXOQHUDEOHSDWLHQW3DUW,,,([HFXWLYHVXPPDU\
RIWKH6FUHHQLQJIRU+HDUW$WWDFN3UHYHQWLRQDQG(GXFDWLRQ 6+$3( 7DVN)RUFHUHSRUW$P-&DUGLRO
++
 *DXVV6$FKHQEDFK63HGHUHU7HWDO$VVHVVPHQWRIFRURQDU\DUWHU\UHPRGHOOLQJE\GXDOVRXUFH&7DKHDGWR
head comparison with intravascular ultrasound. Heart. 97: 991-7.
71. .DVKLZDJL 0 7DQDND$ .LWDEDWD + HW DO )HDVLELOLW\ RI QRQLQYDVLYH DVVHVVPHQW RI WKLQFDS EURDWKHURPD E\
PXOWLGHWHFWRUFRPSXWHGWRPRJUDSK\-$&&&DUGLRYDVF,PDJLQJ
 0DXURYLFK+RUYDW 3 +RIIPDQQ 8 9RUSDKO 0 HW DO 7KH QDSNLQULQJ VLJQ &7 VLJQDWXUH RI KLJKULVN FRURQDU\
SODTXHV"-$&&&DUGLRYDVF,PDJLQJ
 YDQ9HO]HQ-(GH*UDDI)5GH*UDDI0$HWDO&RPSUHKHQVLYHDVVHVVPHQWRIVSRWW\FDOFLFDWLRQVRQFRPSXWHG
tomography angiography: comparison to plaque characteristics on intravascular ultrasound with radiofrequency
EDFNVFDWWHUDQDO\VLV-1XFO&DUGLRO
 1HHIMHV /$ 'KDUDPSDO$6 5RVVL$ HW DO ,PDJH TXDOLW\ DQG UDGLDWLRQ H[SRVXUH XVLQJ GLIIHUHQW ORZGRVH VFDQ
SURWRFROVLQGXDOVRXUFH&7FRURQDU\DQJLRJUDSK\UDQGRPL]HGVWXG\5DGLRORJ\
 von Ballmoos MW, Haring B, Juillerat P, et al. Meta-analysis: diagnostic performance of low-radiation-dose coronary
FRPSXWHGWRPRJUDSK\DQJLRJUDSK\$QQ,QWHUQ0HG


&$378/2

BIOPSIA ENDOMIOCRDICA
PROCEDIMIENTO DIAGNSTICO O DE INVESTIGACIN?

JULIN GONZLEZ, GUSTAVO RISSO, FRANCISCO AZZATO, JOS MILEI

Dedicado a mi mentor, Victor J. Ferrans, un pionero en este tema.


JM

INTRODUCCIN alternativa muy interesante a la BEM, aunque algunos


DXWRUHVVXJLHUHQTXHSXHGHQVHUFRPSOHPHQWDULRV>@
La indicacin rutinaria de la biopsia endomiocrdica En este captulo vamos a revisar la evidencia ms
%(0  HQ OD PLRFDUGLWLV KD VLGR SRU ODUJR WLHPSR relevante de la utilidad clnica de la BEM y las tcni-
\ VLJXH VLHQGR WHPD GH GHEDWH >@$ SHVDU GH TXH cas complementarias en desarrollo.
siempre se la consider el nico mtodo para el diag-
QyVWLFRGHFHUWH]DGHODPLRFDUGLWLVVXEDMDVHQVLELOL-
dad, disponibilidad, su alto costo y riesgos inherentes ASPECTOS TCNICOS DE LA
han llevado a muchos profesionales a evitar su utili- BIOPSIA ENDOMIOCRDICA Y SUS
zacin. Sin embargo, la BEM contina siendo consi- COMPLICACIONES
derada como el gold standard para el diagnstico
GHPLRFDUGLWLV>@ (OSULPHUPpWRGRSDUDREWHQHUPXHVWUDVGHWHMLGRGHO
'HVGHVXLQWURGXFFLyQHQODGpFDGDGHSRU6D- FRUD]yQIXHSURSXHVWRHQORVDxRVSRU9LP\6LO-
NDNLEDUD\.RQQRVHKDQLQWURGXFLGRPXFKDVPHMRUDV YHUPDQ\FRQVLVWtDHQHOXVRGHXQDDJXMDLQWURGXFLGDD
en la tcnica y se han hecho progresos en el anlisis de travs de una toracotoma limitada. La alta incidencia
las muestras. La introduccin de los criterios de Dallas GHQHXPRWyUD[\HOWDSRQDPLHQWRFDUGtDFRKL]RTXHHVWD
>@HQIXHHOSULPHUHVIXHU]RSDUDKDFHUTXHHO WpFQLFDQRIXHUDDFHSWDGD>@)XHHQTXHSRUSUL-
diagnstico histolgico sea ms consistente, pero tienen PHUDYH]6DNDNLEDUD\.RQQRLQIRUPDURQVXWpFQLFDGH
XQDPX\EDMDVHQVLELOLGDG\HVFDVRYDORUSURQyVWLFRHQ BEM introduciendo el biotomo con el que se obtenan
ORVHVWXGLRVFOtQLFRVUHDOL]DGRVKDVWDDKRUD>@ PXHVWUDV GHO HQGRFDUGLR >@ 'HVGH HQWRQFHV VH KDQ
El uso de las tcnicas de inmunohistoqumica LQWURGXFLGRQXPHURVDVPHMRUDVWpFQLFDVHQHOELRWRPR
SDUDLGHQWLFDUPHMRUDODVFpOXODVPRQRQXFOHDUHVLQ- HQ WpUPLQRV GH H[LELOLGDG \ FDSDFLGDG GH PDQLREUD
OWUDQWHVGHOWHMLGRPLRFiUGLFRPHMRUyVLJQLFDWLYD- haciendo el procedimiento ms seguro y fcil.
PHQWHODVHQVLELOLGDGGHOGLDJQyVWLFRKLVWROyJLFR> La posibilidad de acceso a travs de una vena pe-
@$GHPiVODLQWURGXFFLyQGHODUHDFFLyQHQFDGHQD rifrica hizo del ventrculo derecho el sitio ms atrac-
GHSROLPHUDVD 3&5 TXHVHDSOLFDDODLVODPLHQWRGH tivo para el muestreo, especialmente el tabique inter-
genomas virales en muestras de BEM, se convirti ventricular, ya que es ms grueso que la pared libre
en una herramienta prometedora. Ambas tcnicas del ventrculo derecho y se encuentra en el camino
demostraron tener valor pronstico en algunos estu- QDWXUDOGHOXMRGHODVDQJUH>@'HWRGRVPRGRV
dios, pero los resultados no han sido consistentes en si fuera necesario, el ventrculo izquierdo puede ser
todas las publicaciones. alcanzado a travs de la arteria femoral atravesando
El desarrollo de mtodos no invasivos para evaluar ODYiOYXODDyUWLFD>@
GDxRPLRFiUGLFRHQODPLRFDUGLWLVHVSHFLDOPHQWHHOXVR De acuerdo con las actuales recomendaciones de
GHODUHVRQDQFLDPDJQpWLFDQXFOHDU 501 RIUHFHXQD la Sociedad Internacional de Trasplante de Corazn y


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

3XOPyQ>@OD$PHULFDQ+HDUW$VVRFLDWLRQ$PHUL- DWULEXLEOHVDODVSHUIRUDFLRQHV  (OLQIRUPHGH-


can College of Cardiology y la Sociedad Europea de WDOODGRVHUHVXPHHQOD7DEOD
&DUGLRORJtD>@SDUDHYLWDUDUWHIDFWRVGHEDQGDGHFRQ-
WUDFFLyQXQPtQLPRGHPXHVWUDVGHPP de RECOMENDACIONES ACTUALES
WDPDxRGHEHQVHUREWHQLGDVDWHPSHUDWXUDDPELHQWH PARA EL USO DE LA BIOPSIA
Se pueden obtener muestras adicionales si se requie- ENDOMIOCRDICA
ren procedimientos especiales como inmunohistoqu-
PLFD ,+4 PLFURVFRStDHOHFWUyQLFD\R3&5 En un esfuerzo por estandarizar las indicaciones clnicas
Las complicaciones de la BEM se han estudia- GHOD%(0XQFRPLWpGHH[SHUWRVGHOD$PHULFDQ+HDUW
GR GH IRUPD SURVSHFWLYD SRU 'HFNHUVet al >@ HQ Association, el American College of Cardiology y la
SURFHGLPLHQWRVFRQVHFXWLYRV/DWDVDJOREDOGH European Society of Cardiology desarrollaron un docu-
FRPSOLFDFLRQHVIXHGHOHOHQUHODFLyQFRQ PHQWRGHFRQVHQVRHQHVFHQDULRVFOtQLFRVFRQGLVWLQ-
LQVHUFLyQ GH OD YDLQD \ HO  HQ UHODFLyQ FRQ HO WRVQLYHOHVGHUHFRPHQGDFLyQSDUDHOXVRGHOD%(0>@
procedimiento de la biopsia en s mismo. La perfora- 'HEHGHVWDFDUVHTXHGHORVHVFHQDULRVVyORWLHQHQ
FLyQVHREVHUYyHQSDFLHQWHV  FRQPXHUWHV recomendacin grado I, pero slo con nivel de evidencia
B. No hay ninguna recomendacin que tenga nivel de
HYLGHQFLD$(QOD7DEODVHUHVXPHQHVWRVHVFHQD-
Tabla 3.1 Complicaciones de la BEM (Deckers et al. [15])
rios, la utilidad de la BEM, el grado de recomendacin y
Relacionadas con la Insercin del catter = 15 (2.7%) el nivel de evidencia que sustenta dicha recomendacin.
Puncin de la arteria durante la anestesia local $9DXULFXORYHQWULFXODU'$9''LVSODVLD$UULW-
= 12 (2%) PRJpQLFDGHO9HQWUtFXOR'HUHFKR5015HVRQDQFLD
Reaccin vasovagal = 2 (0.4%)
PDJQpWLFD 1XFOHDU 0&3' 0LRFDUGLRSDWtD 'LODWD-
Sangrado prolongado luego de la remocin del
catter = 1 (0.2%) GD 0&* 0LRFDUGLWLV GH &pOXODV *LJDQWHV +/$
$QWtJHQR+XPDQROHXFRFLWDULR0&+0LRFDUGLRSD-
Procedimiento de la toma de biopsia = 18 (3.3%)
Arritmias = 6 (1.1%) WtD +LSHUWUyFD 0+ 0LRFDUGLWLV SRU +LSHUVHQVLEL-
Anomalas de Conduccin = 5 (1%) OLGDG 0(1 0LRFDUGLWLV (RVLQRItOLFD 1HFURWL]DQWH
Dolor sin Perforacin = 4 (0.7%) ME, Microscopa Electrnica.
Perforacin = 3(0.5%), 2 pacientes murieron
(0.3%)

Tabla 3.2 Recomendaciones para el Uso Clnico de la BEM [2].

Grado de Nivel de
N Escenario Clnico Utilidad de la BEM
recom. evid.
Nueva aparicin de insuciencia cardaca Distinguir entre miocarditis linfoctica
<2 semanas de duracin asociado con un (buen pronstico) y MCG o MEN que
1 I B
ventrculo izquierdo de tamao normal o requieren tratamiento
dilatado y compromiso hemodinmico. inmunosupresor.
Nueva aparicin de insuciencia cardaca de
2 semanas a 3 meses de duracin, asociado
con ventrculo izquierdo dilatado y nueva Distinguir entre miocarditis linfoctica
2 aparicin arritmias ventriculares, bloqueo (buen pronstico) y MCG o MEN que I B
AV de segundo o tercer grado, o la falta de requieren tratamiento inmunosupresor.
respuesta al tratamiento habitual dentro de 1
a 2 semanas.
Insuciencia cardaca de duracin > 3 meses
La sarcoidosis cardaca es un diagnstico
asociado con ventrculo izquierdo dilatado y
diferencial especial en este contexto, ya
de nueva aparicin, arritmias ventriculares,
3 que responde muy bien al tratamiento IIa C
bloqueo AV de segundo o tercer grado, o
con corticosteroides. La MCG es tambin
la falta de respuesta al tratamiento habitual
una posibilidad en este escenario.
dentro de 1 a 2 semanas.
Insuciencia cardaca asociada con
Detectar MH, suspender la medicacin
MCPD de cualquier duracin, asociado
4 causante y empezar altas dosis de IIa C
con sospecha de reaccin alrgica y / o
corticosteroides.
eosinolia.


CAPTULO 3 Biopsia Endomiocrdica procedimiento diagnstico o de investigacin?

Grado de Nivel de
N Escenario Clnico Utilidad de la BEM
recom. evid.
Aunque la toxicidad por antraciclina se
puede detectar por medio de pruebas
La insuciencia cardaca asociada con no invasivas, la BEM tiene mejor
5 IIa C
sospecha de miocardiopata por antraciclina sensibilidad para detectar las etapas
tempranas y suspender el frmaco antes.
Requiere ME.
Aunque se ha hecho un gran progreso
en el uso de pruebas no invasivas
tales como RMN en la evaluacin de
Insuciencia cardaca asociada a
6 la cardiomiopata restrictiva, la BEM IIa C
miocardiopata restrictiva no explicada
sigue siendo la nica herramienta de
diagnstico denitivo para muchas de las
patologas causantes.
Cuando el diagnstico no puede realizarse
por otros mtodos. No se recomienda
7 Sospecha de tumores cardacos IIa C
en los mixomas auriculares tpicos por el
riesgo de provocar embolias.
8 Miocardiopatas inexplicables en nios Diagnstico diferencial IIa C
Nueva aparicin de insuciencia cardiaca de 2
semanas a 3 meses de duracin asociado con
Pocas veces la MCG se puede
un ventrculo izquierdo dilatado, sin arritmias
9 diagnosticar en este contexto. La BEM no IIb B
ventriculares de nueva aparicin o bloqueo AV
se debe realizar de forma rutinaria.
de segundo o tercer grado, que responde a la
teraputica habitual dentro de 1 a 2 semanas
En ensayos clnicos recientes los
Insuciencia cardaca de duracin > 3
pacientes que muestran una mayor
meses asociado con un ventrculo izquierdo
expresin de molculas HLA en la BEM
dilatado, sin arritmias ventriculares nuevas o
10 han tenido algn benecio de la terapia IIb C
bloqueo AV de segundo o tercer grado, que
inmunosupresora. La hemocromatosis
responde a la teraputica habitual dentro de
puede ser un diagnstico diferencial en
1 a 2 semanas
este contexto.
Algunas entidades, especialmente las
Insuciencia cardaca asociada a MCPD no enfermedades inltrativas, pueden ser
11 IIb C
explicada diagnosticadas mediante BEM (Pompe,
Fabry, amiloidosis, etc).
Generalmente no ser requiere, ya que la
12 Sospecha de DAVD IIb C
RMN establece el diagstico
Generalmente muestra hallazgos
13 Arritmias ventriculares no explicadas IIb C
inespeccos.
14 Fibrilacin auricular no explicada No se recomienda III C

CUADRO ANATOMOPATOLGICO LA MIOCARDITIS LINFOCTICA


DE LOS DISTINTOS TIPOS DE El cuadro patolgico de la miocarditis linfoctica
MIOCARDITIS HV OD LQOWUDFLyQ GHO PLRFDUGLR SRU OLQIRFLWRV 7 DF-
tivados, con o sin signos de lesin de los miocitos,
Vamos a describir brevemente las caractersticas pa- como se ilustra en la muestra de BEM de un paciente
tolgicas de las principales patologas citadas en este FRQ PLRFDUGLWLV SRU FLWRPHJDORYLUXV &09  TXH VH
captulo, que constituyen el diagnstico diferencial PXHVWUDHQODV)LJXUDV/D)LJXUDWDP-
de la miocarditis linfoctica: bin muestra las inclusiones nucleares caractersticas
PLRFDUGLWLVOLQIRFtWLFD de la infeccin por CMV. Los hallazgos histolgicos
PLRFDUGLWLVGHFpOXODVJLJDQWHV son generalmente difusos, pero pueden ser de natu-
VDUFRLGRVLV UDOH]D IRFDO )LJXUD   VLHQGR QHFHVDULRV SDUD OD
PLRFDUGLWLVSRUKLSHUVHQVLELOLGDG H[DFWLWXGGHOGLDJQyVWLFRODWRPDGHP~OWLSOHVPXHV-
PLRFDUGLWLVHRVLQRItOLFD tras y el uso de la inmunohistoqumica.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 3.4 Miocarditis focal. La inamacin es muy focal.


Ntese que los miocitos necrticos estn inltrados por
linfocitos T. Tcnica de la inmunoperoxidasa. 400X.
Figura 3.1 Miocarditis. La biopsia endomiocrdica mues-
tra una inltracin difusa de linfocitos y dao miocrdico.
H-E. 100 X.
Tabla 3.3 Criterios de Dallas para el diagnstico de miocarditis

Primera biopsia
Miocarditis activa, con o sin brosis
Miocarditis limtrofe
Sin miocarditis
Biopsia subsiguiente
Miocarditis persistente, con o sin brosis
Miocarditis en resolucin, con o sin brosis
Miocarditis curada, con o sin brosis

&RQHOQGHHVWDQGDUL]DUPHMRUGLDJQyVWLFRKLV-
WROyJLFRVHGHVDUUROODURQORVFULWHULRVGH'DOODV 7D-
EOD SDUDODSULPHUDELRSVLDV\VXEVLJXLHQWHV/D
Figura 3.2 Miocarditis. Mismo que el ilustrado en la gura
PLRFDUGLWLVDFWLYDVHGHQHFRPRODSUHVHQFLDGHOLQ-
3.1. Es evidente el denso inltrado de linfocitos T y la necrosis IRFLWRVLQOWUDQWHVHQHOPLRFDUGLRPiVODHYLGHQFLD
de los miocitos. Tcnica de la inmunoperoxidasa. 400X. GHOHVLyQGHORVPLRFLWRV H[FOX\HQGRODVEDQGDVGH
contraccin, un artefacto comn en las muestras de
PLFURVFRStDHOHFWUyQLFD /DPLRFDUGLWLVOLPtWURIHVH
GHQHFRPRLQOWUDGRVOHYHVVLQHYLGHQFLDGHOHVLyQ
del miocito.
Para biopsias posteriores, se crearon las catego-
ras de miocarditis persistente, la miocarditis en re-
VROXFLyQ\PLRFDUGLWLVFXUDGD )LJXUD DFRUGHD
ODSUHVHQFLDGHLQOWUDGRVLJXDOHVTXHHQODSULPHUD
ELRSVLD LQOWUDGRV PHQRUHV R GHVDSDULFLyQ GH ORV
mismos, respectivamente.

LA MIOCARDITIS DE CLULAS GIGANTES


(MCG)
(VWDIRUPDHVSHFtFDGHPLRFDUGLWLVGHRULJHQGHV-
conocido es particularmente agresiva con una alta
Figura 3.3 Miocarditis. La biopsia corresponde al caso ilus- PRUWDOLGDG 3UHVHQWD H[WHQVDV iUHDV GH QHFURVLV GH
trado en las Figuras 3.1 y 3.2. Miocarditis linfoctica por
infeccin de citomegalovirus. Observese el tpico aspecto
PLRFLWRVFRQXQLQWHQVRLQOWUDGRGHOLQIRFLWRVFp-
de ojo de lechuza como inclusiones nucleares (echas). OXODVSODVPiWLFDV\HRVLQyORV/DFDUDFWHUtVWLFDPiV
H-E. 400X. llamativa, que da nombre a la enfermedad, es la pre-


CAPTULO 3 Biopsia Endomiocrdica procedimiento diagnstico o de investigacin?

Figura 3.5 Miocarditis curada. El inltrado linfocitario es nulo.


Obsrvese la atroa en algunos miocitos aislados. H-E 200X. Figura 3.6 Miocarditis de clulas gigantes. Denso inltrado de
linfocitos y clulas gigantes prominentes. Ntese la ausencia
de granulomas bien establecidos. H-E 200X.

sencia de clulas gigantes multinucleadas en los bor-


GHVGHODViUHDVQHFUyWLFDV )LJXUD HVWDVFpOXODV
se originan a partir de los macrfagos. Las clulas
PiV DEXQGDQWHV HQ ORV LQOWUDGRV VRQ ORV OLQIRFLWRV
7&'.
El diagnstico diferencial principal de MCG es la
sarcoidosis, la cual se diferencia por:
/RVHRVLQyORVVRQDEXQGDQWHVHQ0&*SHURHVWiQ
ausentes en la sarcoidosis.
/DEURVLVFLFDWUL]DOHVPiVSURPLQHQWHHQODVDU-
coidosis.
(QOD0&*QRVHREVHUYDQJUDQXORPDV
 /D VDUFRLGRVLV SXHGH DIHFWDU HO SHULFDUGLR QXQFD
comprometido en la MCG.

SARCOIDOSIS Figura 3.7 Sarcoidosis. La biopsia endomiocrdica muestra un


La sarcoidosis es una enfermedad sistmica que pue- granuloma sin necrosis bien establecido. Las clulas gigantes
son evidentes. H-E 200X.
de afectar el miocardio. La presencia de granulomas
HQ ODV %(0 SXHGHQ OOHJDU DO  GH ORV FDVRV (O
compromiso es parcelar y la BEM puede ser negativa.
/RVJUDQXORPDVQRFDVHLFDQWHVTXHFRQVLVWHQWHQHQ crfagos y clulas plasmticas, con un predominio
histiocitos, clulas gigantes, linfocitos y clulas plas- GHHRVLQyORVSXHGHYHUVHLQMXULDGHPLRFLWRVSHUR
mticas, son la caracterstica ms prominente de la HVXQDFDUDFWHUtVWLFDSRFRIUHFXHQWH/DEURVLVHVWD
HQIHUPHGDG /RV LQOWUDGRV IRFDOHV GH OLQIRFLWRV VH ausente.
YHQSHURFDUHFHQGHORVHRVLQyORVREVHUYDGRVHQOD
0&*/DEURVLVHVWDPELpQXQKDOOD]JRIUHFXHQWH LA MIOCARDITIS EOSINOFLICA
)LJXUD  (VWD PLRFDUGLWLV SXHGH HVWDU SUHVHQWH HQ HO  GH
los pacientes con sndrome hipereosinoflico. Se ob-
MIOCARDITIS POR HIPERSENSIBILIDAD VHUYD XQ H[WHQVR LQOWUDGR GH  HRVLQyORV )LJXUD
Aunque no es muy comn, la hipersensibilidad a fr-  'RVFDUDFWHUtVWLFDVD\XGDQDGLVWLQJXLUODGHOD
macos puede comprometer el miocardio. La sospe- miocarditis por hipersensibilidad: la presencia de ne-
cha de esta entidad debe surgir cuando un paciente crosis de los miocardiocitos y la presencia de trom-
VH SUHVHQWD FRQ LQVXFLHQFLD FDUGtDFD DJXGD HQ HO ERV LQWUDFDYLWDULRV FRQ DEXQGDQWHV HRVLQyORV TXH
FRQWH[WR GH XQD UHDFFLyQ GH KLSHUVHQVLELOLGDG D XQ pueden observarse incluso en los vasos coronarios
IiUPDFR (Q ODV PXHVWUDV GH WHMLGRV VH REVHUYD XQ epicrdicos.
LQOWUDGR SHULYDVFXODU FUyQLFR FRQ OLQIRFLWRV PD-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

7ULDO VHUHTXHUtDXQD%(0SRVLWLYDGHDFXHUGRDORV
FULWHULRVGH'DOODVFRPRFULWHULRGHLQOFXVLyQ VyORHO
GHORVGLDJQyVWLFRVIXHFRQUPDGRSRUHOSDQHO
GH SDWyORJRV H[SHUWRV >@ (Q RWUR HVWXGLR GRQGH 
SDWyORJRV H[SHUWRV H[DPLQDURQ ODV %(0V GH  SD-
FLHQWHVFRQPLRFDUGLRSDWtDGLODWDGD 0&3' ODLQWHU-
pretacin de las mismas vari considerablemente. Se
hizo el diagnstico de miocarditis en 11 pacientes por
ORPHQRVSRUXQSDWyORJR6yORHQSDFLHQWHVSDWy-
ORJRVFRLQFLGLHURQHQHOGLDJQyVWLFRHQFRLQFLGLHURQ
PRVWUDQGRTXHD~QSDUDORVSDWyORJRVH[SHUWRVOD
LQWHUSUHWDFLyQGHODV%(0VHVPX\YDULDEOH>@
Algunos investigadores han demostrado que en
pacientes con cuadros sugestivos de miocarditis la
Figura 3.8 Hipereosinolia. El inltrado intersticial de leuco-
citos eosinlos es sugestivo de miocarditis por hipersensibi- BEM era negativa segn los criterios de Dallas pero
lidad. H-E 200X. la PCR era positiva para genomas virales. Martin et
alHVWXGLDURQQLxRVFRQSUHVHQWDFLyQFOtQLFDVX-
JHVWLYDGHPLRFDUGLWLVGHODVPXHVWUDVIXHURQ
EL ROL DE LA BIOPSIA SRVLWLYDVSDUDJHQRPDVYLUDOHVSHURVyORGHODV
ENDOMIOCARDICA EN EL MANEJO  IXHURQSRVLWLYDVVHJ~QORVFULWHULRVGH'DOODV
DE LA MIOCARDITIS >@3DXVFKLQJHUet alKDOODURQTXHHQGHSD-
cientes con MCPD idioptica, todos ellos negativos
La BEM an es considerada como el gold standard segn los criterios de Dallas, la PCR result positiva
para el diagstico de la miocarditis viral. El uso de SDUDJHQRPDVYLUDOHV>@(QRWURHVWXGLR3DXVFKLQ-
los criterios de Dallas, aunque discutido, contina ger et al. demostraron una PCR positiva para genoma
VLHQGRXQLYHUVDO(OGHVDUUROORGHOD,+4\OD3&5D GHHQWHURYLUXVHQSDFLHQWHVFRQ0&3'LGLRSiWLFD
PHMRUDGRVXVHQVLELOLGDG\HVSHFLFLGDG VyORSUHVHQWDEDQ%(0SRVLWLYDVHJ~QORVFULWHULRV
GH'DOODV>@:K\et alPRVWUDURQHQSDFLHQ-
VALIDEZ DE LOS CRITERIOS DE DALLAS tes con MCPD que la PCR para genomas de enterovi-
La mayora de los estudios clnicos sobre miocardi- UXVHUDSRVLWLYDHQFDVRVSHURVyORSUHVHQWDEDQ
tis realizados desde entonces utilizan los criterios de FULWHULRVGH'DOODVSRVLWLYRVHQVXV%(0V>@
'DOODVFRPRFULWHULRVGHLQFOXVLyQUHHMDQGRHODOWR Los criterios de Dallas tambin han demostrado
valor que se les asigna como herramienta diagnstica carecer de valor pronstico. Grogan et al. compar la
>@/DSULQFLSDODTXH]DGHORVFULWHULRVGH'DOODV HYROXFLyQFOtQLFDHQSDFLHQWHVFRQPLRFDUGLWLV\
HVVXEDMDVHQVLELOLGDG FHUFDQDDO SDUDGHWHFWDU SDFLHQWHVFRQ0&3'LGLRSiWLFD/DSUHVHQFLDGH
LQOWUDGRVHQODVPXHVWUDVSULQFLSDOPHQWHGHELGRD miocarditis segn los criterios de Dallas no afect el
 ODQDWXUDOH]DSDUFKHDGDGHOSURFHVRKDFLHQGRTXH SURQyVWLFR>@$QJHOLQLet al. realiz el seguimiento
el error en el muestreo sea un asunto de importancia, FOtQLFR GH  SDFLHQWHV FRQ PLRFDUGLWLV FRQUPDGD
 ODIDOWDGHFRQVLVWHQFLDHQODLQWHUSUHWDFLyQGHODV SRUELRSVLDFRQPLRFDUGLWLVDFWLYD\FRQPLR-
PXHVWUDVLQFOXVRHQPDQRVGHSDWyORJRVH[SHUWRV carditis limtrofe, tambin de acuerdo a criterios de
El error de muestreo es comentado por muchos 'DOODV /D DSDULFLyQ GH LQVXFLHQFLD FDUGLDFD IXH
HVSHFLDOLVWDV&KRZDQG+DXFNSXEOLFDURQXQDQDOLVLV ms frecuente en el grupo de miocarditis limtrofe
de BEMs post-mortem, donde demostr que la sensi- que en el grupo de miocarditis activa, concluyendo
ELOLGDGGHXQD~QLFDPXHVWUDSDUDODGHWHFFLyQGHLQO- que la presencia de necrosis miocitaria no acarrea
WUDGRVHVGHOVLHQGRQHFHVDULDVPXHVWUDVSDUD YDORU SURQyVWLFR >@ &DIRULR et al HVWXGLDURQ 
DOFDQ]DU XQD VHQVLELOLGDG GHO  > @ 6H KDQ SDFLHQWHVFRQPLRFDUGLWLVDFWLYD Q  \PLRFDU-
SXEOLFDGRH[SHULHQFLDVVLPLODUHVFRQHOXVRGH%(0 GLWLVOLPtWURIH Q  /OHJDURQDODFRQFOXVLyQTXH
SDUDHOGLDJQyVWLFRGHUHFKD]RGHDORLQMHUWRV>@ HOXVRGH,+4DSRUWDXQDPD\RUVHQVLELOLGDGSDUDHO
Por otra parte, la falta de concordancia entre los diagnstico de la miocarditis y que los criterios de
observadores en la interpretacin de las muestras, co- 'DOODVFDUHFHQGHYDORUSURQyVWLFR>@.LQGHUPDQQ
rrobora que los criterios de Dallas no han alcanzado et alVLJXLHURQFOtQLFDPHQWHDSDFLHQWHVFRQVRV-
FRPSOHWDPHQWHVXVREMHWLYRV(VGHVWDFDEOHTXHGHORV pecha clnica de miocarditis en quienes realizaron
111 pacientes enrolados en el Myocarditis Treatment una BEM. Los criterios de Dallas fueron positivos


CAPTULO 3 Biopsia Endomiocrdica procedimiento diagnstico o de investigacin?

VyOR HQ  SDFLHQWHV   SHUR OD VHQVLELOLGDG VH WRJUDGRGHPLRFDUGLWLV>@/DWpFQLFDKDGHPRVWUDGR
LQFUHPHQWyHOXVRGHOD,+4TXHPRVWUyLQDPDFLyQ ser til para el diagnstico de miocarditis como causa
en 91 pacientes. Este estudio tambin demostr falta GHPXHUWHV~ELWD )LJXUD >@
GHYDORUSURQyVWLFRGHORVFULWHULRVGH'DOODV>@ 'HVSXpV GH HVWRV WUDEDMRV VH KDQ GHVDUUROODGR
Por otra parte, los criterios de Dallas no mostra- nuevos marcadores, anticuerpos y el diagnostico
ron valor predictivo para seleccionar a los pacientes GHPLRFDUGLWLVPHGLDQWH,+4VHKDYXHOWRPiVVR-
para la terapia inmunosupresora. Los ensayos clni- VWLFDGR .KO et al HVWXGLDURQ ODV %(0V GH 
cos que utilizaron tratamiento inmunosupresor para pacientes con MCPD, sin antecedentes de enfer-
OD PLRFDUGLWLV QR PRVWUDURQ HQ JHQHUDO XQ PHMRU medad viral anterior. Las BEMs se realizaron y se
resultado en los pacientes que recibieron tratamiento procesaron para H & E para determinar la presencia
en comparacin con aquellos que recibieron placebo, de miocarditis de acuerdo con criterios de Dallas,
DSHVDUGHTXHFLHUWRVSDFLHQWHVPHMRUDURQQRWDEOH- y para inmunohistoqumica utilizando anticuerpos
mente su funcin ventricular izquierda despus del SDUD&'5$&'&'&'&'&'5\
tratamiento. Los criterios de Dallas no lograron pre-
GHFLUTXpSDFLHQWHVLEDQDPHMRUDU>@
La necesidad de adoptar nuevos criterios para
hacer el diagnstico histopatolgico ha sido procla-
mada por numerosos autores, pero como se observa
en los estudios citados, los criterios de Dallas siguen
siendo actualmente el gold standard para el diag-
QyVWLFR GH PLRFDUGLWLV PHMRUDQGR VX UHQGLPLHQWR
FRQODDGLFLyQGHOD,+4

EL ROL DE LA INMUNOHISTOQUMICA
El principal problema con el diagnstico histopatol-
gico de miocarditis en muestras tratadas con tcnica
de rutina es la diferenciacin entre los linfocitos in-
tersticiales y otros tipos de clulas, principalmente
EUREODVWRVHKLVWLRFLWRV
Schnitt et alSXEOLFDURQXQWUDEDMRSLRQHURHQ
Figura 3.9 Miocarditis difusa en un nio de 6 aos de edad,
BEMs consecutivas evaluadas por dos observado- hallado muerto bajo el agua en una piscina. Extenso dao
UHV LQGHSHQGLHQWHV >@ &RQ HO XVR GH XQD WpFQLFD miocrdico y marcado edema intersticial, aposicin de los
GH LQPXQRSHUR[LGDVD SDUD WHxLU HVSHFtFDPHQWH HO linfocitos T sobre el sarcolema de miocitos necrticos. Inmu-
DQWtJHQR FRP~Q OHXFRFLWDULR &/$ DKRUD &'$  noperoxidasa para linfocitos-T. (echas) X200.
KXERXQDFRQFRUGDQFLDLQWHUREVHUYDGRUPHMRUHQOD
LGHQWLFDFLyQGHORVOLQIRFLWRV U  TXHFRQOD
WpFQLFDGHKHPDWR[LOLQDHRVLQD + (  U  /D
FRQFRUGDQFLDLQWUDREVHUYDGRUHQODLGHQWLFDFLyQGH +/$FODVH,6yORHOGHODVPXHVWUDVIXHURQSR-
OLQIRFLWRVFRQ,+4\+ (IXHSREUH U \U  VLWLYDVSDUDFULWHULRVGH'DOODVSHURHOPRVWUy
UHVSHFWLYDPHQWH  tincin positiva para uno o ms de los anticuerpos,
El principal inconveniente de anticuerpos los CLA que muestra una sensibilidad muy superior de la in-
HVTXHWDPELpQWLxHODVFpOXODVFHEDGDV\ORVKLVWLRFL- PXQRKLVWRTXtPLFD SDUD PRVWUDU ORV FDPELRV LQD-
tos. Los investigadores no estudiaron el impacto de la PDWRULRVHQ0&3'>@
WpFQLFDHQHOGLDJQyVWLFRGHPLRFDUGLWLV>@ Feeley et al. mostraron que los anticuerpos anti-
8QRGHQRVRWURV -0 KL]RKLQFDSLpHQXQWUDED- &'5 IXHURQ PX\ SUHFLVRV SDUD HO GLDJQyVWLFR
MRSLRQHURHQHODxRHQHOXVRGHOD,+4SDUD GHODLQDPDFLyQGHOPLRFDUGLRHQXQDVHULHGH
LGHQWLFDU ORV OLQIRFLWRV SDUD HO GLDJQyVWLFR DEOH DXWRSVLDVHQXQKRVSLWDOJHQHUDO/DV~QLFDVPXHV-
de miocarditis en la BEM. Se realiz diagnstico de WUDVTXHPRVWUDURQPiVGH&'5FpOXODVSR-
PLRFDUGLWLV  HQ  SDFLHQWHV GH DFXHUGR FRQ OD WLQ- sitivas por campo de alta potencia pertenecan a pa-
cin de rutina de BEMs. Se analizaron las muestras cientes trasplantados, de los cuales tres presentaban
XWLOL]DQGRDQWLFXHUSRVDQWL&/$FDGHQDVOLJHUDV\ rechazo cardaco y uno un trastorno linfoprolifera-
GHLQPXQRJOREXOLQD\UHFHSWRUGHFpOXODV7 7&5  WLYR>@(QXQHVWXGLRQRGLVHxDGRSDUDHVWXGLDU
6yORGHODVELRSVLDVGHPRVWUDURQWHQHUFLHU- miocarditis, Krous et al. demostraron que la tincin


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

FRQDQWL&' OLQIRFLWRV7 \&' PDFUyIDJRV HV enterovirus. No se hallaron genomas de adenovirus,


til para diferenciar la miocarditis de sndrome de rinovirus, virus de la gripe en este estudio de miocar-
PXHUWHV~ELWDGHOODFWDQWH\ODDV[LDHQODV%(0V GLWLVIDWDO(QHOGHORVSDFLHQWHVHQORVTXHOD
GHORVQLxRV>@&RPRVHLQIRUPyDQWHULRUPHQWH PCR fue positiva para CMV, se revel la presencia
HQQXHVWUDH[SHULHQFLDHOXVRGHOD,+4SHUPLWLyHO de ADN viral en los cardiomiocitos mediante hibri-
diagnstico de miocarditis inaparente como causa dacin in situ. Slo 1 de estos pacientes presentaba
GHPXHUWHV~ELWDHQORVQLxRV>@ inmunocompromiso. A partir de estos resultados se
En la publicacin de Caforio et alOD,+4VHXWL- puede concluir que el hallazgo del genoma del CMV
liz para reforzar los criterios de Dallas. Ms de la en la BEM de pacientes con miocarditis tiene un pro-
mitad de las miocarditis dudosas no se hubieran QyVWLFRGHVIDYRUDEOH>@
GLDJQRVWLFDGRVLQHVWDWpFQLFD>@$OUHVSHFWRWDP- Wilmot et al. tambin demostraron el valor pro-
bin Kindermann et al. demostraron en su estudio QyVWLFRGHOD3&5HQODPLRFDUGLWLVIXOPLQDQWHHQ
TXHVyOR  GHPXHVWUDVIXHURQSRVLWLYDV QLxRV WUDWDGRV FRQ DSR\R FLUFXODWRULR PHFiQLFR 6H
SDUDORVFULWHULRVGH'DOODVPLHQWUDVTXH   UHDOL]y3&5HQSDFLHQWHVTXHIXHSRVLWLYDHQ
IXHURQ SRVLWLYRV PHGLDQWH &' &' \ +/$ GH de ellos. La presencia de genomas virales se asoci
FODVH,,>@ FRQ PXHUWH R QHFHVLGDG GH WUDVSODQWH 3   
Tras el anlisis histolgico, la ausencia de infeccin
EL ROL DE LA REACCIN EN CADENA DE LA YLUDO\GHLQDPDFLyQPLRFiUGLFDVHDVRFLDURQDXQD
POLIMERASA HYROXFLyQIDYRUDEOH YDORUHVGH3\UHV-
$SULFLSLRVGHODGpFDGDGHYDULRVDXWRUHVSX- SHFWLYDPHQWH >@
blicaron series de casos mostrando el aislamiento de Mavrogeni et al. realizaron el seguimiento de una
JHQRPDV YLUDOHV PHGLDQWH 3&5 >@ SHUR HVRV FRKRUWHGHSDFLHQWHVFRQPLRFDUGLWLV(QSDFLHQ-
WUDEDMRV HUDQ PD\RULWDULDPHQWH GHVFULSWLYRV GH OD WHVVHUHDOL]y501FRQKDOOD]JRVSDWROyJLFRV(Q
presencia del genoma de ciertos tipos de virus en pacientes se efectu BEM, presentando genomas de
las BEMs y no evaluaban el valor pronstico o te- SDUYRYLUXV%FODPLGLD\KHUSHVYLUXVHQHOGH
raputico de stos hallazgos. Sin embargo, una d- las muestras. En 7 pacientes con deterioro clnico al
cada despus, la PCR tambin demostr tener valor DxR GH VHJXLPLHQWR OD %(0 PRVWUy SHUVLVWHQFLD GH
SURQyVWLFR>@)UXVWDFLet alWUDWDURQSDFLHQWHV ORVJHQRPDVGHORVDJHQWHVLQIHFFLRVRV>@
FRQPLRFDUGLWLVGHPRVWUDGDSRU%(0HLQVXFLHQ- La PCR se ha realizado en muestras post mortem
cia cardaca progresiva con tratamiento inmunosu- de pacientes con muerte sbita secundaria a miocar-
presor. Se hallaron genomas virales de enterovirus ditis viral, resultando de utilidad diagnstica en algu-
Q   YLUXV (SVWHLQ%DUU Q   DGHQRYLUXV Q   QRVFDVRV>@
DGHQRYLUXV \ HQWHURYLUXV Q   LQXHQ]D $ YLUXV
Q   \ SDUYRYLUXV% Q   HQ  QR UHVSRQ- LA BIOPSIA ENDOMIOCRDICA
GHGRUHV   \ HQ  UHVSRQGHGRUHV WRGRV SR- COMO HERRAMIENTA DE
sitivos para el virus de la hepatitis C. Se hallaron INVESTIGACIN
DXWRDQWLFXHUSRVFDUGtDFRVHQUHVSRQGHGRUHV  
pero no se los hall entre los no respondedores. La El papel de la BEM como herramienta de investigacin
presencia de genomas virales fue un predictor in- no debe ser subestimado. Muchos avances en la com-
dependiente del desarrollo de falla del tratamiento SUHQVLyQ GH OD H[SUHVLyQ JHQpWLFD GHO FRUD]yQ VH KDQ
LQPXQRVXSUHVRUHQPHMRUDUODIXQFLyQVLVWyOLFDGHO realizado gracias a la posibilidad de obtener muestras
YHQWUtFXOR L]TXLHUGR >@3RU HO FRQWUDULR &DPDU- SDUDDQDWRPtDSDWROyJLFDGHOP~VFXORFDUGtDFR>@
go et alGHPRVWUDURQTXHORVQLxRVFRQPLRFDUGLWLV (QHOFDPSRHVSHFtFRGHODPLRFDUGLWLVOD%(0
crnica tienen una respuesta favorable a la terapia SHUPLWLUiLGHQWLFDUPHMRUHVSUHGLFWRUHVGHPRUWDOLGDG
inmunosupresora independientemente de la presen- necesidad de trasplante y la respuesta a ciertos frmacos
FLDGHJHQRPDVYLUDOHVHQOD%(0>@ RHVWUDWHJLDVWHUDSpXWLFDV/D3&5LGHQWLFDUiUiSLGD-
Kyt et al. mostraron en un anlisis retrospectivo mente la presencia del genoma viral y en el futuro, la
GHDXWRSVLDVGHPLRFDUGLWLVIDWDOHVHOKDOOD]JRGH H[SUHVLyQGHFLHUWRVJHQHVGHORVPLRFLWRVVHJXUDPHQWH
cidos nucleicos virales en el corazn de 17 pacien- representar una nueva herramienta pronstica.
WHV   &09  SDFLHQWHV  SDUYRYLUXV % 
SDFLHQWHV  HQWHURYLUXV  SDFLHQWH  \ YLUXV KHUSHV CONCLUSIONES
KXPDQR SDFLHQWH (QSDFLHQWHVHO$'1GHO La BEM es una importante herramienta diagnstica en
&09VHHQFRQWUyMXQWRFRQHOGHSDUYRYLUXV%R la miocarditis, siendo el gold standard para el diag-


CAPTULO 3 Biopsia Endomiocrdica procedimiento diagnstico o de investigacin?

QyVWLFRGHQLWLYR/RVFULWHULRVGH'DOODVDXQTXHVHYH- /DLQWURGXFFLyQGHOD,+4\OD3&5SURSRUFLRQDQQXH-
ramente cuestionados por muchos autores, siguen sien- vas herramientas para la evaluacin de las muestras de
do un mtodo de referencia para realizar el diagnstico, BEM. Aunque todava no estn estandarizadas adecua-
ayudando a distinguir la miocarditis linfoctica de otras damente, han demostrado dar informacin pronstica y
entidades, como miocarditis de clulas gigantes, sarcoi- teraputica valiosa. Pronto sern pruebas de rutina en el
dosis o miocaditis necrotizante eosinoflica, y adems diagnstico de la miocarditis.
guiar el tratamiento y establecer el pronstico.

BIBLIOGRAFA
1. )HUUDQV9-5REHUWV:&0\RFDUGLDOELRSV\DXVHIXOGLDJQRVWLFSURFHGXUHRURQO\DUHVHDUFKWRRO"$P-&DUGLRO

 Cooper LT, Baughman KL, Feldman AM, et al. The Role of Endomyocardial Biopsy in the Management of
&DUGLRYDVFXODU'LVHDVH&LUFXODWLRQ
 $UHW]+%LOOLQJKDP0(GZDUGV:HWDO0\RFDUGLWLVDKLVWRSDWKRORJLFGHQLWLRQDQGFODVVLFDWLRQ$PHULFDQ
-RXUQDORI&DUGLRYDVFXODU3DWKRORJ\
 *URJDQ 0 5HGHOG 00 %DLOH\ .5 HW DO /RQJWHUP RXWFRPH RI SDWLHQWV ZLWK ELRSV\SURYHG P\RFDUGLWLV
&RPSDULVRQZLWKLGLRSDWKLFGLODWHGFDUGLRP\RSDWK\-RXUQDORIWKH$PHULFDQ&ROOHJHRI&DUGLRORJ\
 Angelini A, Crosato M, Boffa GM, et al. Active versus borderline myocarditis: clinicopathological correlates and
SURJQRVWLFLPSOLFDWLRQV+HDUW
 Caforio ALP, Calabrese F, Angelini A, et al. A prospective study of biopsy-proven myocarditis: prognostic relevance
RIFOLQLFDODQGDHWLRSDWKRJHQHWLFIHDWXUHVDWGLDJQRVLV(XURSHDQ+HDUW-RXUQDO
7. Kindermann I, Kindermann M, Kandolf R, et al. Predictors of Outcome in Patients With Suspected Myocarditis.
&LUFXODWLRQ
 Milei J, Bortman G, Fernndez-Alonso G, et al. Immunohistochemical Staining of Lymphocytes for the Reliable
'LDJQRVLVRI0\RFDUGLWLVLQ(QGRP\RFDUGLDO%LRSVLHV&DUGLRORJ\
9. 5HSRUWRIWKH:RUOG+HDOWK2UJDQL]DWLRQ,QWHUQDWLRQDO6RFLHW\DQG)HGHUDWLRQRI&DUGLRORJ\7DVN)RUFHRQWKH
'HQLWLRQDQG&ODVVLFDWLRQRI&DUGLRP\RSDWKLHV&LUFXODWLRQ
 %ODXZHW/$&RRSHU/70\RFDUGLWLV3URJ&DUGLRYDVF'LV
11. Cunningham KS, Veinot JP, Butany J. An approach to endomyocardial biopsy interpretation. Journal of Clinical
3DWKRORJ\
 6DNDNLEDUD6.RQQR6(QGRP\RFDUGLDO%LRSV\-DSDQHVH+HDUW-RXUQDO
 7DNHPXUD*)XMLZDUD++RULNH.HWDO9HQWULFXODUH[SUHVVLRQRIDWULDOQDWULXUHWLFSRO\SHSWLGHDQGLWVUHODWLRQV
with hemodynamics and histology in dilated human hearts. Immunohistochemical study of the endomyocardial
ELRSV\VSHFLPHQV&LUFXODWLRQ
 Billingham M. Pathology of Heart Transplantantion. In: Solez K, Racusen L, Billingham M, editors. Solid Organ
7UDQVSODQW5HMHFWLRQPHFKDQLVPVSDWKRORJ\DQGGLDJQRVLV1HZ<RUN0DUFHO'HNNHU,QF
 'HFNHUV-:+DUH-0%DXJKPDQ./&RPSOLFDWLRQVRIWUDQVYHQRXVULJKWYHQWULFXODUHQGRP\RFDUGLDOELRSV\LQ
DGXOW SDWLHQWV ZLWK FDUGLRP\RSDWK\$ VHYHQ\HDU VXUYH\ RI  FRQVHFXWLYH GLDJQRVWLF SURFHGXUHV LQ D WHUWLDU\
UHIHUUDOFHQWHU-RXUQDORIWKH$PHULFDQ&ROOHJHRI&DUGLRORJ\
 %DXJKPDQ./'LDJQRVLVRI0\RFDUGLWLV&LUFXODWLRQ-DQXDU\  
17. Chow LH, Radio SJ, Sears TD, et al. Insensitivity of right ventricular endomyocardial biopsy in the diagnosis of
P\RFDUGLWLV-RXUQDORIWKH$PHULFDQ&ROOHJHRI&DUGLRORJ\
 +DXFN$.HDUQH\'(GZDUGV:(YDOXDWLRQRISRVWPRUWHPHQGRP\RFDUGLDOELRSV\VSHFLPHQVIURPSDWLHQWV
ZLWKO\PSKRF\WLFP\RFDUGLWLVLPSOLFDWLRQVIRUUROHRIVDPSOLQJHUURU0D\R&OLQLF3URFHHGLQJV
19. Spiegelhalter DJ, Stovin PGI. An analysis of repeated biopsies following cardiac transplantation. Statistics in
0HGLFLQH
 =HUEH 7$UHQD 9 'LDJQRVWLF UHOLDELOLW\ RI HQGRP\RFDUGLDO ELRSV\ IRU DVVHVVPHQW RI FDUGLDF DOORJUDIW UHMHFWLRQ
+XPDQ3DWKRORJ\
 0DVRQ-:2&RQQHOO-%+HUVNRZLW]$HWDO$&OLQLFDO7ULDORI,PPXQRVXSSUHVVLYH7KHUDS\IRU0\RFDUGLWLV
1HZ(QJODQG-RXUQDORI0HGLFLQH
 Shanes JG, Ghali J, Billingham ME, et al. Interobserver variability in the pathologic interpretation of endomyocardial
ELRSV\UHVXOWV&LUFXODWLRQ
 0DUWLQ $% :HEEHU 6 )ULFNHU )- HW DO $FXWH P\RFDUGLWLV 5DSLG GLDJQRVLV E\ 3&5 LQ FKLOGUHQ &LUFXODWLRQ



J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 Pauschinger M, Bowles NE, Fuentes-Garcia FJ, et al. Detection of Adenoviral Genome in the Myocardium of Adult
3DWLHQWV:LWK,GLRSDWKLF/HIW9HQWULFXODU'\VIXQFWLRQ&LUFXODWLRQ
 Pauschinger M, Doerner A, Kuehl U, et al. Enteroviral RNA Replication in the Myocardium of Patients With Left
9HQWULFXODU'\VIXQFWLRQDQG&OLQLFDOO\6XVSHFWHG0\RFDUGLWLV&LUFXODWLRQ
 :K\+-0HDQ\%75LFKDUGVRQ3-HWDO&OLQLFDODQGSURJQRVWLFVLJQLFDQFHRIGHWHFWLRQRIHQWHURYLUDO51$LQWKH
P\RFDUGLXPRISDWLHQWVZLWKP\RFDUGLWLVRUGLODWHGFDUGLRP\RSDWK\&LUFXODWLRQ
 0F1DPDUD'0+ROXENRY56WDUOLQJ5&HWDO&RQWUROOHG7ULDORI,QWUDYHQRXV,PPXQH*OREXOLQLQ5HFHQW2QVHW
'LODWHG&DUGLRP\RSDWK\&LUFXODWLRQ
 6FKQLWW6&LDQR36FKRHQ)4XDQWLWDWLRQRI/\PSKRF\WHVLQ(QGRP\RFDUGLDO%LRSVLHV8VHDQG/LPLWDWLRQVRI
$QWLERGLHVWR/HXFRF\WH&RPPRQ$QWLJHQ+XPDQ3DWKRORJ\
 .KO81RXWVLDV06HHEHUJ%HWDO,PPXQRKLVWRORJLFDOHYLGHQFHIRUDFKURQLFLQWUDP\RFDUGLDOLQDPPDWRU\
SURFHVVLQGLODWHGFDUGLRP\RSDWK\+HDUW
 )HHOH\ .0 +DUULV - 6XYDUQD 6. 1HFURSV\ GLDJQRVLV RI P\RFDUGLWLV D UHWURVSHFWLYH VWXG\ XVLQJ &'52
LPPXQRKLVWRFKHPLVWU\-RXUQDORI&OLQLFDO3DWKRORJ\
 .URXV+))HUDQGRV&0DVRXPL+HWDO0\RFDUGLDO,QDPPDWLRQ&HOOXODU'HDWKDQG9LUDO'HWHFWLRQLQ6XGGHQ
,QIDQW'HDWK&DXVHGE\6,'66XIIRFDWLRQRU0\RFDUGLWLV3HGLDWU5HV
 Forcada P, Beigelman R, Milei J. Inapparent myocarditis and sudden death in pediatrics. Diagnosis by
LPPXQRKLVWRFKHPLFDOVWDLQLQJ,QWHUQDWLRQDO-RXUQDORI&DUGLRORJ\
 Jin O, Sole MJ, Butany JW, et al. Detection of enterovirus RNA in myocardial biopsies from patients with myocarditis
DQGFDUGLRP\RSDWK\XVLQJJHQHDPSOLFDWLRQE\SRO\PHUDVHFKDLQUHDFWLRQ&LUFXODWLRQ
 .RLGH+.LWDXUD<'HJXFKL+HWDO*HQRPLF'HWHFWLRQRI(QWHURYLUXVHVLQ7KH0\RFDUGLXP6WXGLHVRQDQLPDO
KHDUWVZLWKFR[VDFNLHYLUXV%P\RFDUGLWLVDQGHQGRP\RFDUGLDOELRSVLHVIURPSDWLHQWVZLWKP\RFDUGLWLVDQGGLODWHG
cardiomyopathy : molecular analysis of the pathophysiology of cardiomypathy. Japanese Circulation Journal.

 +LOWRQ'$9DULHQG63ULQJOH-+'HPRQVWUDWLRQRIFR[VDFNLHYLUXV51$LQIRUPDOLQ[HGWLVVXHVHFWLRQVIURP
childhood myocarditis cases by in situ hybridization and the polymerase chain reaction. The Journal of Pathology.

 1LFKOVRQ)$MHWXQPREL-/L0HWDO0ROHFXODUGHWHFWLRQDQGVHURW\SLFDQDO\VLVRIHQWHURYLUXV51$LQDUFKLYDO
VSHFLPHQVIURPSDWLHQWVZLWKDFXWHP\RFDUGLWLV%ULWLVK+HDUW-RXUQDO
 )XMLRND6.RLGH+.LWDXUD<HWDO0ROHFXODUGHWHFWLRQDQGGLIIHUHQWLDWLRQRIHQWHURYLUXVHVLQHQGRP\RFDUGLDO
ELRSVLHV DQG SHULFDUGLDO HIIXVLRQV IURP GLODWHG FDUGLRP\RSDWK\ DQG P\RFDUGLWLV $PHULFDQ KHDUW MRXUQDO

 Frustaci A, Chimenti C, Calabrese F, et al. Immunosuppressive Therapy for Active Lymphocytic Myocarditis.
&LUFXODWLRQ
 &DPDUJR352ND\76<DPDPRWR/HWDO0\RFDUGLWLVLQFKLOGUHQDQGGHWHFWLRQRIYLUXVHVLQP\RFDUGLDOWLVVXH
,PSOLFDWLRQVIRULPPXQRVXSSUHVVLYHWKHUDS\,QWHUQDWLRQDO-RXUQDORI&DUGLRORJ\
 .\W|99XRULQHQ7 6DXNNR 3 HW DO &\WRPHJDORYLUXV ,QIHFWLRQ RI WKH +HDUW ,V &RPPRQ LQ 3DWLHQWV ZLWK )DWDO
0\RFDUGLWLV&OLQLFDO,QIHFWLRXV'LVHDVHV
 Wilmot I, Morales DLS, Price JF, et al. Effectiveness of Mechanical Circulatory Support in Children With Acute
)XOPLQDQWDQG3HUVLVWHQW0\RFDUGLWLV-RXUQDORI&DUGLDF)DLOXUH
 Mavrogeni S, Spargias C, Bratis C, et al. Myocarditis as a precipitating factor for heart failure: evaluation and 1-year
follow-up using cardiovascular magnetic resonance and endomyocardial biopsy. European Journal of Heart Failure.

 De Salvia A, De Leo D, Carturan E, et al. Sudden cardiac death, borderline myocarditis and molecular diagnosis:
HYLGHQFHRUDVVXPSWLRQ"0HGLFLQH6FLHQFHDQGWKH/DZ66
 *DDORXO,5LDEL6+DUUDWK5HWDO6XGGHQXQH[SHFWHGGHDWKUHODWHGWRHQWHURYLUXVP\RFDUGLWLVKLVWRSDWKRORJ\
LPPXQRKLVWRFKHPVWU\DQGPROHFXODUSDWKRORJ\GLDJQRVLVDWSRVWPRUWHP%0&,QIHFWLRXV'LVHDVHV
 )HOGPDQ$05D\3(6LODQ&0HWDO6HOHFWLYHJHQHH[SUHVVLRQLQIDLOLQJKXPDQKHDUW4XDQWLFDWLRQRIVWHDG\
state levels of messenger RNA in endomyocardial biopsies using the polymerase chain reaction. Circulation.

 /DGHQVRQ3:6KHUPDQ6,%DXJKPDQ./HWDO5HYHUVLEOHDOWHUDWLRQVLQP\RFDUGLDOJHQHH[SUHVVLRQLQD\RXQJPDQ
ZLWKGLODWHGFDUGLRP\RSDWK\DQGK\SRWK\URLGLVP3URFHHGLQJVRIWKH1DWLRQDO$FDGHP\RI6FLHQFHV

 Bristow MR, Minobe WA, Raynolds MV, et al. Reduced beta 1 receptor messenger RNA abundance in the failing
KXPDQKHDUW7KH-RXUQDORI&OLQLFDO,QYHVWLJDWLRQ
 /RZHV%'=ROW\50LQREH:$HWDO6HULDO*HQH([SUHVVLRQ3UROLQJLQWKH,QWDFW+XPDQ+HDUW7KH-RXUQDO
RI KHDUW DQG OXQJ WUDQVSODQWDWLRQ  WKH RIFLDO SXEOLFDWLRQ RI WKH ,QWHUQDWLRQDO 6RFLHW\ IRU +HDUW7UDQVSODQWDWLRQ



&$3,78/2

REMODELACIN FISIOLGICA
<3$72/*,&$
EL ELECTROCARDIOGRAMA DEL INFARTO AGUDO INFEROPOSTERIOR

SAMUEL SCLAROVSKY

INTRODUCCIN concepto de suma importancia para el tratamiento de


emergencia de los sndromes isqumicos agudos.
El concepto de remodelacin cardaca naci y se de-
sarroll en los laboratorios de biologa molecular y LOS INFARTOS AGUDOS DEBIDO
HOHFWURVLRORJtD EiVLFD ,QLFLDOPHQWH VH HVWXGLDEDQ A OBSTRUCCIN SBITA DE UNA
los cambios morfolgicos que ocurran en el rea ARTERIA CORONARIA DERECHA
vecina y en la pared no involucrada en los infartos
H[SHULPHQWDOHV FUyQLFRV (VWRV FRQFHSWRV IXHURQ Hemos diferenciado la evolucin de los infartos en
PiVWDUGHH[WHQGLGRVDORVFDPELRVHVWUXFWXUDOHVTXH FXDWUR HWDSDV HOHFWURFDUGLRJUiFDV   Fase prein-
RFXUUtDQ HQ ODV KLSHUWURDV FDUGtDFDV LQGXFLGDV SRU farto: segmento ST elevado y onda T positiva, previa
sobrecargas sistlicas, diastlicas o por mutaciones DODDSDULFLyQGHODVRQGDV4 YHQWDQDGHRSRUWXQL-
JHQpWLFDV   GDG    Fase necrtica: RQGD 4 FRQ VHJPHQWR 67
En el primer decenio de este siglo se estudiaron HOHYDGR \ RQGD7 SRVLWLYD  Fase de reperfusion
ORVHIHFWRVGHODUHPRGHODFLyQEUyWLFDFRPRVXEV- incompleta RQGD 4 FRQ VHJPHQWR 67 HOHYDGR \
WUDWR GH ODV DUULWPLDV YHQWULFXODUHV UHPRGHODFLyQ RQGD7LQYHUWLGD\ Fase de reperfusion comple-
HOHFWURVLROyJLFD   \PiVUHFLHQWHPHQWHVHHVWXGLy ta RQGD 4 FRQ VHJPHQWR 67 LVRHOpFWULFR \ RQGD7
las remodelacin inica como base molecular de la LQYHUWLGD   )LJXUD 
PHPRULDFDUGtDFD   En este captulo nos referiremos a la fase preinfar-
$FWXDOPHQWHVHLQWURGXMRHOFRQFHSWRGHremode- to inferoposterior, causado por la obstruccin brusca
ODFLyQKLSHUWUyFDVLROyJLFD\SDWROyJLFD. En este \FRPSOHWDGHODDUWHULDFRURQDULDGHUHFKD FRURQDULD
aspecto, Kong et al estudiaron en ratas normales y GHUHFKD \ODUHDFFLyQHOHFWURVLROyJLFDPROHFXODUH
con mutaciones los cambios estructurales y molecu- inica de las paredes ventriculares involucradas.
lares debidos a un aumento de la tensin sistlica en /RV LQIDUWRV FRQ UHPRGHODFLyQ VLROyJLFD VRQ
ORVGRVWLSRVGHKLSHUWURDV   aquellos que se producen por una obstruccin sbita
El electrocardiograma es un mtodo de investi- de una arteria coronaria aislada y el rea no compro-
JDFLyQFDUGtDFDFDSD]GHH[SUHVDUORVFDPELRVLyQL- metida no est afectada por el proceso isqumico.
cos, metablicos y hemodinmicos que ocurren en el (VWR VLJQLFD TXH H[LVWH XQD VROD DUWHULD REVWUXLGD
LQIDUWR FDUGtDFR DJXGR GHO PLRFDUGLR    6HJ~Q y las restantes son normales, pero la pared no in-
QXHVWUDH[SHULHQFLDHVGHJUDQXWLOLGDGSDUDGLVWLQJXLU volucrada en el proceso tiene que remodelarse para
estos cambios en los infartos inferiores, posteriores mantener una fraccion de eyeccion razonablemente
o laterales aislados o la combinacin entre ellos, es conservada y en consecuencia un volumen minu-
decir en infartos no anteriores. Ms an, a travs de to razonable. En cambio, si la pared no involucra-
este mtodo, es posible diferenciar entre remodela- da esta irrigada por arterias obstruidas ella sufrir
FLyQVLROyJLFD\SDWROyJLFDGHORVLQIDUWRVDJXGRV cambios estructurales isquemicos que impiden el


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

reacomodamiento de la pared que debiera compensar


la pared irrigada por la arteria bruscamente obstrui-
GD(VWHIHQyPHQRORH[SUHVDHOHOHFWURFDUGLRJUDPD
registrado en la fase de preinfarto, concepto de crtica
LPSRUWDQFLDSDUDHOPDQHMRGHHVWRVFDVRVTXHVRQHO
GHODVLVTXHPLDVDJXGDV
(O(&*HVFDSD]GHLGHQWLFDUODDUWHULDREVWUXL-
GDODGLPHQVLyQGHOiUHDLUULJDGDSRUODDUWHULD iUHD
LQYROXFUDGD FRPRDVtWDPELpQHOQLYHOGHREVWUXF-
FLyQ  
En el infarto de la coronaria derecha, generalmen-
te el segmento ST-T en la derivacin DIII es el ms
elevado en comparacin con las dems derivaciones
H[SUHVDODFDUDLQIHULRULUULJDGDSUHGRPLQDQWHPHQWH
SRUGLFKDDUWHULD \VLHPSUHDFRPSDxDGRSRUXQDGH-
SUHVLyQGHOVHJPHQWR677HQ$9/   )LJXUD 
En una arteria corta, este puede ser el nico cambio
HOHFWURFDUGLRJUiFR  
Cuando la derivacin DII est involucrada en el
proceso isqumico, indica generalmente que la co-
ronaria deracha es co-dominante con la arteria cir-
FXQHMDHQODLUULJDFLyQGHODFDUDSRVWHULRU/DHOH-
vacin del segmento ST y onda T positiva en esta
GHULYDFLyQ YD DFRPSDxDGD SRU XQD GHSUHVLyQ GHO
Figura 4.1 Las 4 etapas del infarto agudo en evolucin de-
bido a una obstruccin sbita y completa hasta la etapa de VHJPHQWR67\RQGD7LQYHUWLGDHQ9(VWHVLJQR
reperfusin coronaria y miocrdica completa. En esta resea GHUHPRGHODFLyQVLROyJLFDSXHGHWDPELpQDSDUHFHU
se discutir nicamente la etapa del preinfarto debido a una FRQGHSUHVLyQGHOVHJPHQWR677HQ9 H[SUHVDQGR
obstruccin sbita y completa de la coronaria derecha. ORVSRWHQFLDOHVGHOVHSWXPPHGLRDQWHULRU \9 VHS-

Figuras 4.2 En la lnea 1 y 3 se observa una obstruccin sbita de coronaria derecha. Elevacin del segmento ST en DIII y AVF,
acompaados de una depresin del segmento ST y onda T en AVL. En lnea 2 se observa una reperfusin incompleta descenso
del ST en DIII acompaado por ascenso en AVL. En lnea 4 ST isoelctrico con T negativa en DIII con inversin de la onda T,
reperfusin completa y normalizacin de AVL.


CAPTULO 4 Remodelacin Fisiolgica y Patolgica. el electrocardiograma del infarto agudo inferoposterior.

WXPDQWHULRULQIHULRU RKDVWD9 iSH[L]TXLHUGR   


)LJXUDDEF 
Es importante recalcar que la depresin del seg-
mento ST y la inversin de la onda T es ms pronun-
FLDGDHQ9\YDHQGHFUHFLHQGRKDFLD9  /D
UHDFFLyQ UHHMD \ OD GLVWULEXFLyQ QR KRPRJpQHD GH
los receptores de tensin endocrdica crean fenotipos
GLIHUHQWHVHQWUHORVLQGLYLGXRV  
En el caso de que la coronaria derecha sea domi-
nante y que su rama lateral izquierda irrigue la pared
lateroapical, el segmento ST-T estar elevado en las
GHULYDFLRQHV9\9  (QHVWRVFDVRVHVSHFt-
cos, se observa segmento ST isoelctrico, con onda T
SRVLWLYDHQGHULYDFLyQ9\HQ9\9HOVHJPHQWR
67GHSULPLGRFRQRQGD7SRVLWLYD )LJXUD 
En las obstrucciones distales a la marginal dere-
FKDHQ9 TXHH[SUHVDORVSRWHQFLDOHVGHOVHSWXP
GHUHFKRDQWHULRU VHREVHUYDGHSUHVLyQGHOVHJPHQWR
67\RQGD7LQYHUWLGDH[SUHVDQGRODUHPRGHODFLyQ
GHODLVTXHPLDGHOVHSWXPSRVWHULRULVTXpPLFR VLHP-
SUHLUULJDGRSRUODFRURQDULDGHUHFKD   (QFDVR
GH XQD REVWUXFFLyQ SUR[LPDO D OD DUWHULD PDUJLQDO
derecha, generalmente, el segmento ST est elevado
con onda T positiva en V1, indicando que el septo
derecho anterior est involucrado en el proceso is-
TXpPLFR )LJXUDDE 

LA BIOLOGA MOLECULAR DE
LA ZONA INFARTADA EN LA CARA
INFERIOR

Los infartos agudos inferiores presentan siempre en


su morfologa inicial q/R en DII, DIII y AVF. Esta
onda q no indica necrosis inferior, sino que el mscu-
lo anterior se depolariza antes que el posterior, des-
YLDQGRHOYHFWRUGHORVSULPHURVPVHJKDFLDDUULED
y a la izquierda. Hang y colaboradores demostraron
que en estos casos disminuye la concentracin de la
SURWHtQD FRQHFWLYD FRQH[LQD    GH XQD IRUPD
similar a los hemibloqueos posteriores, que en este
caso es por alteracin de la conduccin de las vas
GH3XUNLQMH
(VLPSRUWDQWHVHxDODUTXHVLH[LVWHXQKHPLEOR-
queo anterosuperior, el primer vector en las deriva-
Figura 4.3 a. Obstruccin sbita de la coronaria derecha, distal FLRQHVGHORVPLHPEURVVHGLULJHKDFLDDEDMR\DOD
con remodelacin siolgica en V2 (septum superior) Ntese
que el segmento ST deprimido y onda T invertida (ver texto)
derecha, debido a que el msculo papilar posterior se
b. Obstruccin sbita coronaria derecha, distal con 2 deriva- depolariza antes que el anterior. En esta situacin la
ciones con remodelacin siolgica (V3 septum medio) isquema inferior no mostrar ondas q iniciales, debi-
c. Obstruccin sbita de coronaria derecha, distal con 4 de- GRDTXHORVSRWHQFLDOHVHOpFWULFRVGHORVPVHJLQL-
rivaciones con remodelacin siolgica. Ntese: que V2 es
la ms pronunciada, y los cambios siolgicos van en decre-
ciales estn demorados en ambos msculos papilares
ciendo hacia V4 (septum inferior) y V5 (pex izquierdo) Este XQRSRUEORTXHRFUyQLFRGHODUDPDDQWHURSRVWHULRU
patrn es importante tenerlo presente para la diferenciacin \HORWURSRUODGLVPLQXFLyQGHODFRQH[LQDSRUOD
de los patrones de remodelacin electrocardiogrca pato- LVTXHPLDDJXGD  )LJXUD 
lgica.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 4.4 Obstruccin sbita de una coronaria derecha, dominante. La elevacin del segmento ST y la onda T en V6, V5, V4,
indica que la rama izquierda de la coronaria derecha dominante, irriga la parte inferior de la cara lateral, apical y septal inferior.
Ntese que V3 y V2 muestran ST deprimido, con onda T positiva, sugiriendo el borde subendocrdico isqumico.

Las ondas T ms altas en DIII que en DII sugieren onda T alta y acuminada se debe al fenmeno elec-
que el centro de la isquemia est en la cara inferior, WURVLROyJLFRPROHFXODU\FUHDXQHOHPHQWRGHSUR-
irrigada casi siempre por la arteria descendente pos- WHFFLyQHSLFiUGLFReVWHIHQyPHQRIXHH[SOLFDGRSRU
WHULRUUDPDGHODFRURQDULDGHUHFKD )LJXUD /D Antzelevitch mostrando que en condiciones norma-
les el registro del potencial de accin del epicardio
HVPiVFRUWRTXHHOHQGRFDUGLR \HVWRH[SOLFDODVRQ-
GDV7SRVLWLYDVHQHO(&*GHODGXOWR SHURDOLQGXFLU
isquemia en el preparado, el potencial de accion del
HSLFDUGLRVHDFRUWD DXPHQWDQGRODDOWXUDGHODRQGD
7 PLHQWUDVTXHHOHQGRFDUGLFRQRFDPELDGHOHVWDGR
pre isqumico. Al agregar al preparado un bloquea-
GRU GH ORV FDQDOHV GH SRWDVLR DPLQRSLULGLQD  OD
isquemia no acorta el potencial de accion epicardio,
sugiriendo que el potasio tiene un papel primordial
HQHVWHIHQyPHQRHOHFWURVLROyJLFR  
La onda T alta en la isquemia aguda indica que el
potencial de accion del epicardio, se ha acortado en
ODVIDVHV\$ODFRUWDUVHODIDVHHQWUDPHQRV
calcio al sarcomero y de esta forma disminuye la in-
WHQVLGDGGHODFRQWUDFFLyQGHODPLREULOOD\SRUOR
tanto, se reduce la necesidad de O  SHUPLWLHQGR
una sobrevida del rea epicrdica.
Tambin el msculo liso de la microcirculacin
HSLFiUGLFDVHUHODMDSRUODDFWLYLGDGGHOSRWDVLRSUR-
GXFLHQGRYDVRGLODWDFLyQ  \GHHVWDIRUPDVHGH-
ULYDXMRVDQJXtQHRGHODSDUWHVDQDDODLVTXpPLFD
Figura 4.5 Ver explicacin en el texto. URERSRVLWLYR 


CAPTULO 4 Remodelacin Fisiolgica y Patolgica. el electrocardiograma del infarto agudo inferoposterior.

Figura 4.6 Ver explicacin en el texto.

Es importante destacar la funcin de la adenosi- FLyQ RSRUDOJXQDPXWDFLyQHQODVSURWHtQDVGHHVWH


na en este fenmeno. Con la falta de Oy substratos fantstico fenmeno.
SDUDODIRUPDFLyQGH$73HQODVPLWRFRQGULDV JOXFR-
VD\iFLGRVJUDVRV ODVVXVWDQFLDVIRVIDWDGDVGHDOWD EL SEGMENTO ST INVOLUCRADO
HQHUJtD VH YDQ GHJUDGDQGR $73$'3$03$'(- EN EL REA DEL INFARTO AGUDO
126,1$ . Esta ltima estimula los receptores de
potasio dependientes de ATP que estn casi inactivos /DH[SOLFDFLyQHOHFWURVLROyJLFD\PHWDEyOLFDGHOD
HQFRQGLFLRQHVVLROyJLFDV  (ODXPHQWRLQWHUV- elevacin del segmento ST, no est muy aclarada de-
ticial de este electrolito produce una atenuacin en bido a que la investigacin mdica no se ha sepa-
la contraccin del miocito y una vasodilatacin en la UDGR HQWUH HVWH \ OD RQGD7 3RU OR WDQWR H[SUHVDUp
microcirculacin en la zona afectada por la isquemia. mi opinin personal en este tema y de acuerdo a mi
Otro papel importante de la adenosina en la is- H[SHULHQFLDFOtQLFD\H[SHULPHQWDO )LJXUD 
quemia aguda, es la estimulacin de los receptores de (VGHFRQVHQVRJHQHUDOTXHHOVHJPHQWR67H[-
potasio dependientes de la acetilcolina, que de esta SUHVDODIDVHGHOSRWHQFLDOGHDFFLyQ(QHVWDIDVH
IRUPDGHSULPHODH[FLWDELOLGDG\FRQGXFWLELOLGDGGH penetra el calcio al sarcomero. Durante la isquemia
ORVQyGXORVVLQXVDO\DXUtFXORYHQWULFXODU  (VWH aguda disminuye el pH en el rea isqumica debido a
es un fenmeno protector que evita un aumento de una salida de hidrogeno de la clula, creando un vec-
QHFHVLGDG GH HQHUJtD  (VWR H[SOLFD SRUTXH OD IUH- tor de lesin desde el rea sana hacia la afectada. Ms
cuencia cardaca en la fase preinfarto est general- D~Q VH KD GHPRVWUDGR TXH HO S+ EDMR SURYRFD XQD
PHQWH SRU GHEDMR GH  OSP D SHVDU GH OD JUDQ VH- DFXPXODFLyQVLJQLFDWLYDGHFDOFLRHQHOiUHDLVTXp-
crecin de sustancias adrenrgicas, producida por la mica, induciendo un gradiente importante entre este
angustia, el temor y dolor que sufren estos pacientes. y el rea sana, contribuyendo tambin a la elevacin
*HQHUDOPHQWH FXDQGR H[LVWH WDTXLFDUGLD VLQXVDO HQ GHOVHJPHQWR67  
la isquemia aguda, sta puede deberse al agotamiento
GHODVVXVWDQFLDVSURWHFWRUDV LQIDUWRVGHODUJDGXUD-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 4.7 Ver explicacin en el texto.

Figura 4.8 Experimento en perro llevado a cabo por el autor de este capitulo. A la izquierda se observa el registro electrocar-
diogrco del perro con corazn cerrado. En el centro obstruccin completa de la descendente anterior con baln. Se observa
la tpica elevacin del segmento ST y de la onda T (15 mm del ST). A la derecha despus de 20 min se efecta una inyeccin
intracoronaria de diaxozido (que abre los canales de potasio) y la onda T se eleva 15min. Este experimento sugiere que la
elevacin del segmento ST y la onda T en la isquemia aguda tienen un mecanismo biolgico y electrosiolgico diferente, por
lo tanto pueden presentarse aisladamente en situaciones clnicas diferentes.

DISCUSIN DE LAS BASES VLRH[LVWHQHQHOHQGRFDUGLRPLHQWUDVTXHHQHOHSLFDU-


ELECTROFISIOLGICAS GLRH[LVWHQORVUHFHSWRUHVGHSHQGLHQWHVGHODLVTXHPLD
Y MOLECULARES DE LA El potencial de accion endocrdico se acorta
REMODELACIN FISIOLGICA debido a la presin aumentada en el ventrculo iz-
DEL INFARTO INFERIOR quierdo, por un aumento brusco de la concentracin
GHSRWDVLR  HVWDEOHFLHQGRXQJUDGLHQWHGHSRWHQ-
El endocardio anterior opuesto al infarto posterior, ciales entre el endo-epicardio, induciendo un vector
VXIUHXQDUHDFFLRQHOHFWURVLROyJLFD\PROHFXODUSRU elctrico desde el epi al endocardio. Este vector se
la presin diastlica aumentada intracavitaria debido H[SUHVDSRUXQDGHSUHVLyQGHOVHJPHQWR67HQ9R
al fenmeno isqumico agudo. Esta presin sobre el HQODVRWUDVGHULYDFLRQHVSHURFRPRVHKDH[SOLFDGR
endocardio anterior estimula los receptores de potasio DQWHVVLHPSUH9HVODPiVSURIXQGD\DTXHHQIUHQ-
GHSHQGLHQWHV GH OD SUHVLyQ FRGLFDGRV HQ75(. HO ta la cara posterior alta. Por supuesto si se registrasen
JHQTXHFRGLFDDOUHFHSWRUGHSRWDVLRGHWHQVLRQXEL- ORVFRPSOHMRVLQWUDFDYLWDULRVHQHVWDHWDSDGHOLQIDUWR
FDGRHQHOHQGRFDUGLR  (VWRVUHFHSWRUHVGHSRWD- se observara un ST elevado con T positiva.


CAPTULO 4 Remodelacin Fisiolgica y Patolgica. el electrocardiograma del infarto agudo inferoposterior.

LA HISTORIA DE LA DEPRESIN evitar la evolucin del proceso hacia infarto su-


DEL SEGMENTO ST Y DE LA ONDA bendocrdico circunferencial que era frecuente-
T EN LOS SNDROMES ISQUMICOS PHQWHIDWDO )LJXUD 
AGUDOS

Antes de comenzar a discutir el problema de las re-


modelaciones patolgicas de los infartos permtaseme
analizar el fenmeno de la depresin del segmento ST
y su relacin con la orientacin de la onda T en los
procesos agudos isqumicos. Este tema fue investiga-
do por nuestro grupo en la Unidad Intensiva Coronaria
GHQWURGHO&HQWUR0pGLFR5DELQ H[%HLOLVRQ 
(Q ORV DxRV  FRPHQ]DPRV D HVWXGLDU ORV SUR-
cesos isqumicos agudos con registros electrocardio-
JUiFRVFRQWLQXRVGHDGHULYDFLRQHV1RVOODPD-
ba la atencin la evolucin muy diferente que tenian
los pacientes que se presentaban con fenmenos is-
qumicos de cara anterior, entre los que registraban
segmento ST y onda T elevados versus los que tenian
67GHSULPLGR\RQGD7QHJDWLYD  +DEtDXQDGL-
ferencia notable en la evolucin clnica, y mortalidad
HQWUHORVJUXSRV/RVSDFLHQWHVFRQ67GHSULPLGR
tenan mayor mortalidad y en la autopsia no se vean
VLJQRV H[WHUQRV GH LQIDUWR HSLFiUGLFR PLHQWUDV TXH
los pacientes con ST-T elevado tenan menos mor-
WDOLGDG VROtDQ IDOOHFHU SRU VKRFN FDUGLRJpQLFR \ HO Figura 4.9 Ver explicacin en el texto.
H[DPHQQHFUySVLFRVHREVHUYDEDXQLQIDUWRHSLFiUGL-
co o taponamiento por hemopericardio. Los primeros
presentaban en su gran mayora una obstruccin en el Tambin describimos las isquemias subendocr-
WURQFRGHODDUWHULDFRURQDULDL]TXLHUGDRORVYDVRV GLFDV UHJLRQDOHV TXH VH H[SUHVDEDQ FRQ VHJPHQWRV
severamente obstruidos, mientras el segundo grupo 67GHSULPLGRV\VHDFRPSDxDEDQGHXQDRQGD7SR-
presentaba obstruccin trombtica en la descendente sitiva puntiaguda similar a la onda T de las isquemias
anterior. Tambin se observaba que en la evolucin WUDQVPXUDOHV \ VH ORFDOL]DED HQ 99 VXJLULHQGR
de los primeros que sobrevivan, no aparecan ondas que la arteria culpable era la descendente anterior.
4 LQIDUWRFLUFXQIHUHQFLDOVXEHQGRFiUGLFR PLHQWUDV Llegamos a la conclusin de que este fenmeno era
TXHORVVHJXQGRVQDOL]DEDQFRQRQGD4SRULQIDUWRV debido a una obstruccin sbita incompleta de dicha
VHJPHQWDULRV   arteria que a veces evolucionaba hacia una obstruc-
En la literatura se conocan dos publicaciones de cin completa con signos de isquemia transmural, es
\GHLQIDUWRVFLUFXQIHUHQFLDOHVVXEHQGRFiU- GHFLU 67 HOHYDGR   )LJXUD   (V LQWHUHVDQWH
dico que durante el proceso isqumico presentaban en que este fenmeno se observa nicamente en la arte-
el ECG depresin del segmento ST, el diagnstico era ria descendente anterior pero no en otras arterias co-
DWUDYpVGHODDQDWRPtDSDWROyJLFD   ronarias, y probablemente se debe a que esta arteria
Desarrollamos el concepto de la isquemia aguda posee el fenmeno de autoregulacin.
subendocrdica circunferencial y determinamos crite- Asimismo, describimos pacientes que presentaban
ULRVGLDJQyVWLFRVTXHVRQ DSDULFLyQEUXVFDGH67 en un episodio de isquemia aguda segmento ST de-
GHSULPLGR FRQ RQGDV 7 QHJDWLYDV   Pi[LPD GHSUH- SULPLGRFRQRQGD7QHJDWLYDHQ999(VWHIH-
VLyQHQ99 FRUUHVSRQGLHQWHDODSH[  IUHFXHQ- QyPHQRH[SUHVDEDXQDLVTXHPLDWUDQVPXUDOSRVWHULRU
FLD FDUGtDFD GXUDQWH HO GRORU GH PHQRV GH  OSP lateral, debido a una obstruccin de la parte tercera de
JHQHUDOPHQWH HQWUH  \  OSP  (VWR XOWLPR SDUD XQDFRURQDULDGHUHFKDFRUWD   9HU)LJXUD 
diferenciarlos, de los cambios similares que aparecan En estudios posteriores describimos pacientes
HQODVWDTXLFDUGLDVVLQXVDOHVRSUXHEDGHHVIXHU]R   con sndrome isqumico agudo, que presentaban una
Esta concepcin permiti categorizar a estos HOHYDFLyQ GHO VHJPHQWR 67 \ RQGD 7 SRVLWLYD HQ 
pacientes en la etapa isqumica, y de esta forma GHULYDFLRQHVQRFRQVHFXWLYDV$9/\9SHURSUHVHQ-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

LA REMODELACIN PATOLGICA
DE LOS INFARTOS INFERIORES
/D UHPRGHODFLyQ HOHFWURFDUGLRJUiFD SDWROyJLFD HQ
una obstruccin sbita de la coronaria derecha se ob-
servan cambios en las derivaciones precordiales que
hacen sospechar de obstruccin concomitantes en
una o dos arterias izquierdas.

PACIENTES CON INFARTOS CON ST


DEPRIMIDOS EN V2, V3 CON ONDA
Figura 4.10 Tpica evolucin de una isquemia aguda subto-
T POSITIVA
tal de la AD. Se observa una depresin progresiva en V2,
V3, V4 con una onda T alta y acuminada Disociacin en la Como hemos recalcado anteriormente, la remodela-
orientacin del segmento ST y de la onda T. Ntese al nal FLyQVLROyJLFDGHOLQIDUWRDJXGRLQIHULRU\SRVWHULRU
del trazado la aparicin de una onda q mnima (q minscula) VH SUHVHQWDED FRQ VHJPHQWR 67 GHSULPLGR 9  HQ
indicando un infarto segmentario subendocrdico.
Registro superior. Obstruccin sbita incompleta de la AD Re- forma aislada o asociado a otras derivaciones, pero
gistro del medio. Reperfusin miocrdica. Registro inferior. Re VLHPSUHORVFDPELRVPi[LPRVVHUHJLVWUDEDQHQ9
isquemia pero con obstruccin completa de la AD. 7DPELpQKHPRVGLVFXWLGRHOVLJQLFDGRGHOSDWUyQGH
67GHSULPLGRFRQ7SRVLWLYDH[SUHVDQGRXQDLVTXH-
mia regional subendocrdica, que podra ser conse-
WDEDQWLSRVGHVHJPHQWRV67GHSULPLGRVHQ',,, FXHQFLDGHXQDREVWUXFFLyQDJXGDVXEWRWDORH[SUHVD
DII, AVF con onda T negativa, sugiriendo un fen- HOERUGHVXEHQGRFiUGLFRGHOLQIDUWRHQFXxD
meno de remodelacin de la isquemia anteroseptal En el infarto agudo nfero-posterior en la fase de la
VXSHULRU\9FRQ67LVRHOHFWUtFRFRQ7SRVLWLYD\ obstruccin sbita de la coronaria derecha, asociada
99R67GHSULPLGR\RQGD7SRVLWLYD(QWRGRV a una obstruccin cronica y crtica de la descendente
los casos pudimos predecir que la arteria que provo- DQWHULRU  VH REVHUYDUi HQ 9 \9  XQD GHSUHVLyQ
FDEDHVWHIHQyPHQRHOHFWURFDUGLRJUiFRHUDXQDREV- del segmento ST con onda T positiva acuminada
truccin sbita aislada de la arteria primera diagonal, \QRLQYHUVLyQGHODRQGD7 (VSUREDEOHTXHHVWD
rama de la descendente anterior. EI ECG sugera un morfologa haga sospechar la obstruccin crtica de
LQIDUWRHQFXxDHVGHFLUTXHHOYpUWLFHHUDWUDQVPXUDO GLFKD DUWHULD TXH QR VH H[SUHVDED HQ FRQGLFLRQHV
SHURODEDVHHQGRFiUGLDFD   )LJXUD  QRUPDOHV XQ FDVR VLPLODU D OD SUXHED GH HVIXHU]R
Tambin observamos que una obstruccin sbita positiva que descubre una obstruccin crtica y cr-
de una rama secundaria se presentaba como un infar- nica de descendente anterior, pero en este caso por
WRHQFXxDSRUHMHPSORODSULPHUDRODVHJXQGDUDPD DXPHQWRGHODQHFHVLGDGGHR[LJHQRPLHQWUDVTXHHQ
marginal, o la segunda diagonal, rama de la descen- HOLQIDUWRLQIHULRUHVSRUODUHGXFFLyQGHOXMR (VWH
dente anterior. concepto puede ser de gran importancia cuando hay
que determinar la actitud teraputica. Al disminuir el
XMRFRURQDULRSRUHOLQIDUWRDJXGRHVWDREVWUXFFLyQ

Figura 4.11 Este registro indica una obstruccin sbita de la rama, primera diagonal de la descendente anterior Ntese la ele-
vacin del segmento ST y onda T positiva, en AVL y V2. En V3 se observa a una onda T positiva, sin elevacin del segmento ST.
En V4, V5, V6 segmento ST deprimido y onda T positiva, sin elevacin del segmento ST. En V4, V5, V6 segmento ST deprimido
y onda T positiva. Este patrn es tpico de los infartos en cua. El vrtice en el epicardio (AVL, V2) y en la base, el borde de la
isquemia que es subendocrdica.


CAPTULO 4 Remodelacin Fisiolgica y Patolgica. el electrocardiograma del infarto agudo inferoposterior.

crnica se hace evidente con una isquemia anterior meno se debi a la apertura universal de las unidades
UHJLRQDOVXEHQGRFiUGLFD )LJXUD (VWRQRGHEH LQWHQVLYDVFRURQDULDVDOSULQFLSLRGHOGHFHQLRGHO
confundirse con la etapa de reperfusin de la corona- siglo pasado, que se convirtieron prcticamente en
ULDGHUHFKDTXHQRVHH[SUHVDHQ'FRQXQD7LQYHU- ODERUDWRULRVGHLQYHVWLJDFLyQHOHFWURFDUGLRJUiFRV
WLGDFRQ67HOHYDGR\9PRVWUDUiWDPELpQFDPELRV El uso de los mtodos no invasivos que investigaban
recprocos con onda T positiva y ST elevado. En in- la funcin cardaca, permiti dar otro salto adelante
fartos agudos debido a una obstruccin sbita de una DO(&*(QORVDxRVDOSRGHUYLVXDOL]DUODSDWR-
arteria coronaria derecha dominante, se observa en loga coronaria en los pacientes con sndrome agu-
el electrocardiograma un segmento ST elevado con do, permiti dar un gran avance, donde el ECG se
onda T positiva y segmento ST elevado en las deri- manifest como nico mtodo no invasivo capaz de
YDFLRQHV9\9   determinar la anatoma coronaria T los mecanismos
Este fenmeno elctrico se debe a que la rama iz- VLRSDWROyJLFRV(QORV\HVWH~OWLPRGHFHQLRHO
quierda de la coronaria derecha, produce un infar- (&*IXHWDPELpQFDSD]GHH[SUHVDUORVFDPELRVPH-
WRFRQFXxD VLPLODUDOFDVRGHODSULPHUDGLDJRQDO tablicos y inicos que se producen en la evolucin
UDPDGHODGHVFHQGHQWHDQWHULRU GRQGH9SUHVHQWD de los procesos agudos
XQ 67 LVRHOpFWULFR FRQ RQGD7 SRVLWLYD \9 \9 El fenmeno de la remodelacin cardaca fue un
muestran signos de isquemia subendocrdica re- WHPDH[FOXVLYRGHORVFHQWURVGHLQYHVWLJDFLyQEiVLFD
gional, es decir ST deprimido con onda T positivas \HQORVODERUDWRULRVGHHOHFWURVLRORJtD
ERUGHVXEHQGRFiUGLFRGHOLQIDUWRODWHURDSLFDO (VWH En este captulo yo trato de analizar la posibilidad
fenmeno no pertenece a remodelacin patolgica TXHHO(&*SXHGDH[SUHVDUDQLYHOFOtQLFRODUHPRGH-
pero fue analizado en este prrafo por el diagnostico ODFLyQVLROyJLFD\SDWROyJLFD
deferencial del segmento ST. Este concepto, viene probablemente a ayudar al cl-
QLFRDGHWHUPLQDUFXiOHVHOSDFLHQWHGHEDMRULHVJR
CONCLUSIONES RH[WUHPDGRULHVJRHQSDFLHQWHVFRQXQDREVWUXFFLyQ
La investigacin electrocardiograma a nivel clnico sbita de una arteria coronaria derecha, y por ende
vuelve a adquirir una importancia relevante en los aplicar un tratamiento adecuado.
diagnsticos de los procesos isqumicos. Este fen-

Figura 4.12 Este grupo de pacientes muestra un patrn tpico de una obstruccin distal de la coronaria derecha, con ST deprimi-
do en V2 y V3, pero la onda T es positiva sugiriendo una remodelacin patolgica. Este patrn hace sospechar una obstruccin
crtica y crnica de la descendente anterior. Este electrocardiograma, muestra el segmento ST deprimido, con T positiva, sin
cambios en las otras derivaciones precordiales.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

BIBLIOGRAFA
1. 6Z\JKKHGDX%0ROHFXODUPHFKDQLVPRIP\RFDUGLDOUHPRGHOLQJ3K\VLRORJLFDO5HYLHZ
 Ruan H, Mitchel S, Vainoriene et. Alfa mediated cardiac electrophysiological remodeling and arrhythmias in
K\SHUWURSKLFFDUDGLRP\RSDWK\&LUFXODWLRQ
 'MH\DUDM':LOVRQ,'=KRQJ3-HWDO0HFKDQRHOHFWULFDOIHHGEDFNDVDQRYHOPHFKDQLVPLQHOHFWULFDOUHPRGHOLQJ
&LUFXODWLRQ
 .RQJ 6: %RGLDN .1 <XH 3 HW DO *HQRPLF H[SUHVVLRQ SUROHV GXULQJ SK\VLORJLFD DQG SDWKRORJLFDO FDUGLDF
K\SHUWURSK\DQGKHDUWIDLOXUHLQUDWV3K\VLRORJLFDO*HQRPLF
 6FODURYVN\68SJUDGLQJWKHHOHFWURFDUGLRJUDPWRWKHFHQWXU\-RI(OHFWURFDUGLRORJ\
 6FODURYVN\67KHHOHFWURFDUGLRJUDPLQWKHDFXWHLVFKHPLFV\QGURPHV&KDUSWHU'XQLW]/RQGRQ
7. %LUHQEDXP<6FODURYVN\60DJHU$HWDO67VHJPHQWGHSUHVVLRQLQ$9/LVDVHQVLWLYHPDUNHUIRUDFXWHLQIHULRU
P\RFDUGLDOLQIDUFWLRQ(XURS+HDUW-
 +DVGDXL'<HVXURQ<6FODURYVN\6$FXWHLQIHULRUZDOOLQIDUFWLRQZLWKRQHOHDG67HOHYDWLRQ ',,, 7KHEHQLJQ
YHUVXVWKHPDOLJQDQWFOLQLFDOHYROXWLRQ&RURQDU\$UWHU\'LVHDVH
9. 6FODURYVN\ 63 3K\VLRORJLFDO DQG SDWKRORJLFDO UHPRGHOLQJ LQ QRQ DQWHULRU ZDOO    LQIDUFWLRQ ,VUDHOLDQ 0HGLFDO
Association Journal. in press.
 Stones R, Gilbert H, Benoist D, et al. Inhomogeneity in the reponse of mechanical stimulus cardiac muscle function
JHQHH[SUHVVLRQ3URJ%LROHVWD
11. $VVDOL$6FODURYVN\6+HUW],HWDO&RPSDULVRQRISDWLHQWVZLWKLQIHULRUZDOOLQIDUFWLRQZLWYHUVXVZLWKRXW67
VHJPHQWHOHYDWLRQLQ99$P-&DUGLRO
 +DQJ;'6DQGXVN\*(=LSHV*)HWDO+HWHURJHQRXVORVVRIFRQH[LQHLQWKHLVFKHPLFGRJKHDUW-&DUGLRYDVFXODU
(OHFWURSK\VLRORJ\
 Lucas A, Antelevitch C. Differences in the electrophysiological response of canine ventricular epicardium to
LVFKHPLDUROHRIWUDQVLHQWRXWZDUGFXUUHQW&LUFXODWLRQ
 )XUXFXUD7.XXUD6)XUXZDND1HWHO5ROHRIFDUGLDF$73UHJXODWHGSRWDVVLXPFKDQQHOVLQGLIIHUHQWUHVSRQVHRI
HQGRFDUGLDODQGHSLFDUGLFDOFHOOVWRLVFKHPLD&LUF5HVHDUFK
 +HDUVH ' $FWLYDWLRQ RI $73 VHQVLWLYH FKDQQHOV $ QRYHO SKDUPDFRORJLFDO DSSURDFK P\RFDUGLDO SURWHFWLRQ"
&DUGLRYDVFXODU5HV
 1HDUERQH-0.DVV560ROHFXODUSK\VLRORJ\RIFDUGLDFUHSRODUL]DWLRQ3K\VLRO5HY
17. Norton GR, Mullane K, Flamen W, et al. Role of adenosine A1 receptors mediated antiadrenergic effect. J Physiol
++
 Chol HS, Trafford AW, Orchard et al. The effect of acidosis on systolic CA and sarcoplastic reticulum Ca content in
LVRODWHGUDWYHQWP\RFLWHV-3K\VLRORJ\
19. .HOO\'0DFNHQ]LHO+XQWHU6HWDO*HQHH[SUHVVLRQRIVWUHWFKDFWLYDWHGFKDQQHOVDQGPHFKDQLFHOHFWULFDOIHHGEDFN
LQWKHKHDUW&OLQLFDO([S3KDUPDF3K\VLRO
 6FODURYVN\6'DYLGVRQ(6WUDVEHUJ%HWDO8QHVWDEOHDQJLQDWKHVLJQLFDQFHRI67HOHYDWLRQRUGHSUHVVLRQLQ
SDWLHQWZLWKRXWHYLGHQFHRILQFUHDVHGR[\JHQGHPDQG$P+HDUW-
 6FODURYVN\6'DYLGVRQ,6WUDVEHUJ%HWDO8QHVWDOHDQJLQDHYROYLQJWRDFXWHP\RFDUGLDOLQIDUFWLRQ6LJQLFDQFH
RI(&*FKDQJHVGXULQJFKHVWSDLQ$P+HDUW-
 6FODURYVN\65HKDYLD(6WUDVEHUJ%HWDO8QVWDEOHDQJLQD67VHJPHQWGHSUHVVLRQZLWKQHJDWLYHYVSRVLWLYH7
ZDYHV$0+HDUW-
 6FODURYVN\67RSD]25HKDYLD(HWDO,VRODWHG67GHSUHVVLRQLQOHDGV99LQWKHSUHVHQWLQJ(&*IHDWXUHRI
SRVWHURODWHUDOZDOOP\RFDUGLDOLQIDUFWLRQ$P+HDUW-
 /HYLQH+)RUG596XEHQGRFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
 &RRN5:(GZDUGV-(3UXLW5'(OHFWURFDUGLRJUDSKLFFKDQJHVLQDFXWHVXEHQGRFDUGLDOLQIDUFWLRQ&LUFXODWLRQ

 6FODURYVN\ 6 %LUQEDXP < 6RORGN\ $ HW DO  ,VRODWHG PLG DQWHULRU P\RFDUGLDO LQIDUFWLRQ $ VSHFLDO
electrocardiographic subtype of acute myocardial infarction with ST elevation in nonconsecutive leads and two
GLIIHUHQWPRUSKRORJLFDOW\SHVRI67GHSUHVVLRQ,QW-&DUGLRORJ\
 +DVGDL'6FODURYVN\66RORGN\$HWDO3URJQRVWLFVLJQLFDQFHRIPD[LPDOSUHFRUGLDO67VHJPHQWGHSUHVVLRQ
LQULJKW 99 YHUVXV677GHSUHVVLRQLQ99 OHIW LQSDWLHQWVZLWKDFXWHLQIHULRUZDOOLQIDUFWLRQ$P-RI
&DUGLRORJ\
 6FODURYVN\6%DVHYLWFK56WUDVEHUJ%HWDO8QVWDEOHDQJLQDZLWKWDFK\FDUGLDFOLQLFDODQG\KHUDSHXWLFDOLPSOLFDWLRQ
$P+HDUW-
 $VVDOL$6FODURYVN\6+HU],HWDO&RPSDULVVLRQRGSDWLHQWVZLWKDFXWHLQIHULRUZDOOLQIHULRUZLWKYHUVXVZLWKRXW
67HOHYDWLRQLQ99$P-RI&DUGLRO


&$3,78/2

IMPACTO CARDIOVASCULAR
DEL SNDROME METABLICO
JORGE LERMAN

INTRODUCCIN ODLQVXOLQD 5, SRGUtDVHUHOIDFWRUHWLROyJLFRGHXQ


grupo de desrdenes consistentes en intolerancia a
La observacin de que los factores de riesgo car- la glucosa, hiperinsulinemia, hipertrigliceridemia,
diovascular muestran una tendencia a asociarse de FROHVWHURO+'/EDMRH+7$$HVWHFRQMXQWRORGH-
una manera preferencial fue descripta de diversas QRPLQyVLQGURPH;\VHxDOyHOULHVJRGHFRQWUDHU
maneras a lo largo del siglo pasado. Recientemente (&$HQORVVXMHWRVTXHORSDGHFtDQ Poco despus,
Sefaridis y Nilsson revisaron detalladamente la his- Norman Kaplan agreg un factor muy importante: la
toria de las ideas relacionadas con estos conceptos1. adiposidad central, o grasa acumulada dentro del ab-
A comienzos del siglo pasado, dos mdicos vieneses, GRPHQ(VGHFLUHOWHMLGRDGLSRVRHVSOiFQLFRTXHHVWi
.DUO+LW]HQEHUJHU\0DUWLQ5LFKWHU4XLWWQHUREVHU- depositado en el mesenterio, el epipln, entre las asas
varon la frecuente asociacin entre hipertensin ar- intestinales y el retroperitoneo, y que se drena por la
WHULDO +7$  \ GLDEHWHV '%7 $SUR[LPDGDPHQWH vena porta en lugar de la vena cava. Kaplan resumi
GXUDQWH OD PLVPD pSRFD HO VXHFR (VNLO .\OLQ y el las caractersticas del sndrome en cuatro componen-
HVSDxRO*UHJRULR0DUDxyQ publicaron en forma in- tes: adiposidad central, intolerancia a la glucosa, hi-
GHSHQGLHQWH\HQODPLVPDUHYLVWD =HQWUDOEODWWIXU pertrigliceridemia e HTA, y lo denomin el cuarteto
,QQHUH0HGL]LQ GRVDUWtFXORVEDMRHOWtWXOR+LSHU- mortal.9
WHQVLyQ \ GLDEHWHV PHOOLWXV +\SHUWRQLH DQG =XF-
NHUNUDQNKHLW 3RFRGHVSXpV.\OLQDPSOLyHVWDDVR- EL PROBLEMA DE LAS
ciacin agregando la hiperuricemia(O9DJXH DEFINICIONES
diferenci por primera vez la obesidad androide de
ODJLQHFRLGH\VHxDOyODFRQH[LyQHQWUHODSULPHUD\ /DSULPHUGHQLFLyQIXHSURSXHVWDSRUOD2UJDQL]D-
el desarrollo de DBT y enfermedad cardiovascular FLyQ0XQGLDOGHOD6DOXG 206 HQ En ella,
DWHURHVFOHURWLFD (&$  la RI era un componente esencial del sndrome y
/DGHQRPLQDFLyQVtQGURPHPHWDEROLFR 60 OD UHTXHUtDDOJXQDHYLGHQFLDELRTXtPLFDGHVXH[LVWHQ-
utilizaron por primera vez Hanefeld y Leonhardt n cia para formular el diagnstico. Esto era un factor
 LQFOX\HQGR '%7 KLSHULQVXOLQHPLD REHVLGDG H[FOX\HQWHDOTXHGHEtDQDJUHJDUVHRWURVGRVGHORV
+7$KLSHUOLSLGHPLDJRWD\WURPEROLD7 Estos auto- siguientes: obesidad, hipertensin arterial, elevacin
res notaron que dichas alteraciones se desarrollaban de los triglicridos, reduccin del colesterol HDL o
como consecuencia de una predisposicin gentica microalbuminuria.
DVRFLDGD D IDFWRUHV DPELHQWDOHV FRPR H[FHVRV DOL- (QHO1DWLRQDO&KROHVWHURO(GXFDWLRQ3UR-
mentarios e inactividad fsica y favorecan la apari- JUDP$GXOW 7UHDWPHQW 3DQHO ,,, $73,,,  SXEOLFy
cin de ECA. XQDGHQLFLyQTXHUHVXOWyVHUODPiVXWLOL]DGDHQOD
Gerald Reaven, en su clebre Banting Lecture, SUiFWLFD\ODLQYHVWLJDFLyQGXUDQWHDxRV 11. Para esta
SURSXVRHQODKLSyWHVLVGHTXHODUHVLVWHQFLDD GHQLFLyQ QR HUD QHFHVDULR GHPRVWUDU 5, QL QLQJ~Q


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

RWURHOHPHQWRH[FOX\HQWH6yORVHUHTXHUtDODSUHVHQ- GLDJQRVWLFRGH60VHGHQHSRUODSUHVHQFLDGHGH
FLDGHGHORVVLJXLHQWHVIDFWRUHVREHVLGDGDEGR- ORVFRPSRQHQWHVWDPELpQSUHVHQWHVHQODVGHPiV
minal, hipertensin arterial, elevacin de triglicri- GHQLFLRQHV6HFRQVLGHUDQDGHPiVSXQWRVGHFRUWH
dos, reduccin de colesterol HDL e hiperglucemia en SDUD OD FLUFXQIHUHQFLD DEGRPLQDO HVSHFtFRV SDUD
ayunas o diabetes. FDGDJUXSRpWQLFRFRQYDORUHVTXHRVFLODQHQWUH
(QOD)HGHUDFLyQ,QWHUQDFLRQDOGH'LDEHWHV \FPSDUDORVYDURQHV\HQWUH\SDUDODV
),' SURSXVRXQDQXHYDGHQLFLyQTXHVHDVHPHMDED PXMHUHV. Adems de los componentes clsicos que
a la de la OMS en el sentido que requera un elemen- VRQFRPXQHVDODPD\RUtDGHODVGHQLFLRQHVH[LVWHQ
WRH[FOX\HQWHODREHVLGDGDEGRPLQDO(VWDHUDFRQVL- frecuentes anormalidades asociadas, que no integran
derada como un elemento subrogante fuertemente re- ORVFULWHULRVGLDJQyVWLFRVGHO60\TXHVHH[SRQHQ
ODFLRQDGRFRQOD5,$GHPiVVHUHTXHUtDODH[LVWHQFLD HQOD7DEOD
GHRWURVGHORVIDFWRUHVLQFOXLGRVHQODGHQLFLyQ
GHO$73,,,2WUDSDUWLFXODULGDGGHHVWDGHQLFLyQHUD EPIDEMIOLOGA
TXHVHGHQtDQGHIHUHQWHVSXQWRVGHFRUWHSDUDHOSH-
rmetro abdominal segn el grupo tnico analizado, (Q ORV ~OWLPRV DxRV VH OOHYDURQ D FDER QXPHURVRV
considerando que el biotipo de un caucsico europeo, estudios epidemiolgicos de SM en muchas regio-
un asitico, un africano o un individuo originario de QHV GHO PXQGR \ JUXSRV GHPRJUiFRV &DPHURQ \
Amrica eran bien diferentes. /DVGHQLFLRQHVGHO FROHIHFWXDURQXQDGHODVPiVH[WHQVDVUHFRSLODFLR-
ATP III y de la IDF se basan en criterios clnicos y nes en relacin a la prevalencia de SM, analizando
MHUDUTXL]DQODVHQFLOOH]\SUDFWLFLGDGGHGHWHFFLyQHQ HQFXHVWDVGHORVFLQFRFRQWLQHQWHV\HQFRQWUDURQ
consultorios clnicos por sobre la precisin de deter- amplias diferencias entre las series . Factores ge-
PLQDFLRQHV ELRTXtPLFDV PiV VRVWLFDGDV FRPR OR nticos, sociales, alimentarios, hbito constitucio-
GHWHUPLQDEDODGHOD206/DVWUHVGHQLFLRQHVH[- QDO HVWLOR GH YLGD \ DFWLYLGDG ItVLFD H[SOLFDQ HVWDV
puestas han sido las que tuvieron mayor difusin en GLYHUJHQFLDV DXQTXH WDPELpQ H[LVWLHURQ GLIHUHQWHV
la clnica y la investigacin, pero hubieron otras.  criterios diagnsticos en esos estudios. Dichos auto-
(VWDPXOWLSOLFLGDGGHGHQLFLRQHVSURYRFyFRQIXVLyQ res hallaron que en los varones la frecuencia oscil
GXUDQWH YDULRV DxRV KDVWD TXH HQ RFWXEUH GH  HQWUHHQOD,QGLD\HQORV((88PLHQWUDV
H[SHUWRVGHOD),'$PHULFDQ+HDUW$VVRFLDWLRQ TXHHQODVPXMHUHVIXHHQWUHHQ)UDQFLD\HQ
National Heart, Lung, and Blood Institute y otras Irn. En todos los casos hubo coincidencia en que la
LPSRUWDQWHV RUJDQL]DFLRQHV FLHQWtFDV VH UHXQLHURQ frecuencia de SM es una funcin directa de la edad.
FRQ HO REMHWR GH DUPRQL]DU OD GHQLFLyQ GHO 60 . Ford y col analizaron el National Health And
Se coincidi en que la obesidad abdominal no es un 1XWULWLRQ([DPLQDWLRQ6XUYH\ 1+$1(6 \HQFRQ-
FRPSRQHQWH REOLJDWRULR QL H[FOX\HQWH SHUR FRQVWL- traron que la prevalencia global del SM utilizando
tuye un estigma o herramienta preliminar muy til y OD GHQLFLyQ GHO$73 ,,, IXH GHO  17 Cuando
orientadora para detectar el SM en la comunidad. El DQDOL]DURQ OD IUHFXHQFLD GHO 60 HQ DPERV VH[RV \

Tabla 5.1 Condiciones asociadas al sndrome metablico

Hiperuricemia
Aumento de las lipoprotenas pequeas y densas
Dislipidemia
Aumento de los cidos grasos libres
Aumento del bringeno
Hipercoagulabilidad
Aumento de PAI-1
Aumento de protena C reactiva
Aumento de Interleuquina-6
Inamacin Aumento de factor de necrosis tumoral
Aumento de leptina
Reduccin de adiponectina
Esteatosis heptica
Apnea del sueo
Ovario poliqustico
Acantosis nigricans


CAPTULO 5 Impacto cardiovascular del sndrome metablico

diferentes grupos tnicos, se observ que el subgrupo [RV(QHVWDPLVPDPXHVWUDVHDQDOL]yHOSHVRSURSLR


que mostr la mayor prevalencia de SM fue el de la individual de cada uno de los componentes del SM
PXMHUHVKLVSDQDV  \HOPHQRUHOGHORVYDURQHV para predecir cardiopata isqumica. El componente
DIURDPHULFDQRV  (VWDVGLIHUHQFLDVVHGHEHQ que mostr la asociacin ms fuerte con ella fue el
DODJUDQLQXHQFLDTXHWLHQHQORVIDFWRUHVJHQpWLFRV FROHVWHURO+'/EDMRHQDPERVVH[RVVHJXLGRGHOD
alimentarios, sociales, ambientales y la actividad f- hipertrigliceridemia en los varones y la hipergluce-
sica. Otra importante conclusin de este estudio fue PLDHQODVPXMHUHV.
el progresivo incremento de la prevalencia del SM en 2WUDH[SHULHQFLDKRVSLWDODULDHVWDYH]HQSDFLHQ-
((88SDUWLFXODUPHQWHHQWUHODVPXMHUHV\ORVLQGL- WHV DJXGRV IXH SXEOLFDGD SRU 3LRPER \ FRO HQ 
YLGXRVPiVMyYHQHV 17 pacientes con eventos coronarios agudos admitidos en
([LVWHQ UHOHYDPLHQWRV HIHFWXDGRV HQ FDVL WRGRV la Unidad Coronaria del Hospital Argerich de Buenos
los pases europeos. En ellos se observa que los pa- $LUHV(O60HVWXYRSUHVHQWHHQHOGHORVFDVRV\
ses escandinavos muestran una prevalencia que oscila ODLQFLGHQFLDGHXQWULSOHSXQWRQDOFRPELQDGR DQJL-
HQWUHHODOHQ(VSDxDGHO\HQ,WDOLDGHO QDUHIUDFWDULDLQIDUWRRPXHUWH IXHPD\RUHQORVSD-
(QOD$UJHQWLQD/XTXH]\FROFRQGXMHURQXQ FLHQWHVFRQHOVtQGURPH YV /DGLIHUHQFLD
importante estudio en dos ciudades de la provincia de QRIXHHVWDGtVWLFDPHQWHVLJQLFDWLYDSUREDEOHPHQWH
Crdoba: Dean Funes, una poblacin del noroeste de SRUXQLQVXFLHQWHWDPDxRGHODPXHVWUD
la provincia, agro ganadera, de ascendencia nativa e La epidemia de sobrepeso/obesidad alcanza a los
hispana, y Oncativo, ubicada ms al sur, en la pam- pases en vas de desarrollo, en los que se registr
pa hmeda, ms industrializada, con mayor ingreso XQ LQFUHPHQWy GHO  DO  HQ OD SUHYDOHQFLD GH
per capita e integrada por una importante corriente VREUHSHVR\GHODOGHREHVLGDGHQORV~OWLPRV
inmigratoria italiana 196HLQFOX\HURQLQGLYLGXRV DxRV. La particularidad del aumento de la epidemia
GH'HiQ)XQHV\GH2QFDWLYRFRQHGDGHVHQWUH en pases subdesarrollados consiste en que en ellos
\DxRV5HFRJLHURQGDWRVGHPRJUiFRV\GHO se produce por aumento del consumo de caloras de
H[DPHQItVLFRODERUDWRULRGHUXWLQDOtSLGRVSUXHED EDMRFRVWR KLGUDWRVGHFDUERQR PLHQWUDVTXHHQODV
de tolerancia a la glucosa, insulinemia y HOMA. La comunidades ms opulentas se lleva a cabo con ali-
SUHYDOHQFLDJOREDOGH60IXHGHOVHJ~QODGH- PHQWRVPiVFRVWRVRV JUDVDVVDWXUDGDV 
QLFLyQ$73,,,\GHOVHJ~QODGHOD206(O Un problema altamente preocupante es el cre-
60SUHGRPLQyHQWUHORVLQGLYLGXRVFRQEDMDIRUPD- FLHQWHLQFUHPHQWRGHO60HQORVQLxRV\DGROHVFHQ-
cin educativa, sedentarismo y falta de prctica de tes. Este grupo poblacional es el que sufre ms fuer-
deportes. La RI segn el mtodo HOMA se observ temente la diseminacin de esta epidemia. Se estima
HQHOGHORVFDVRV(QDPEDVFRPXQLGDGHVOD que en los EEUU la prevalencia de SM entre los ado-
5,IXHPiVFRP~QHQODVPXMHUHVHQORVFLXGDGDQRV OHVFHQWHVHVGHOSHURDOFDQ]DXQHQORV
PiVDxRVRV\HQWUHORVVXMHWRVTXHDFXPXODEDQPD- adolescentes obesos . El aumento de la prevalencia
yor nmero de criterios de diagnstico de SM. De de SM corre paralelo al del sobrepeso y la obesidad:
ORVFULWHULRVTXHFRPSRQHQHO60HQ2QFDWLYRHO HQORV((88HQWUHORVQLxRVGHHGDGHVFRODU
ms prevalente fue la hipertensin seguida por trigli- WLHQH VREUHSHVR \ FHUFD GHO  REHVLGDG . En la
FpULGRVREHVLGDGDEGRPLQDOFROHVWHURO+'/EDMRH $UJHQWLQDH[LVWHQGDWRVDSRUWDGRVSRUXQDHQFXHVWD
KLSHUJOXFHPLDPLHQWUDVTXHHQ'HiQ)XQHVHOPiV en una poblacin peditrica que demostr una preva-
SUHYDOHQWH IXH +'/ EDMR VHJXLGR SRU WULJOLFpULGRV OHQFLDGHOXWLOL]DQGRFRPRSXQWRGHFRUWHHO
hipertensin, obesidad abdominal e hiperglucemia SHUFHQWLORHQWUHGHO,0&.
19
. Los hallazgos de este estudio demuestran una vez Weiss y col comprobaron una relacin directa
ms las diferencias determinadas por las diversas HQWUHHOVREUHSHVRREHVLGDG\HOHVWDGRLQDPDWRULR
FRPSRVLFLRQHV JHQpWLFDV GHPRJUiFDV \ VRFLRHFR- REMHWLYDGRSRUDXPHQWRGHSURWHtQD&UHDFWLYD\GLV-
nmicas de las poblaciones. PLQXFLyQ GH DGLSRQHFWLQD XQD FLWRTXLQD DQWLLQD-
/DSUHYDOHQFLDGHO60HQHOFRQVXOWRULRH[WHUQR PDWRULDTXHDXPHQWDODVHQVLELOLGDGDODLQVXOLQD .
de un servicio de Cardiologa de un hospital gene- (VWRVDXWRUHVGHPRVWUDURQDVLPLVPRHQHVRVQLxRV\
UDO IXH LQYHVWLJDGD HQ  SDFLHQWHV FRQVHFXWLYRV adolescentes alteraciones metablicas caractersticas
en el Hospital de Clnicas de Buenos Aires. El SM del SM, como intolerancia a la glucosa, RI y elevadas
DQDOL]DGR VHJ~Q OD GHQLFLyQ GHO $73 ,,,  HVWDED FRQFHQWUDFLRQHVGHSDUWtFXODVSHTXHxDV\GHQVDVGH
SUHVHQWHHQHOGHORVYDURQHV\HOGHODV colesterol.
PXMHUHV/RVGRVFRPSRQHQWHVPiVFRPXQHVIXHURQ Esta creciente epidemia de obesidad y SM tiene
la hipertensin arterial y la obesidad en ambos se- como causas primordiales los desfavorables cambios


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

HQHOHVWLORGHYLGDGHORVQLxRV\DGROHVFHQWHVTXH leccin natural hizo que subsistiera la mutacin que


habitan principalmente las reas urbanas, que se in- JHQHUyHOJHQRWLSRDKRUUDGRU(VWRVLJQLFDTXHVR-
WHQVLFyPiVIXHUWHPHQWHDSDUWLUGHODGpFDGDGHORV brevivieron y prevalecieron los individuos que logra-
DxRV(VFDGDYH]PD\RUHOVHGHQWDULVPRODVR- ron generar sistemas endocrinos y enzimticos que
brealimentacin con dietas ricas en grasas saturadas SXGLHUDQDOPDFHQDUHQHUJtDHQHOWHMLGRDGLSRVRGX-
y carbohidratos simples fcilmente absorbibles y el rante la abundancia para ser utilizado ulteriormente
censurable hbito del uso abusivo de la televisin y durante la hambruna. Por otra parte, el hombre primi-
las computadoras. Los hogares, las familias, las es- tivo necesitaba de esa reserva para los requerimien-
cuelas y las instituciones sociales de concurrencia de tos de su sistema msculo esqueltico, dado que para
ORVQLxRVVRQORViPELWRVDGHFXDGRVSDUDSURPRYHU deba recorrer grandes distancias para hallar su sus-
KiELWRV GH YLGD VDOXGDEOHV FRQ HO REMHWR GH ORJUDU
tento o huir de sus predadores. Es decir que consuma
una prevencin efectiva en esta etapa de crecimien- energa y quemaba de esta forma parte de las caloras
WRLGHQWLFDUSREODFLRQHVHQULHVJR\GHWHQHUHOLQ- DOPDFHQDGDV(QHVHFRQWH[WRDKRUUDGRUla insulina
cremento a gran escala de la epidemia de sobrepeso, MXJy\MXHJDXQUROHVHQFLDOGDGRTXHHVODKRUPRQD
REHVLGDG \ 60 (VWD FDPSDxD GHEH FRQWDU FRQ HO DQDEyOLFD SRU H[FHOHQFLD (VWD DGDSWDFLyQ JHQHUDGD
apoyo indispensable de autoridades sanitarias, cuer- por la seleccin natural, que favoreci la superviven-
SRVOHJLVODWLYRVVRFLHGDGHVFLHQWtFDVRUJDQL]DFLR- cia del hombre primitivo, se transform en una so-
nes no gubernamentales, medios de comunicacin, EUH DGDSWDFLyQ SHUMXGLFLDO HQ HO KRPEUH PRGHUQR
supermercados y la industria alimentaria que vive en condiciones totalmente diferentes. Luego
de la revolucin industrial y particularmente con la
FISIOPATOLOGA actual revolucin informtica, el individuo cazador y
recolector se convirti en ganadero, agricultor y se-
(O60HVHOUHVXOWDGRGHODGDxLQDLQWHUDFFLyQGHfac- dentario. Las hambrunas y los largos recorridos a pi
tores del medio ambiente sobre la base de la consti- TXH GHEtDQ FXPSOLUVH KDFH  DxRV SDUD ORJUDU
tucin gentica. . La gentica carga el can y los alimento son reemplazados en las sociedades desa-
malos hbitos de vida disparan el gatillo. rrolladas por sobre abundancia, facilidad de obten-
El medio ambiente opera a travs de dos facto- cin y progresivo sedentarismo. En las comunidades
res: por un lado la inadecuada alimentacin, basada modernas los supermercados suelen estar al alcance
en carbohidratos simples de rpida absorcin, cidos de los consumidores en todos los barrios y se hallan
grasos saturados y grasas trans y por otro la inactivi- colmados de ofertas de alimentos de obtencin rela-
GDG VLFD. Ello provoca un balance calrico positi- tivamente fcil. Hasta pueden obtenerse sin moverse
vo y una desproporcionada acumulacin de caloras del hogar, con un simple llamado telefnico. Ni si-
DOPDFHQDGDV HQ DGLSRVLWRV (O WHMLGR DGLSRVR HQ VX TXLHUDHVQHFHVDULRHOWUDEDMRGHFRFLQDUORVGDGRTXH
FRQMXQWR FRQVWLWX\H OD UHVHUYD FDOyULFD GHO RUJDQLV- es cada vez ms frecuente el delivery de alimentos
mo, pero la grasa visceral que se encuentra dentro elaborados, muchos de ellos ricos en carbohidratos
de la cavidad abdominal, entre las asas intestinales, simples de rpida absorcin, cidos grasos saturados
HQHOPHVHQWHULR\HOUHWURSHULWRQHR TXHVHGUHQDDO y grasas trans. Estas diferentes condiciones del me-
VLVWHPD SRUWD  HV DGHPiV XQ DFWLYR yUJDQR GH VH- dio ambiente determinaron que el genotipo ahorrador
crecin endocrina. Los principales productos de esa DQWLJXDPHQWHHOVDOYDGRU VHWUDQVIRUPHHQHOYHFWRU
secrecin son cidos grasos libres y citoquinas pro de las enfermedades degenerativas modernas como
LQDPDWRULDVFRQDOWDFDSDFLGDGDWHURJpQLFD el SM y sus dos principales consecuencias: la DBT y
El componente gentico que participa en la con- la ateroesclerosis. Ellas estn entre las primeras cau-
formacin del SM se relaciona con el llamado geno- sas de muerte o invalidez.
WLSRDKRUUDGRU(VWHFRQFHSWRDFXxDGRLQLFLDOPHQWH
por el genetista norteamericano James Neel hace casi RESISTENCIA A LA INSULINA
DxRVVHUHHUHDODSHUPDQHQFLDHQHOKRPEUHPR-
derno de antiguas adaptaciones evolucionistas que /DLQVXOLQDHVODKRUPRQDDQDEyOLFDSRUH[FHOHQFLD
DGRSWyHOKRPEUHSULPLWLYRKDFHPiVGHDxRV 6XV SULQFLSDOHV HIHFWRV VLROyJLFRV VH FDQDOL]DQ HQ

. El hombre prehistrico no era ganadero ni agricul- el metabolismo de los hidratos de carbono y de los
tor sino que era cazador y recolector y su superviven- lpidos. Su accin fundamental es mantener un nivel
cia dependa de factores naturales y climticos. Deba GH JOXFHPLD VLROyJLFR OXHJR GH OD DEVRUFLyQ GH OD
aprovechar adecuadamente las pocas de abundancia glucosa en el aparato digestivo. Para ello estimula el
y sobreponerse a las de escasez. El proceso de la se- ingreso de glucosa a la clula y activa su consumo a


CAPTULO 5 Impacto cardiovascular del sndrome metablico

travs de su fosforilacin, catabolismo en la glucli- La alteracin en la estructura molecular del re-


sis anaerbica hasta piruvato y entrada en las mito- ceptor de la insulina en la membrana plasmtica de
FRQGULDVSDUDFXPSOLUFRQODIDVHR[LGDWLYDPHGLDQWH ODVXSHUFLHGHODVFpOXODVVHQVLEOHVDODDFFLyQGHOD
HOFLFORGH.UHEV\ODFDGHQDR[LGDWLYD$GHPiVSUR- insulina provoca que dicho receptor no se combine
mueve la sntesis de glucgeno heptico y bloquea FRQVXOLJDQGRHVSHFtFR ODLQVXOLQD 'HHVWHPRGR
la glucgeno lisis. En el metabolismo lipdico los ODLQVXOLQDHVLQHFD]SDUDFXPSOLUFRQVXVIXQFLRQHV
principales efectos son la inhibicin de la liplisis metablicas y una de las consecuencias ms inme-
y la facilitacin de la acumulacin de grasa en los diatas y trascendentes es la hper glucemia. Por el
adipositos. conocido mecanismo de retroalimentacin, sta re-
Los mecanismos moleculares de la actividad ce- presenta el estmulo directo para la hiper secrecin
lular de la insulina estn bien dilucidados . Inicial- GHLQVXOLQD&RPR\DIXHH[SUHVDGRHOKLSHULQVXOL-
PHQWHVHXQHDODVXEXQLGDGD H[WUDPHPEUDQRVD GHO nismo es la consecuencia directa de la RI. La RI con
receptor, lo que genera un cambio estructural en la hiperinsulinismo es el escenario tpico del sndrome
VXEXQLGDG E LQWUDPHPEUDQRVD  TXH OH FRQHUH DF- metablico y la DBT tipo II. Durante un perodo de
tividad de tirosina quinasa. La tirosina se fosforila y WLHPSRTXHSXHGHPHGLUVHHQDxRVRTXL]iVGpFDGDV
estos residuos de tirosina fosforilados sirven de an- persiste esta situacin de RI, hiperinsulinismo e h-
FODMHSDUDSURWHLQDVLQWUDFHOXODUHV(VWHJUXSRGHSUR- SHUJOXFHPLDOHYHRPRGHUDGD FRPSHQVDGDSDUFLDO-
WHtQDVLQWHUPHGLDULDVVRQODV,56 ,QVXOLQ5HFHSWRU PHQWH SRU OD HOHYDFLyQ GH OD LQVXOLQHPLD  3HUR HQ
6XEVWUDFW RVXVWUDWRSDUDHOUHFHSWRULQVXOtQLFR/D algn momento de este proceso se produce el agota-
ms importante es la IRS 1 que permite anclar a otras miento de las clulas beta de los islotes de Langher-
SURWHtQDVHQ]LPiWLFDVFRPROD3,. IRVIDWLGLOLQRVL- hans pancreticos y se inicia la fase descompensada
WROTXLQDVD $SDUWLUGHDTXtVHSURGXFHQXQDVHULH de la diabetes, pasando a ser de hiperinsulnica a hi-
de eventos que terminan con las acciones de la insu- poinsulnica. Como consecuencia de ello, la gluce-
OLQDSRUODYtDGHOVHxDODPLHQWRGHOD3,.8QDGH mia se eleva desproporcionadamente y ya no es po-
las consecuencias ms importantes es la traslocacin VLEOHFRQWURODUODHQIHUPHGDGVLQHODSRUWHH[yJHQR
GHORVUHFHSWRUHV*/87DOPDFHQDGRVHQYHVtFXODV de insulina.
dentro del citoplasma hacia la membrana para que la El estado de hiperinsulinismo genera una situa-
JOXFRVD HQWUH D OD FpOXOD /D */87  UHSUHVHQWD HO FLyQ VLRSDWROyJLFD DGYHUVD SDUWLFXODUPHQWH SRU
paso fundamental de todo este sistema molecular de las consecuencias deletreas sobre la pared arterial.
ingreso de la glucosa al espacio intracelular. Una de las ms importantes es el aumento de la sen-
/D UHGXFFLyQ GH OD VHQVLELOLGDG GH ORV WHMLGRV D sibilidad de los receptores de colesterol LDL en el
la insulina genera la RI. En otros trminos, RI es la endotelio facilitando el ingreso de estas partculas
inversa de la sensibilidad insulnica. Los principales hacia la ntima. Adems se incrementa la sntesis de
WHMLGRVVREUHORVTXHDFW~DHVWDKRUPRQDVRQHOPXV- lpidos y de matriz intersticial de la pared vascular.
FXODUHODGLSRVR\HOKHSiWLFR&XDQGRH[LVWH5,VH Por otra parte se activan otros mecanismos aterog-
hace necesaria una concentracin mucho mayor de QLFRVFRPRODVtQWHVLVGHFLWRTXLQDVLQDPDWRULDVGH
insulina para mantener un nivel normal de glucemia. molculas de adhesin de macrfagos y linfocitos
Por lo tanto se produce hperglucemia con hiperinsu- asociado a la proliferacin y migracin hacia la nti-
linemia. El hiperinsulinismo es en consecuencia el ma de macrfagos y de clulas musculares lisas de la
resultado directo de la RI. capa media. Finalmente se promueve un mecanismo
/D 5, HV XQD FRQGLFLyQ VLRSDWROyJLFD EDVWDQ- pro trombtico a travs del aumento de produccin
te bien estudiada, que tiene bases genticas. Se han
GHVFULSWRPiVGHPXWDFLRQHVGHOJHQTXHFRGLFD
la protena del receptor de la insulina en el cromo- Tabla 5.2 Principales efectos del hiperinsulinismo
soma 19 . La forma ms comn es la del tipo A
con acantosis nigricans e hiperandrogenicidad en Aumenta:
pacientes con sndrome de ovario poliqustico. Re- La sensibilidad a los receptores LDL
La sntesis de lpidos
cientemente se reconoci un factor de transcripcin
La sntesis de matriz intersticial
gentico denominado USF1, que est involucrado en La sntesis de citoquinas inamatorias y
ODH[SUHVLyQGHXQJUXSRGHJHQHVUHODFLRQDGRVFRQ molculas de adhesin
la obesidad, el metabolismo de la glucosa, la regula- La proliferacin y migracin de macrfagos y
FLyQGHODSUHVLyQDUWHULDO\FLHUWDVUHVSXHVWDVLQD- clulas musculares lisas
matorias. La sntesis de PAI-1


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Factores ambientales (alimentacin, sedentarismo)

Obesidad central Genotipo ahorrador

Adipoquinas, AGNE

Resistencia a la insulina Mutacin del gen del


receptor de la insulina
HTA

Hiperglucemia Inflamacin

Dislipidemia Disfuncin Estado


aterognica endotelial protrombtico

Figura 5.1. Esquema de la gnesis y desarrollo del sndrome metablico mediado por la hiptesis de la los factores ambientales,
el genotipo ahorrador y resistencia a la insulina (AGNE = cidos grasos no estericados).

de PAI 1. En sntesis, aparecen las condiciones tpi- GDGFHQWUDO YLVFHUDO /RVDGLSRVLWRVGLVIXQFLRQDQ-


cas que promueven la gnesis y el desarrollo de la tes que la componen segregan cidos grasos libres y
SODFDGHDWHURPD 7DEOD  FLWRTXLQDVTXHJHQHUDQOD5,HQORVWHMLGRVVHQVLEOHV
La hiptesis que sostiene que la RI es el deno- VLHPSUH \ FXDQGR H[LVWD XQD PXWDFLyQ GHO JHQ GHO
minador comn de la constelacin de atributos que UHFHSWRUGHODLQVXOLQD(OFRQMXQWRGHHVWDVHFXHQFLD
integran el SM no est absolutamente demostrada ni conduce a la composicin de la constelacin que in-
DFHSWDGDSRUWRGRVORVDXWRUHV\DTXHH[LVWHQFDVRV WHJUDHO60TXHH[SRQHHQOD7DEOD
de RI sin SM y viceversa. Pero en el estado actual En condiciones de RI se alteran los metabolismos
del conocimiento resulta la manera ms integral de de los carbohidratos y de los lpidos. Por el lado del
LQWHUSUHWDUHVWDDIHFFLyQ/D)LJXUDUHSUHVHQWDHV- metabolismo hidrocarbonado se reduce el ingreso de
quemticamente la secuencia de hechos que se suce- JOXFRVDDORVWHMLGRVPXVFXODU\DGLSRVR\DXPHQWDOD
deran en el desarrollo del SM mediado por la hip- gluconeognesis heptica. Estos mecanismos elevan
WHVLVGHOD5,/RVIDFWRUHVDPELHQWDOHVQHJDWLYRV OD la glucemia, con estimulacin de las clulas beta del
DVRFLDFLyQGHPDODDOLPHQWDFLyQ\VHGHQWDULVPR HQ pncreas y aumento de la insulinemia. En el metabo-
presencia de un genotipo ahorrador, provocan obesi- lismo de los lpidos, el menor ingreso de glucosa a los

Tabla 5.3 Componentes del sindrome metablico

Obesidad abdominal
Hipertensin arterial
Hperglucemia
Descenso de colesterol HDL
La triada o dislipidemia pro aterognica Aumento de triglicridos
Aumento de las partculas de colesterol LDL pequeas y densas.
Disfuncin endotelial
Estado pro trombtico
Estado pro inamatorio


CAPTULO 5 Impacto cardiovascular del sndrome metablico

adipositos, provoca una reduccin de la sntesis de RWURV WHMLGRV \ OD VtQWHVLV GH JOXFyJHQR KHSiWLFR
triglicridos en ellos y como consecuencia se vuelca Otro efecto normal de la insulina es la vasodilata-
XQDFDQWLGDGVLJQLFDWLYDGHiFLGRVJUDVRVOLEUHVDO cin dependiente del endotelio, dado que estimula
plasma. Los cidos grasos volcados al sistema porta OD R[LGR QtWULFR VLQWHWDVD FRQ OD FRQVHFXHQWH SUR-
SRUHOWHMLGRDGLSRVRYLVFHUDOVRQFDSWDGRVSRUHOKt-GXFFLyQ GH y[LGR QtWULFR . Mediante la segunda
gado y utilizados para un incremento de la sntesis deva metablica la insulina resulta ser un factor de
OLSRSURWHtQDVGHPX\EDMDGHQVLGDG 9/'/ &RPR proliferacin celular que activa la Mitogen Acti-
FRQVHFXHQFLDKD\XQDUHGXFFLyQHQODH[SUHVLyQGH YDWHG 3URWHLQ .LQDVH 0$3.  (VWD YtD IDYRUHFH
ODPLJUDFLyQGHPRQRFLWRV\HVWLPXODODH[SUHVLyQ
lipoproten-lipasa y la lecitina-colesterol aciltransfe-
UDVDHQWUHRWUDV(VWD~OWLPDHQ]LPDGHVHPSHxDXQ GH IDFWRUHV SUR WURPEyWLFRV \ 3$, ([LVWHQ HYL-
papel clave en el transporte reverso de colesterol ha-dencias que sugieren que en presencia de RI, se blo-
FLDHOKtJDGR/DVXEH[SUHVLyQGHODVPHQFLRQDGDV quea preferencialmente la primera va, pero no la
enzimas conduce a una reduccin del catabolismo de segunda, con lo cual la insulina se convertira en un
las VLDL ricas en triglicridos. El aumento en los elemento proaterognico . Por otra parte, en pre-
niveles de triglicridos promueve la transferencia de sencia de DE la insulina provoca vasoconstriccin
SDUDGyMLFD
steres del colesterol desde las protenas de alta den-
VLGDG +'/ (VWHSURFHVRSURPXHYHODUHGXFFLyQGH Otro mecanismo mediante el cual la RI afectara
la concentracin de HDL y la aparicin de partculas ODIXQFLyQHQGRWHOLDOHVHOGHOHVWUpVR[LGDWLYR9DULRV
SHTXHxDV \ GHQVDV GH /'/ /DV FLIUDV HOHYDGDV GH
GHORVFRPSRQHQWHVGHO60HVWLPXODQVLVWHPDVR[L-
WULJOLFpULGRVEDMDVGHFROHVWHURO+'/\ODDSDULFLyQdativos en el endotelio, induciendo principalmente la
GHFRQFHQWUDFLRQHVHOHYDGDVGH/'/SHTXHxDV\GHQ- R[LGDVDGHOFRPSOHMR1$' 3 1$' 3 +\JHQHUDQ-
VDVVRQSURSLDVGHO60\GHQLGDVFRPRIDFWRUHVLQ- GRHVSHFLHVUHDFWLYDVGH2(VWXGLRVH[SHULPHQ-
dependientes de riesgo vascular. Ellas constituyen la tales han demostrado que esos sistemas enzimticos
triada aterognica caracterstica de este sndrome. pueden ser activados por la hiperinsulinemia . El
/DV SDUWtFXODV GH FROHVWHURO /'/ SHTXHxDV \representante ms importante de las especies reac-
GHQVDVMXHJDQXQSDSHOVXPDPHQWHLPSRUWDQWHHQOD WLYDVGH2HVHODQLyQVXSHUy[LGR 2 HOHPHQWR
gnesis de la placa de ateroma por varios motivos. VXPDPHQWHUHDFWLYRTXHDWDFDDOy[LGRQtWULFRJHQH-
(QWUHORVSULQFLSDOHVJXUDVXUHGXFLGRWDPDxRTXH UDGRHQHOHQGRWHOLRIRUPDQGRHODQLyQSHUR[LQLWULWR
hace que sean ms fcilmente transportadas a travs 2122  (VWH HV XQ DJHQWH DOWDPHQWH Wy[LFR SDUD
del endotelio hacia la capa ntima arterial. Por otra el endotelio con mltiples efectos deletreos, tales
parte, su estructura y composicin qumica las hace FRPR OD SHU R[LGDFLyQ OLStGLFD OD R[LGDFLyQ GH ORV
PiVIiFLOPHQWHR[LGDEOHV\IDJRFLWDGDVSRUORVPD- JUXSRVVXOItGULORVGHORVUHVLGXRVSURWHLFRVHOGDxR
crfagos de la pared generando as el ncleo o core irreversible a los cidos nucleicos y la desnaturali-
GHODSODFDGHDWHURPDMRYHQ$GHPiVSRUVXVSUR- zacin de las membranas celulares. Un ambiente al-
SLHGDGHVSURLQDPDWRULDVHVWLPXODQODSUROLIHUDFLyQWDPHQWH R[LGDWLYR SURYRFD DGHPiV OD R[LGDFLyQ GH
y migracin de clulas musculares lisas de la capa ODVOLSRSURWHtQDVGHEDMDGHQVLGDG /'/ JDWLOORIXQ-
PHGLDDUWHULDO\SURYRFDQPD\RUWR[LFLGDGDOHQGR- damental en la gnesis de la aterosclerosis. Por otra
telio. Por todos esos motivos, se considera que estas parte, la clula dispone de un arsenal de enzimas an-
partculas son participantes fundamentales en el pro- WLR[LGDQWHVFRPRODVXSHUy[LGRGLVPXWDVDFDWDODVD\
ceso de la ateroesclerosis JOXWDWLyQSHUR[LGDVDTXHFRQWULEX\HQDPDQWHQHUHO
HTXLOLEULRR[LGDWLYR'HOEDODQFHUHODWLYRGHODVIXHU-
DISFUNCIN ENDOTELIAL EN EL ]DV R[LGDWLYDV YHUVXV ODV DQWLR[LGDWLYDV UHVXOWDUi HO
SNDROME METABLICO GHVHQODFHQDO
Un tercer mecanismo tiene que ver con la reduc-
Los mecanismos por los cuales la RI y el hiperinsu- cin de la sntesis de triglicridos por los adipositos
linismo compensador provocan disfuncin endote- que se produce en presencia del SM y RI. Como
OLDO '( VRQP~OWLSOHV\FRPSOHMRV. Se ha com- consecuencia aumenta la liberacin de cidos grasos
probado que cuando la insulina se une a su receptor, libres a la circulacin, que se incrementa aun ms
SXHGHHMHUFHUVXDFFLyQDWUDYpVGHGRVYtDVXQDHV SRUODDFHQWXDGDOLSyOLVLVSURYRFDGDSRUHOH[FHVRGH
la ya mencionada de la fosfatidil-inositol quinasa, DGLSRVLGDG YLVFHUDO 6H FRQVLGHUD TXH HO H[FHVR GH
que mediante la protena quinasa B activa la prote- cidos grasos libres puede ser otro factor promotor
QDWUDQVSRUWDGRUD*/87\IDYRUHFHODDEVRUFLyQ de disfuncin endotelial en la RI.
de la glucosa en el msculo liso, los adipositos y


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

ESTADO INFLAMATORIO EN EL FLyQ SODVPiWLFD GH 3&5 EULQyJHQR OHXFRFLWRVLV


SNDROME METABLICO obesidad, RI, y SM, con mayores concentraciones
en los pacientes con inadecuado control metablico.
/DDVRFLDFLyQGHO60FRQODLQDPDFLyQHVWiELHQGR- Est demostrado por otra parte que niveles aumenta-
cumentada , y su fundamento radica en el ya men- GRVGH3&5GHDOWDVHQVLELOLGDGSRUHQFLPDGHPJ
cionado hecho de que los adipositos viscerales son dL se correlacionan fuerte e independientemente con
DFWLYRV SURGXFWRUHV GH FLWRTXLQDV LQDPDWRULDV /D elevacin del riesgo cardiovascular .
,QWHUOHXNLQD\HOIDFWRUGHQHFURVLVWXPRUDODFW~DQ En un importante estudio, Han y col demostraron
de una manera endocrina, paracrina y autocrina, pro- TXHWUDVDxRVGHVHJXLPLHQWROD3&5HOHYDGDSUH-
YRFDQ FLWRWR[LFLGDG \ DSRSWRVLV \ VX H[SUHVLyQ HVWi dice el desarrollo de diabetes de DBT y SM . Estos
DXPHQWDGD HQ HO WHMLGR DGLSRVR GH DQLPDOHV \ VHUHV KDOOD]JRV IXHURQ FRQUPDGRV HQ GLYHUVRV HVWXGLRV
humanos obesos. Por el contrario, se mencion que multicntricos, en los que se observa que la PCR se
ODDGLSRQHFWLQDHVXQDDGLSRFLWRTXLQDDQWLLQDPDWRULD eleva en forma proporcional con cada factor de ries-
VHJUHJDGD H[FOXVLYDPHQWH SRU HO WHMLGR DGLSRVR TXH go analizado, incluyendo los componentes del SM.
aumenta la sensibilidad a la insulina y posee actividad
DQWLLQDPDWRULDDOLQKLELUODH[SUHVLyQGHPROpFXODVGH ESTADO PRO TROMBTICO EN EL
DGKHVLyQLQWHUFHOXODU ,&$0 \YDVFXODU 9&$0  SNDROME METABLICO
y E-selectina. Los niveles elevados de las mismas se
encuentran asociados en forma proporcional con cada 5HVXOWDGLFXOWRVRHQODSUiFWLFDFOtQLFD\HQHODQi-
componente del SM. Las molculas de adhesin inter- lisis bioqumico, discriminar entre los trastornos in-
celular y vascular participan en forma activa en la am- DPDWRULRV\GHOVLVWHPDKHPRVWiWLFR/DVFDXVDVVH
SOLFDFLyQGHODUHVSXHVWDLQDPDWRULD\VHUHODFLRQDQ GHEHQDTXHODVDOWHUDFLRQHVGHODVPROpFXODVLQD-
con el aumento del espesor ntima media carotdeo y matorias activan la cascada de coagulacin y vice-
un incremento del riesgo cardiovascular . Asimis- versa. Por otra parte, mltiples mediadores poseen
mo, el ICAM-1 soluble y la selectina E se elevan en SURSLHGDGHV SURLQDPDWRULDVSURFRDJXODQWHV \ DP-
los pacientes con obesidad central. EDVVLWXDFLRQHVVHPDJQLFDQHQHO60
3RURWUDSDUWHXQHVWDGRLQDPDWRULRFUyQLFRHVWi El estado de hipercoagulabilidad que caracteriza
implicado en la patognesis de la DE. Como ya fue D HVWH WUDVWRUQR VH DFRPSDxD GH LQFUHPHQWR GH ORV
H[SUHVDGR OD '(  SURPXHYH OD DFXPXODFLyQ GH OL- IDFWRUHV GH FRDJXODFLyQ IDFWRU WLVXODU IDFWRU9,, \
poprotenas en la capa ntima vascular y su ulterior EULQyJHQR  \R LQKLELGRU GH OD EULQyOLVLV LQFUH-
R[LGDFLyQ /DV OLSRSURWHtQDV R[LGDGDV VRQ D VX YH] mento del inhibidor 1 del activador del plasminge-
HOHPHQWRVSURLQDPDWRULRVTXHLQWHQVLFDQ\SHUSH- no y descenso de la actividad del activador del plas-
tan el proceso ateroesclertico. PLQyJHQR 6LPXOWiQHDPHQWHOD'(\ODGLVOLSHPLD
(OHVWDGRLQDPDWRULRTXHDFRPSDxDDO60SXHGH HVWLPXODQODDJUHJDFLyQSODTXHWDULD\HQFRQMXQWRVH
SRQHUVHGHPDQLHVWRHQODFOtQLFDPHGLDQWHHOGRVDMH FRQMXJDQSDUDLQFUHPHQWDUODSUREDELOLGDGGHWURP-
GH EULQyJHQR SURWHtQD DPLORLGH $ \ IXQGDPHQWDO- bosis arterial y venosa. En los pacientes obesos se
mente de PCR cuantitativa. Esta ltima se ha vuelto duplica el riesgo de tromboembolismo venoso, como
ya una prueba de rutina, mientras que otras como la consecuencia de la disfuncin de las clulas adiposas,
LQWHUOHXTXLQD UHTXLHUHQ XQ  SURFHVDPLHQWR PiV ORVFDPELRVLQDPDWRULRV\HOHVWDGRGHKLSHUFRDJX-
VRVWLFDGR /D 3&5 HV XQ PDUFDGRU LQHVSHFtFR GH labilidad. Estudios de cohorte demuestran que el n-
LQDPDFLyQTXHLQGXFHODVtQWHVLVGHFLWRTXLQDVPR- dice de masa corporal es proporcional a los niveles
lculas de adhesin celular y factores quimiotcticos GHGHJUDGDFLyQGHEULQD. La secrecin del PAI-1
\WLVXODUHVTXHDFWLYDQODYtDH[WUtQVHFDGHODFRDJX- es estimulada por la insulina, los cidos grasos libres
lacin. La PCR tambin incrementa los receptores de \ OD LQDPDFLyQ FUyQLFD . En el SM la elevacin
angiotensina 1 en el msculo liso vascular y altera la GHOEULQyJHQRVHDVRFLDFRQODLQDPDFLyQFUyQLFD
diferenciacin de las clulas endoteliales. Como con- la RI y el incremento en los niveles de protena C,
VHFXHQFLDVHUHGXFHODH[SUHVLyQGHODR[LGRQtWULFR factor X y protena S (O&'OLJDQGRHVXQPH-
sintetasa y se desencadena DE. A su vez, los incre- GLDGRUSURLQDPDWRULRH[SUHVDGRHQODVFpOXODVWLSR
PHQWRVGHORVQLYHOHVGH3&5\EULQyJHQRHQHVWRV T y activado en las plaquetas, con un rol fundamen-
pacientes se comportan como variables predictivas de WDOHQODFDVFDGDLQDPDWRULD\IXQFLRQHVSURDWHUR-
HQIHUPHGDGDWHURVFOHUyWLFDH[SUHVDGDVFOtQLFDPHQWHD WURPEyWLFDV&RQVWLWX\HHOQH[RHQWUHHOVLVWHPDGHOD
nivel del espesor ntima media carotdeo. LQDPDFLyQGLVIXQFLyQHQGRWHOLDO\ODDFWLYDFLyQGH
([LVWHXQDFRUUHODFLyQGLUHFWDHQWUHODFRQFHQWUD- la coagulacin. Se eleva en los sndromes coronarios


CAPTULO 5 Impacto cardiovascular del sndrome metablico

agudos y en pacientes con RI, donde incrementa el y prolongada a la hiperglucemia resulta en la glicosi-
riesgo de eventos mayores. lacin de las protenas de la matriz celular, provocando
ligaduras cruzadas del colgeno de la pared arterial .
MANIFESTACIONES INICIALES DE Al vencerse la barrera protectora de la pared arte-
DAO SOBRE LA PARED ARTERIAL ULDOVHGHVDUUROODQPHFDQLVPRVLQDPDWRULRVGHQWUR
de la misma, que inician el proceso aterosclertico.
Mientras el endotelio esta indemne, cumple con sus (VWH SURFHVR VLRSDWROyJLFR SXHGH VHU HYDOXDGR GH
funciones esenciales relacionadas con la adecuada una manera no invasiva en la clnica desde dos pun-
UHJXODFLyQGHOXMRVDQJXtQHRPLFURYDVFXODUODSUR- tos de vista: uno funcional a travs de las respuestas
duccion de sustancias vasodilatadores, la sintesis de vasodilatadores de la pared arterial frente a estimulos
factores antiagregantes. La DE es el evento primor- provocadores, y otro anatmico mediante la medi-
dial de la enfermedad ateroesclerotica y precede a la cin y el anlisis de la pared vascular. Es decir la pr-
instalacion de sus manifestaciones sintomticas. Una dida de la elasticidad y el engrosamiento del espesor
de las claves de los aspectos clnicos y epidemiol- GHFDSDtQWLPDPHGLD (,0 $PERVVRQPDUFDGRUHV
gicos del SM radica en la deteccin de los estadios reconocidos de aterosclerosis subclnica y predicto-
LQLFLDOHVGHHVHGDxRYDVFXODU res independientes de mala evolucin.
Los pacientes con SM sufren precozmente DE, (OHVWXGLR$WKHURVFOHURVLV5LVNLQ&RPPXQLWLHV
que se traduce precozmente en trastornos funciona- $5,& UHDOL]DGRHQPiVGHSHUVRQDVGHGLIH-
les, en vasos morfolgicamente intactos, antes del UHQWHVHWQLDVGHDPERVVH[RV\GHPHGLDQDHGDGOLEUHV
inicio de la enfermedad vascular macroscpica. El de enfermedad coronaria, evidenci que el SM estuvo
XMR FRURQDULR GH ORV YDVRV HSLFiUGLFRV HYDOXDGR asociado con aterosclerosis subclnica, estimada por la
SRUHOUHFXHQWRGHFXDGURV7,0,HQVXMHWRVFRQDU- medicin de EIM  con un fuerte impacto pronstico,
WHULDVFRURQDULDVDQJLRJUiFDPHQWHQRUPDOHVVHHQ- \DTXHGHVSXpVGHDMXVWDUFRQRWUDVYDULDEOHVODSUH-
cuentra alterado en personas con SM, al efectuar la VHQFLDGH60LQFUHPHQWyDSUR[LPDGDPHQWHYHFHVHO
comparacin con controles sanos . GHVDUUROORGHHYHQWRVHQDPERVVH[RV
Los componentes del sndrome son reconocidas 6FXWHUL\FRODQDOL]DURQXQDVHULHGHLQGLYL-
QR[DVHQGRWHOLDOHV(QWUHRWUDVODVPRGLFDFLRQHVGHOD duos aparentemente sanos pertenecientes al impor-
estructura y composicin de las lipoprotenas lesionan tante Baltimore Longitudinal Study on Aging e
al endotelio y son rpidamente captadas por los ma- investigaron el EIM carotdeo y la rigidez arterial,
crfagos de la pared arterial /DH[SRVLFLyQFUyQLFD relacionndolos la edad y la presencia de SM. Como

Controles

0.7 Sindrome metablico


Espesor intima media carotdeo (mm)

0.6

0.5

0.4

0.3
Primero Segundo Tercero Cuarto

Cuartilos de edad

Figura 5.2 El espesor ntima media carotdeo aumenta con el avance de la edad (medida en cuartilos), tanto en los pacientes
con sndrome metablico como en los controles. Pero en cada grupo de edad, el espesor ntima media es mayor en los pacien-
tes con sndrome metablico. (Modicado de Scuteri et al. J Am Coll Cardiol 2004; 43:1388-95).47


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Controles

12 Sindrome metablico

Rigidez arterial carotdea


10

4
Primero Segundo Tercero Cuarto

Cuartilos de edad

Figura 5.3. La rigidez arterial carotdea (medida en valores sin unidades), aumenta con el avance de la edad (medida en cuar-
tilos), tanto en los pacientes con sndrome metablico como en los controles. Pero en cada grupo de edad, la rigidez carotdea
es mayor en los pacientes con sndrome metablico. (Modicado de Scuteri et al. J Am Coll Cardiol 2004; 43:1388-95).47

VHDSUHFLDHQODV)LJXUDV\DFXDOTXLHUHGDG cian ms frecuentemente de lo que deberan hacerlo


los pacientes con SM muestran aumento en ambos VLPSOHPHQWHSRUHOD]DU"3DUDTXHODSULPHUDKLSy-
marcadores de enfermedad vascular prematura . En tesis sea la verdadera, debera reconocerse un deno-
este estudio el EIM y la rigidez arterial se relaciona- minador comn a todos los componentes que tenga
EDQVLJQLFDWLYDPHQWHFRQODFLUFXQIHUHQFLDDEGRPL- cierta implicancia causal. Ese denominador comn
nal, pero no con el ndice de masa corporal. podra ser la RI y en dicho caso, el SM sera una
Tzou y col analizaron otra importante poblacin: HQWLGDG QRVROyJLFD GHQLGD \ SRGUtD DFHSWDUVH TXH
OD GHO %RJDOXVD +HDUW 6WXG\ (O REMHWLYR GH HVWD su impacto cardiovascular fuese mayor que la suma
investigacin fue, como en los casos anteriormenmte de los componentes individuales. Dicho en otras pa-
comentados, analizar la asociacin del SM con la ate- labras, la acumulacin de los factores componentes
roesclerosis sub clnica mediante la medicin del EIM. tendra un efecto multiplicativo. En el caso de la se-
(VWXGLDURQVXMHWRVGHORVFXDOHVWHQtDQ60 gunda hiptesis, el SM sera slo una combinacin
El EIM carotdeo era mayor en los pacientes con SM de los factores que lo integran y el riesgo de ECA
YVPPS  3RURWUD VHULDVRORODVXPDGHHOORV HIHFWRDGLWLYR 
parte, el EIM se incrementaba a medida que aumenta-
ba el nmero de componentes del SM. RELACIN ENTRE RESISTENCIA
A LA INSULINA Y ENFERMEDAD
CONSECUENCIAS CLNICAS DEL CARDIOVASCULAR
SNDROME METABLICO
/D 5, IRUPD SDUWH GH ODV EDVHV VLRSDWROyJLFDV GHO
Una de las controversias que surge al encarar el SM SM y es un indicador absoluto de riesgo de desarro-
es si el riesgo de ECA que implica es mayor que la llar diabetes DBT en el futuro. Tambin se sospecha
suma del riesgo individual de cada uno de sus com- que lo es de ECA, aunque en este ltimo aspecto la
ponentes. Este dilema persiste y la evidencia dispo- evidencia no es tan robusta. Algunas sociedades cien-
QLEOHHVFRQWUDGLFWRULDGDGRTXHH[LVWHELEOLRJUDItD WtFDVFRPROD$PHULFDQ'LDEHWHV$VVRFLDWLRQ\OD
que sustenta ambas posibilidades.  .Este debate est European Association for the Study of Diabetes han
relacionado con una cuestin esencial en la interpre- cuestionado la utilidad clnica del SM como predictor
WDFLyQGHO60HVHVWHXQYHUGDGHURVtQGURPH"2 de riesgo cardiovascular , lo que constituye otra de
es la combinacin de diferentes factores que se aso- ODV SROpPLFDV H[LVWHQWHV 'H WRGRV PRGRV GLYHUVRV


CAPTULO 5 Impacto cardiovascular del sndrome metablico

estudios poblacionales han demostrado que la hiperin- IXHDQDOL]DGRH[KDXVWLYDPHQWHHQYDULRVLPSRUWDQWHV


sulinemia, tanto en ayunas como luego de la sobre- seguimientos prospectivos. El conocido estudio de
carga de glucosa, predice la aparicin de enfermedad ODV HQIHUPHUDV 1XUVHV +HDOWK 6WXG\  OOHYDGR D
cardiovascular en individuos no diabticos. La RI, cabo en los EEUU y conducido por investigadores de
DXQTXHQRHVWpDFRPSDxDGDGHKLSHULQVXOLQHPLDFRP- la Universidad de Harvard, aport importantes datos
SHQVDGRUD QL FRQJXUH GLDEHWHV WDPELpQ SUHGLFH HO acerca del valor predictivo de la obesidad abdominal
riesgo cardiovascular . En una poblacin aparente- en una poblacin aparentemente sana. En este traba-
mente sana y no obesa a la que se le hizo una prueba MRVHLQFOX\HURQPXMHUHVTXHIXHURQVHJXLGDV
GH5,HQGRYHQRVD<LS\FROHQFRQWUDURQTXHORVSD- GXUDQWH  DxRV &XDQGR VH DQDOL]y OD LQFLGHQFLD GH
FLHQWHVPiVVHQVLEOHVDODLQVXOLQD WHUFLORLQIHULRU QR infarto de miocardio o muerte cardiovascular, se ob-
WXYLHURQHYHQWRVFDUGLRYDVFXODUHVDOFDERGHDxRVGH serv que a medida que aumentaba la circunferencia
VHJXLPLHQWRPLHQWUDVTXHXQGHORVGHOWHUFLOR abdominal se incrementaba progresiva y proporcio-
ms insulinorresistente desarrollaron nuevos casos de nalmente el riesgo de padecer dichos eventos. Una
enfermedad coronaria, accidentes cerebrovasculares FLUFXQIHUHQFLDDEGRPLQDOGHFPRPiVVHDVRFLy
o arteriopata perifrica, independientemente de otros FRQXQULHVJRUHODWLYRGH ,& 
IDFWRUHVGHULHVJRFRPRHGDGVH[RWDEDTXLVPRtQGL- comparado con las que tenan un permetro abdomi-
ce de masa corporal o sedentarismo. QDOLQIHULRUDFP . En esa misma serie, cuando
'LYHUVRV PHFDQLVPRV VLRSDWROyJLFRV \ PROHFX- se compar la incidencia de DBT se comprob que
ODUHVMXHJDQXQSDSHOLPSRUWDQWHHQODUHODFLyQHQWUH a medida que aumentaba el permetro abdominal, se
KLSHULQVXOLQHPLD\(&$3RUHMHPSORHVWUDVFHQGHQWH incrementaba directamente la incidencia de DBT.
el rol de la endotelina-1, poderoso vasoconstrictor y Las enfermeras que tenan un permetro de cintura
estimulante de la proliferacin celular, cuya secrecin PD\RUGHFPDGTXLULHURQ'%7HQXQDSURSRUFLyQ
es estimulada por la insulina. Se acepta que ciertos YHFHVPD\RUTXHODVTXHWHQtDQPHQRVGHFP.
casos de hipertensin asociados a RI e hiperinsuline- En pacientes con cardiopata isqumica crnica,
mia pueden estar mediados por este mecanismo. Dagenais y col analizaron pacientes del conocido
Las clulas endoteliales disponen de un sistema re- HVWXGLR+23( +HDUW2XWFRPHV3UHYHQWLRQ(YDOXD-
nina-angiotensina completo, localizado principalmente WLRQ  (VWH HVWXGLR HVWXGLy XQD SREODFLyQ LQWHJUDGD
en las caveolas, que les permiten sintetizar angiotensina SRUYDURQHV\PXMHUHVFRQXQDHGDGPH-
II. Adems de su potente efecto vasoconstrictor, la an- GLDGHDxRV/XHJRGHDxRVGHVHJXLPLHQWRORV
JLRWHQVLQD,,HVXQSRGHURVRHVWLPXODQWHGHOD1$' 3 pacientes en el tercer tecilo de circunferencia abdo-
+ R[LGDVD PHGLDQWH VXV UHFHSWRUHV$7 6KLQR]DNL\ PLQDOPRVWUDURQXQVLJQLFDWLYRDXPHQWRGHOULHVJR
col estudiaron la estrecha asociacin entre hiperinsuli- GH PRUWDOLGDG FDUGLRYDVFXODU S    GH LQIDUWR
nemia y activacin del sistema renina angiotensina en- GHPLRFiUGLFR S \GHPRUWDOLGDGWRWDO S
dotelial, demostrando que el bloqueo farmacolgico de  (VWRVUHVXOWDGRVVHH[SUHVDQHQOD)LJXUD
este sistema no slo reduce la hipertensin arterial sino Empana y col encararon en Francia una intere-
tambin la RI. Folli y col. estudiaron las relaciones rec- sante investigacin orientada a investigar el poder
procas entre insulina y angiotensina II y sus respectivos predictivo de la obesidad abdominal para anticipar
UHFHSWRUHVDQLYHOPROHFXODUHQPRGHORVH[SHULPHQWD- PXHUWH V~ELWD 3DUD HOOR DQDOL]DURQ  YDURQHV
les, tanto in vivo con ratas como in vitro con clulas DSDUHQWHPHQWH VDQRV FRQ HGDG HQWUH  \  DxRV
musculares lisas de aorta. Estos autores demostraron enrolados en el Paris Prospective Study. Durante
que mientras la insulina acta estimulando a su receptor XQVHJXLPLHQWRGHDxRVVHSURGXMHURQPXHU-
mediante la fosforilacin de la tirosina, la angiotensina WHVV~ELWDV\LQIDUWRVGHPLRFDUGLRIDWDOHV/XHJR
II lo hace fosforilando el residuo de serina, y postulan GHDMXVWHVPXOWLYDULDGRVP~OWLSOHVHOGLiPHWURVDJL-
que este mecanismo estara involucrado en la modula- tal abdominal result efectivamente un predictor de
FLyQTXHHOODSURGXFHHQODVHxDOL]DFLyQLQWUDFHOXODUGH muerte sbita. La relacin entre el primer y quinto
la cascada de accin de la insulina. TXLQWLOR IXH   ,&     \   ,&
 SDUDPXHUWHV~ELWDHLQIDUWRGHPLRFDUGLR
RELACIN ENTRE LA OBESIDAD respectivamente.
ABDOMINAL Y ENFERMEDAD Coutinho y col llevaron a cabo un metanlisis
CARDIOVASCULAR LQYROXFUDQGR  SDFLHQWHV FRURQDULRV FUyQLFRV
/XHJRGHXQSURPHGLRGHDxRVRFXUULHURQ
El impacto que posee la obesidad abdominal en la fallecimientos. La obesidad central se asoci directa
incidencia de ECA o DBT en diferentes poblaciones \VLJQLFDWLYDPHQWHFRQODPRUWDOLGDGWRWDO KD]DUG

71
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Circunferencia abdominal (cm)


Varones Mujeres
Tercilo 1 < 95 < 87
Tercilo 2 95 - 103 87 - 98

Tercilo 3 > 103 > 98


1.4
1.35

1.29
1.27
Riesgo relativo ajustado

1.2
1.17 1.16
1.14

1 1 1
1.0

0.8

Mortalidad Infarto de Mortalidad


cardiovascular miocardio total

Figura 5.4 Riesgo relativo de mortalidad cardiovascular, infarto agudo de miocardio y mortalidad total, en funcin de la circun-
ferencia abdominal, expresada en tercilos, ajustado para edad, sexo, IMC, DBT, colesterol, etc (Modicado de Dagenais et al.
Am Heart J 2005;149:54-60).62

UDWLR,&D PLHQWUDVTXHSRUHO OHQFLDGH60GH$OFDERGHXQVHJXLPLHQWRSUR-


contrario, el ndice de masa corporal se asoci en for- PHGLRGHDxRVORVLQGLYLGXRVFRQ60PRVWUDURQ
PDLQYHUVD\VLJQLFDWLYD +D]DUGUDWLR XQDXPHQWRGHPRUWDOLGDGFRURQDULD 55
,&  D    Estos hallazgos tienen relacin ,& PRUWDOLGDGFDUGLRYDVFXODU 55
FRQODSDUDGRMDGHODREHVLGDGXQDVLWXDFLyQTXH ,& \PRUWDOLGDGWRWDO 55
VXJLHUHXQPHMRUSURQyVWLFRHQYDULRVJUXSRVGHSD- ,& PD\RUTXHHOUHVWR )LJXUD 
cientes cardipatas y que contiene varios errores con- (O HVWXGLR FRQGXFLGR SRU +X LQFRUSRUy 
ceptuales al incluir el peso del sistema muscular y la SDFLHQWHV HQWUH  \  DxRV GH HGDG GH  SDtVHV
grasa total en lugar de la grasa visceral. Por otro lado HXURSHRVVHJXLGRVGXUDQWHXQSURPHGLRGHPiVGH
VHUHDUPDHOFRQFHSWRGHODWUDVFHQGHQFLDGHODREH- DxRV\FRQXQDSUHYDOHQFLDGH60VHJ~QODGHQLFLyQ
sidad central por sobre el ndice de masa corporal. GHOD206GHO/RVKD]DUGUDWLRSDUDPRUWD-
OLGDGWRWDO\FDUGLRYDVFXODUIXHURQGHO ,&
IMPACTO CLNICO EN  \ ,& HQYDURQHV\
POBLACIONES APARENTEMENTE GHO ,& \ ,&
SANAS  HQPXMHUHVUHVSHFWLYDPHQWH.
En los EEUU, el importante estudio Atheros-
(O WpUPLQR DSDUHQWHPHQWH VDQR VH UHHUH D OD VL- FOHURVLV5LVNLQ&RPPXQLWLHV $5,& FRQ
tuacin de un individuo sin antecedentes clnicos de individuos de edad media, en un seguimiento de 11
HQIHUPHGDGYDVFXODU\TXHQRHVGLDEpWLFR(O5LVN DxRVWDPELpQDUURMRUHVXOWDGRVVLPLODUHV(OWH-
)DFWRUVDQG/LIH([SHFWDQFLHV6WXG\IXHXQRGHORV QtD60\OXHJRGHXQVHJXLPLHQWRPHGLRGHDxRV
primeros grandes estudios que report una estrecha VHUHJLVWUyXQDXPHQWRGH\YHFHVHQYDURQHV\
DVRFLDFLyQHQWUHHOVtQGURPH; WDOFRPRIXHGHQR- PXMHUHVUHVSHFWLYDPHQWHGHGHVDUUROODUHQIHUPHGDG
PLQDGRSRUORVDXWRUHV \OD(&$HQPiVGH coronaria o accidente cerebrovascular en aquellos su-
personas americanas y europeas seguidas durante 7 MHWRVFRQ60. Encontraron una asociacin positiva
DxRV entre el incremento del nmero de componentes del
(O.XRSLR,VFKDHPLF+HDUW'LVHDVH5LVN)DFWRU sndrome y el riesgo de enfermedad vascular. Re-
Study es uno de los estudios ms ampliamente cita- PDUFDURQ TXH ORV  PHMRUHV SUHGLFWRUHV GH HYHQWRV
dos en la literatura, respecto al pronstico del SM en cardiovasculares fueron la presin arterial elevada y
SREODFLRQHVVDQDVSRUODSUROLMLGDGGHVXGLVHxR\OD ODVEDMDVFRQFHQWUDFLRQHVGHFROHVWHURO+'/DXQTXH
FRQWLQXLGDG HQ VX VHJXLPLHQWR ,QFOX\y  YDURQHV VHxDODURQTXHODPD\RUSDUWHGHOULHVJRSRGtDVHUDQ-
QODQGHVHVHQWUHDDxRVGHHGDGFRQXQDSUHYD- ticipado por el escore de Framingham.


CAPTULO 5 Impacto cardiovascular del sndrome metablico

RR (IC 95%) =
2.43 (1.64-3.61)
20 Controles

Sndrome metablico

15
Eventos (%) RR (IC 95%) =
3,55 (1.96-6.43)
10
RR (IC 95%) =
3,77 (1.74-8.17)

0
Mortalidad Mortalidad Mortalidad
coronaria cardiovascular total

Figura 5.5 Tasa de eventos (mortalidad coronaria, mortalidad cardiovascular y mortalidad total) a 11.4 aos de seguimiento, y
riesgo relativo (RR) conferido por el sndrome metablico. (Modicado de Lakka et al. JAMA 2002; 288: 2709-16).

5LGNHU\FROGHPRVWUDURQHQFDVLPXMH- enfermedad est modulada por la presencia del SM.


res participantes del Womens Health Study que a Schillaci y col, en la Universidad de Perugia, estudia-
medida que aumenta el nmero de componentes del URQSDFLHQWHVKLSHUWHQVRVFRQDxRVGHHGDGPH-
VtQGURPHPHWDEyOLFRVHJ~QODGHQLFLyQGDGDSRUHO GLDGHORVTXHDSUR[LPDGDPHQWHODFXDUWDSDUWHWHQtDQ
NCEP/ATP III, se incrementa logartmicamente el SM. La rigidez de la pared artica medida a travs de
riesgo relativo de eventos cardiovasculares, y ade- ODYHORFLGDGGHODRQGDGHOSXOVRIXHVLJQLFDWLYDPHQ-
ms, la protena C reactiva incorpora poder predic- WH PD\RU HQ ORV FDVRV FRQ 60 TXH HQ HO UHVWR 
tivo adicional .   YHUVXV    PV S    SRU DQiOLVLV
Otro estudio norteamericano dirigido por Wilson multivariado. La velocidad artica se correlacion con
VLJXLySHUVRQDVDSDUHQWHPHQWHVDQDVGHODFR- la circunferencia abdominal, pero no con el ndice de
KRUWHGH)UDPLQJKDPGXUDQWHDxRV La prevalen- masa corporal 71 Uno de los mecanismos que ligaran
FLDGHO60IXHGHHQWUHORVYDURQHV\ al SM con la rigidez arterial podra ser que la hiperglu-
HQWUHODVPXMHUHV(QHOVH[RPDVFXOLQRHOULHVJRUH- cemia genera glicosilacin no enzimtica de las pro-
ODWLYRDMXVWDGRSDUDHO60IXHGH ,& tenas de la matriz del vaso y acumulacin de produc-
D   SDUD (&$   &,  D   SDUD tos de glicosilacin avanzada, los llamados advanced
HQIHUPHGDGFRURQDULD\ ,&D  JO\FDWLRQHQGSURGXFWV $*( (VWRV$*(PRGLFDQ
SDUD'%7(QHOIHPHQLQRIXH ,&D las propiedades fsicas de la pared arterial en forma
 SDUD(&$ ,&D SDUDFDU- DQiORJDDORTXHVHREVHUYDHQOD'%7\HVWHDXPHQ-
GLRSDWtDLVTXpPLFD\ ,&D SDUD WRHQODULJLGH]DyUWLFDFRQJXUDUtDXQVXVWUDWRSDUDHO
DBT. El riesgo atribuible poblacional asociado al SM incremento del riesgo cardiovascular.
SDUD(&$HQIHUPHGDGFRURQDULD\'%7IXHGH La participacin del sistema simptico en la aso-
\HQORVYDURQHV\HQOD ciacin entre SM y HTA como otro mecanismo ge-
PXMHUHV UHVSHFWLYDPHQWH /D KtSHU JOXFHPLD IXH HO nerador de hipertensin fue investigado por Hugget
factor ms predictivo para DBT y la HTA y el HDL y col. Estos autores demostraron mediante estudios
colesterol lo fueron para ECA.  PLFURQHXURJUiFRVTXHHO60UHSUHVHQWDXQHVWDGR
de hiperactividad simptica . La hiperinsulinemia,
EL SNDROME METABLICO EN LA una de las principales caractersticas del SM, genera
HIPERTENSIN ARTERIAL otros mecanismos capaces de facilitar la aparicin de
HTA: mayor reabsorcin de sodio en el tbulo distal,
El aumento moderado de la presin arterial es uno de incremento de la actividad de los sistemas renina, an-
los componentes del SM, pero adems la HTA como giotensina, aldosterona titulares y DE.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

El impacto clnico del SM en la HTA fue ana- Tabla 5.4. Prevalencia del sndrome metablico segn el
lizado en el estudio PIUMA . Este grupo sigui estado metablico. Disglicemia: hiperglucemia en ayunas o
curva de tolerancia a la glucosa.anormal. (Adaptado de Iso-
GXUDQWHXQSURPHGLRGHDxRVDKLSHUWHQVRV maa et al. Diabetes Care 2001; 24:683-9).77
y encontr que los pacientes con SM casi duplicaron
la incidencia de eventos cardiovasculares en relacin Normales Disglicemia Diabetes
DO UHVWR  YV  SRU  SDFLHQWHVDxRV S  Mujeres 10% 42% 78%
  (VWR VH HYLGHQFLy SDUD HYHQWRV FDUGtDFRV \ Varones 15% 64% 84%
cerebro vasculares. Adems los eventos se incre-
mentaron progresivamente a medida que aumentaba
el nmero de componentes del SM. se presentaba en diferentes proporciones, segn el es-
WDGRPHWDEyOLFRGHORVLQGLYLGXRV 7DEOD /XHJR
IMPACTO CLNICO EN GHDxRVODPRUWDOLGDGWRWDOIXHGHHQORVSD-
POBLACIONES CON ENFERMEDAD FLHQWHVFRQ60\VLQpO S /DPRUWDOL-
ATEROSCLERTICA O DIABETES GDGFDUGLRYDVFXODUIXHGHHQORVTXHWHQtDQ60\
HQORVTXHQRORSDGHFtDQ S .
El estudio Second Manifestation of Arterial Disea- Un subestudio del INTERHEART publicado por
VHFRQVXMHWRVHQWUH\DxRVGHWHFWyHO Mente y col aporta datos interesantes. . El INTER-
VtQGURPHHQHOGHSDFLHQWHVSRUWDGRUHVGH(&$ HEART constituye probablemente el relevamiento
en diferentes localizaciones. La prevalencia fue del epidemiolgico ms trascendental desde el estudio
HQSDFLHQWHVFRQHQIHUPHGDGYDVFXODUSHULIpUL- )UDPLQJKDPFRQODYHQWDMDGHTXHpVWH~OWLPRHVXQ
FDHQDTXHOORVFRQDQHXULVPDGHDRUWDDEGRPL- estudio comunitario limitado a una poblacin subur-
QDOFRQDFFLGHQWHFHUHEURYDVFXODULVTXpPLFR\ bana de Boston, en los EEUU, mientras que el IN-
 HQ SDFLHQWHV FRQ HQIHUPHGDG FRURQDULD . En TERHEART aporta datos de orden planetario, ya que
HVDPLVPDVHULH2OLMKRHN\FROKDOODURQHQORVFDVRV DEDUFySDFLHQWHVGHSDtVHVSHUWHQHFLHQWHV
con SM una alta incidencia de manifestaciones de D  FRQWLQHQWHV 6H WUDWy GH XQ HQVD\R FDVRFRQWURO
'(FRPRSRUHMHPSORLQFUHPHQWRGHO(,0FDURWt- FDVRV\FRQWUROHV GH,$0(QHOFL-
GHR PPYVPP GHOtQGLFHWRELOOREUD]R WDGRVXEHVWXGLRGH0HQWH\FROVHH[DPLQyHOULHVJR
YV \GHODH[FUHFLyQXULQDULDGHDOEXPL- de IAM conferido por la presencia de SM. El SM es-
QXULD YVGHORVSDFLHQWHV . WDEDSUHVHQWHHQHOGHORVFDVRV\HQHO
(QHOHVWXGLRGH6ROLPRVV\FROSDFLHQWHV GHORVFRQWUROHV S (QHODQiOLVLVSRUVXE-
consecutivos fueron estudiados mediante angiografa grupos, la tendencia se mantena independientemente
coronaria. Los pacientes con SM evidenciaron una GHODHGDGJpQHURUD]DRSURFHGHQFLDJHRJUiFD(O
PD\RUH[WHQVLyQGHODHQIHUPHGDG\VHHQFRQWUyXQD riesgo de padecer IAM asociado al SM fue similar al
relacin directa entre el nmero de componentes del GHOD'%7\DOGHODKLSHUWHQVLyQ79.
SM y la gravedad de la enfermedad coronaria. El Dos grandes metanlisis condensaron gran parte
descenso en el colesterol HDL fue el factor de riesgo de la informacin relativa al impacto cardiovascular
involucrado ms frecuente, seguido por el aumento del SM. Uno es el de Gami y col. de la Clnica Mayo,
de la presin arterial . TXH LQFOX\y  HVWXGLRV ORQJLWXGLQDOHV FRQ 
El estudio Womens Ischemia Syndrome Eva- individuos, y mostr un incremento del riesgo relativo
OXDWLRQ :,6(  DQDOL]y  PXMHUHV UHIHULGDV D GH ,&D GHHYHQWRVFDUGLRYDVFXOD-
cinecoronariografa por sospecha de cardiopatra is- res y muerte en personas con SM. Esta asociacin fue
TXpPLFD (O  WHQtD 60 \ HQ HOODV OD VREUHYLGD PD\RUHQPXMHUHVTXHHQKRPEUHV YV (VWH
D  DxRV IXH GH  YHUVXV  GH ODV TXH QR estudio demostr adems que el aumento de riesgo es
ORSUHVHQWDEDQ S /DVREUHYLGDOLEUHGH,$0 similar para eventos cardiovasculares, eventos corona-
$&9 R LQVXFLHQFLD FDUGtDFD WDPELpQ IXH LQIHULRU rios, mortalidad cardiovascular, mortalidad coronaria
HQORVFDVRVFRQ60 YHUVXVS  y mortalidad total y que el riesgo cardiovascular con-
Sin embargo, la diferencia en el pronstico se limit ferido por el SM es independiente de la presencia o
VRORDDTXpOODVSDFLHQWHVFRQOHVLRQHVVLJQLFDWLYDV ausencia de DBT, de enfermedad vascular previa y de
HQODFRURQDULRJUDItD KD]DUGUDWLR,& los clsicos factores de riesgo coronario.
DS 77. El otro es el de Motillo y col. de Canad, en el
El importante estudio Botnia, llevado a cabo en que luego de revisar la totalidad de la bibliografa,
6XHFLD\)LQODQGLDLQFOX\ySDFLHQWHVGHD VH VHOHFFLRQDURQ ORV  HVWXGLRV TXH FXPSOtDQ FRQ
DxRVGHHGDG(O60 VHJ~QODGHQLFLyQGHOD206  los requisitos bsicos para ser analizados en base a


CAPTULO 5 Impacto cardiovascular del sndrome metablico

una revisin sistemtica. Esos estudios incluan indi- GRSURQyVWLFRGHO60H[FHGHRQRHOULHVJRDVRFLDGR


viduos de la poblacin general, pacientes vasculares, con la suma de los componentes individuales.
diabticos, obesos, hipertensos, etc, con un total de Es interesante destacar que no todos los factores
FDVRV/XHJRGHXQSUROLMRDQiOLVLVVHOOHJy involucrados en el SM no tienen la misma implican-
a la conclusin de que la presencia de SM muestra un cia pronstica. El desarrollo de eventos coronarios
ULHVJRUHODWLYRGH(&$GH ,&D  HVWiPiVIUHFXHQWHPHQWHDVRFLDGRDODVEDMDVFRQFHQ-
PRUWDOLGDG FDUGLRYDVFXODU GH   ,&  D traciones de colesterol HDL y a la hipertensin arte-
 PRUWDOLGDGWRWDOGH ,&D  rial. En cambio, las alteraciones en la glucemia basal
,$0GH ,&WR \$&9GH se relacionan ms comnmente con la aparicin de
,&D (QVXVFRQVLGHUDFLRQHVQDOHV DBT en la evolucin.
HVWRVDXWRUHVGHMDQODGXGDDFHUFDGHVLHOVLJQLFD-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

BIBLIOGRAFA
1. 6DUDGLV3$1LOVVRQ307KHPHWDEROLFV\QGURPHDJODQFHDWLWVKLVWRU\-+\SHUWHQV
 +LWLW]HQEHUJHU.8EHUGHQ%OXWGUXFNEHL'LDEHWHV0HOOLWXV:LHQHU$UFK,QQHUH0HG
 .\OLQ(+\SHUWRQLHDQG=XFNHUNUDQNKHLW=HQWUDOEODWWIXU,QQHUH0HGL]LQ
 0DUDxRQ*8EHU+\SHUWRQLHDQG=XFNHUNUDQNKHLW=HQWUDOEODWWIXU,QQHUH0HGL]LQ
 .\OLQ(6WXGLHQXEHUGDV+\SHUWRQL+\SHUJO\FHPL+\SHUXULNHPLV\QGURP=HQWUDOEODWWIXU,QQHUH0HGL]LQ

 9DJXH-/DGLIIHUHQWLDWLRQVH[XHOOH)DFWHXUGHWHUPLQDQWGHVIRUPHVGHOREHVLWH3UHVVH0HG
7. Citado por la referencia 1.
 5HDYHQ*0%DQWLQJ/HFWXUH5ROHRILQVXOLQUHVLVWDQFHLQKXPDQGLVHDVH'LDEHWHV
9. Kaplan NM. The deadly quartet. Upper body obesity, glucose intolerance, hypertriglyceridemia and hypertension.
$UFK,QWHUQ0HG
 $OEHUWL.* =LPPHW3= 'HQLWLRQ GLDJQRVLVDQGFODVVLFDWLRQRI GLDEHWHVPHOOLWXVDQGLWVFRPSOLFDWLRQVSDUW
GLDJQRVLVDQGFODVVLFDWLRQRIGLDEHWHVPHOOLWXVSURYLVLRQDOUHSRUWRID:+2FRQVXOWDWLRQ'LDEHW0HG

11. 1DWLRQDO&KROHVWHURO(GXFDWLRQ3URJUDP 1&(3 ([SHUW3DQHORQ'HWHFWLRQ(YDOXDWLRQDQG7UHDWPHQWRI+LJK
%ORRG &KROHVWHURO LQ $GXOWV $GXOW 7UHDWPHQW 3DQHO ,,,  7KLUG 5HSRUW RI WKH 1DWLRQDO &KROHVWHURO (GXFDWLRQ
3URJUDP 1&(3 ([SHUW3DQHORQ'HWHFWLRQ(YDOXDWLRQDQG7UHDWPHQWRI+LJK%ORRG&KROHVWHUROLQ$GXOWV $GXOW
7UHDWPHQW3DQHO,,, QDOUHSRUW&LUFXODWLRQ
 $OEHUWL.*=LPPHW36KDZ-,')(SLGHPLRORJ\7DVN)RUFH&RQVHQVXV*URXS7KHPHWDEROLFV\QGURPHDQHZ
ZRUOGZLGHGHQLWLRQ/DQFHW
 %DONDX%&KDUOHV0&RPPHQWRQWKHSURYLVLRQDOUHSRUWIURPWKH:+2FRQVXOWDWLRQ(XURSHDQ*URXSIRUWKH
6WXG\RI,QVXOLQ5HVLVWDQFH (*,5 'LDEHWHV0HG
 Einhorn D, Reaven G, Cobin R. American College of Endocrinology position statement on the insulin resistance
V\QGURPH(QGRFULQ3UDFW
 $OEHUWL .* (FNHO 5+ *UXQG\ 60 HW DO +DUPRQL]LQJ WKH PHWDEROLF V\QGURPH $ MRLQW LQWHULP VWDWHPHQW RI
WKH ,QWHUQDWLRQDO 'LDEHWHV )HGHUDWLRQ 7DVN )RUFH RQ HSLGHPLRORJ\ DQG SUHYHQWLRQ 1DWLRQDO +HDUW /XQJ DQG
%ORRG ,QVWLWXWH$PHULFDQ +HDUW$VVRFLDWLRQ:RUOG +HDUW )HGHUDWLRQ ,QWHUQDWLRQDO$WKHURVFOHURVLV 6RFLHW\ DQG
,QWHUQDWLRQDO$VVRFLDWLRQIRUWKHVWXG\RIREHVLW\&LUFXODWLRQ
 Cameron AJ, Shaw JE, Zimmet PZ. The metabolic syndrome: prevalence in worldwide populations Endocrinol
0HWDE&OLQ1$P
17. )RUG(6*LOHV:+0RNGDG$+,QFUHDVLQJSUHYDOHQFHRIWKHPHWDEROLFV\QGURPHDPRQJ86DGXOWV'LDEHWHV&DUH

 /HUPDQ - (SLGHPLRORJtD GHO VtQGURPH PHWDEyOLFR (Q (QIRTXH LQWHJUDO GHO VtQGURPH PHWDEyOLFR GD HGLFLyQ
/HUPDQ-,JOHVLDV5 (GLWRUHV (GLWRULDO,QWHUPpGLFD%XHQRV$LUHV
19. Luquez H, De Loredo L, Madoery R, y col. Sndrome metablico: Prevalencia en dos comunidades de la provincia
GH&yUGRED$UJHQWLQDGHDFXHUGRFRQGHQLFLRQHV$73,,,\2065HY)HG$UJ&DUGLRO
 Piombo A, Gagliardi J, Blanco F y col. Prevalencia, caractersticas y valor pronstico del sndrome metablico en
ORVVtQGURPHVFRURQDULRVDJXGRV5HY$UJHQW&DUGLRO
 Hossain P, Kawar B, El Nahas M. Obesity and diabetes in the developing World. A Growing challenge N Engl J Med

 'DQLHOV65$UQHWW'.(FNHO5+HWDO2YHUZHLJKWLQFKLOGUHQDQGDGROHVFHQWVSDWKRSK\VLRORJ\FRQVHTXHQFHV
SUHYHQWLRQDQGWUHDWPHQW&LUFXODWLRQ
 /REVWHLQ7%DXU/DQG8DX\5,QWHUQDWLRQDO2EHVLW\7DVN)RUFH2EHVLW\LQFKLOGUHQDQG\RXQJSHRSOHDFULVLVLQ
SXEOLFKHDOWK2EHVLW\5HYLHZV 6XSSO 
 +DUZLF]3.RYDOVN\V,6tQGURPHPHWDEyOLFRHQQLxRV\DGROHVFHQWHV(Q(QIRTXHLQWHJUDOGHOVtQGURPHPHWDEyOLFR
GDHGLFLyQ/HUPDQ-,JOHVLDV5 (GLWRUHV (GLWRULDO,QWHUPpGLFD%XHQRV$LUHV
 Weiss R, Dziura J Burgert T et al. Obesity and the metabolic syndrome in children and adolescents. N Engl J Med

 1HHO-9'LDEHWHVPHOOLWXVDWKULIW\JHQRW\SHUHQGHUHGGHWULPHQWDOE\SURJUHVV"$P-+XP*HQHW

 Shepherd P, Kahn B. Mechanisms of disease: glucose transporters and insulin action. Implications for insulin
UHVLVWDQFHDQGGLDEHWHVPHOOLWXV1(QJO-0HG
 0XOOHU:LHODQG ' 7DXE 5 7HZDUL '6 HW DO ,QVXOLQ UHFHSWRU JHQH DQG LWV H[SUHVLRQ LQ SDWLHQWV ZLWK LQVXOLQ
UHVLVWDQFH'LDEHWHV
 7D\ORU6,&DPD'$FFLOL'HWDO0XWDWLRQVLQWKHLQVXOLQUHFHSWRUJHQ(QGRFU5HY
 0LNKDLO17XFN0/,QVXOLQDQGWKHYDVFXODWXUH&XUU+\SHUWHQV5HS
 6WRXW5:,QVXOLQDQGDWKHURPD\HDUSHUVSHFWLYH'LDEHWHV&DUH


CAPTULO 5 Impacto cardiovascular del sndrome metablico

 .XERNL.-LDQJ=<7DNDKDUD1HWDO5HJXODWLRQRIHQGRWKHOLDOFRQVWLWXWLYHQLWULFR[LGHVLQWKHWDVHJHQHH[SUHVVLRQ
LQHQGRWKHOLDOFHOOVLQYLYRDVSHFLFYDVFXODUDFWLRQRILQVXOLQ&LUFXODWLRQ
 &XVL . 0DH]RQR . 2VPDQ$ HW DO ,QVXOLQ UHVLVWDQFH GLIIHUHQWLDOO\ DIIHFWV WKH 3, NLQDVH DQG 0$3 NLQDVH
PHGLDWHGVLJQDOLQJLQKXPDQPXVFOH-&OLQ,QYHVW
 &DL + +DUULVRQ '* (QGRWKHOLDO G\VIXQFWLRQ LQ FDUGLRYDVFXODU GLVHDVHV 5ROH RI R[LGDQW VWUHVV &LUF 5HV 

 6MRKROP-1\VWURP7(QGRWKHOLDOLQDPPDWLRQLQLQVXOLQUHVLVWDQFH/DQFHW
 5LGNHU30+HQQHNHQV&+$OOHQ-HWDO3ODVPDFRQFHQWUDWLRQRIVROXEOHLQWHUFHOOXODUDGKHVLRQPROHFXOHDQGULVNV
RIIXWXUHP\RFDUGLDOLQIDUFWLRQLQDSSDUHQWO\KHDOWK\PHQ/DQFHW
 5LGNHU 30 5LIDL 1 6WDPSIHU 0 HW DO 3ODVPD FRQFHQWUDWLRQ RI LQWHUOHXNLQ DQG WKH ULVN RI IXWXUH P\RFDUGLDO
LQIDUFWLRQDPRQJDSSDUHQWO\KHDOWK\PHQ&LUFXODWLRQ
 5LGNHU 30 +LJKVHQVLWLYLW\ & UHDFWLYH SURWHLQ LQDPPDWLRQ DQG FDUGLRYDVFXODU ULVN IURP FRQFHSW WR FOLQLFDO
SUDFWLFHWRFOLQLFDOEHQHW$P+HDUW- 6XSSO 6
 Han T, Sattar N and Williams K. Prospective study of C-reactive protein in relation to the development of diabetes
DQGPHWDEROLFV\QGURPHLQWKH0H[LFR&LW\'LDEHWHV6WXG\'LDEHWHV&DUH
 1LHXZGRUS06WURHV(60HLMHUV-&HWDO+LSHUFRDJXODELOLW\LQWKHPHWDEROLFV\QGURPH&XUU2SL3KDUPDFRORJ\

 -XKDQ9DJXH,$OHVVL0&0DYUL$HWDO3ODVPLQRJHQDFWLYDWRULQKLELWRULQDPPDWLRQREHVLW\LQVXOLQUHVLVWDQFH
DQGYDVFXODUULVN-7KURPE+DHPRVW
 *RGVODQG ,) &URRN ' 6WHYHQVRQ -& HW DO +HPRVWDWLF ULVN IDFWRUV DQG LQVXOLQ VHQVLWLYLW\ UHJLRQDO ERG\ IDW
GLVWULEXWLRQDQGWKHPHWDEROLFV\QGURPH-&OLQ(QGRFULQRO0HWDE
 7XUKDQ$+HUYLD$<DVVDU$,PSDLUHGFRURQDU\EORRGRZLQSDWLHQWVZLWKPHWDEROLFV\QGURPH'RFXPHQWHGE\
7URPERO\VLVLQ0\RFDUGLDO,QIDUFWLRQ 7,0, IUDPHFRXQWPHWKRG$P+HDUW-
 6WHLQEHUJ'3DUWKDVDUDWK\6&DUHZ7(%H\RQGFKROHVWHURO0RGLFDWLRQVRIORZGHQVLW\OLSRSURWHLQWKDWLQFUHDVH
LWVDWKHURJHQLFLW\1HZ(QJO-0HG
 Brownlee M, Cerami A, Vlassara H. Advanced glycosylation end products in tissue and the biochemical basis of
GLDEHWLFFRPSOLFDWLRQV1HZ(QJO-0HG
 0F1HLOO$0 5RVDPRQG : *LUPDQ & 3UHYDOHQFH RI FRURQDU\ KHDUW GLVHDVH DQG FDURWLG DUWHULDO WKLFNHQLQJ LQ
SDWLHQWVZLWKWKHPHWDEROLFV\QGURPH 7KH$5,&6WXG\ $P-&DUGLRO
 6FXWHUL$1DMMDU60XOOHU'0HWDEROLFV\QGURPHDPSOLHVWKHDJHDVVRFLDWHGLQFUHDVHVLQYDVFXODUWKLFNQHVVDQG
VWLIIQHV-$P&ROO&DUGLRO
 Tzou WS, Douglas PS, Srinivasan SR et al. Increased subclinical atherosclerosis in young adults with metabolic
V\QGURPHWKH%RJDOXVD+HDUW6WXG\-$P&ROO&DUGLRO
 /HUPDQ-3XFKXOX)&RQWURYHUVLD([LVWHHOVtQGURPHPHWDEyOLFR"5HY$UJHQW&DUGLRO
 Kahn R, Buse J, Ferrannini E et al. The metabolic syndrome: time for a critical appraisal. Joint statement from
WKH$PHULFDQ'LDEHWHV$VVRFLDWLRQDQGWKH(XURSHDQ$VVRFLDWLRQIRUWKH6WXG\RI'LDEHWHV'LDEHWHV&DUH

 Pyorala K. Relationship of glucose tolerance and plasma insulin to the incidence of coronary heart disease: results
IURPWZRSRSXODWLRQVWXGLHVLQ)LQODQG'LDEHWHV&DUH
 Ducimetiere P, Eschwege E, Papoz L et al. Relationship of plasma insulin levels to the incidence of myocardial
LQIDUFWLRQDQGFRURQDU\KHDUWGLVHDVHPRUWDOLW\LQDPLGGOHDJHGSRSXODWLRQ'LDEHWRORJLD
 'HVSUpV -3 /DPDUFKH % 0DXULpJH 3 HW DO +\SHULQVXOLQHPLD DV DQ LQGHSHQGHQW ULVN IDFWRU IRU LVFKHPLF KHDUW
GLVHDVH1(QJO-0HG
 Facchini FS, Hua N, Abbasi F, et al. Insulin resistance as a predictor of age related diseases. J Clin Endocrinol Metab

 <LS-)DFFKLQL)65HDYHQ*05HVLVWDQFHWRLQVXOLQPHGLDWHGJOXFRVHGLVSRVDODVDSUHGLFWRURIFDUGLRYDVFXODU
GLVHDVH-&OLQ(QGRFULQRO0HWDE
 Piatti PM, Monti LD, Galli L et al. Relationship between endotelin-1 concentration and metabolic alteraction stypical
RIWKHLQVXOLQUHVLVWDQFHV\QGURPH0HWDE&OLQ([S
 Vicent D, Ilany J, Kondo T et al. The role of endothelial insulin signaling in the regulation of vascular tone and
LQVXOLQUHVLVWDQFH-&OLQ,QYHVW
 6KLQR]DNL$$\DMLNL.1LVKLR<HWDO(YLGHQFHRIDFDVXDOUROHRIUHQQLQDQJLRWHQVLQV\VWHPLQYDVFXODUGLVIXQFLyQ
DVVRFLDWHGZLWKLQVXOLQUHVLVWDQFH+\SHUWHQVLRQ
 )ROOL)6DDG0-9HOORVR/HWDO&URVVWDONEHWZHHQLQVXOLQDQGDQJLRWHQVLQ,,VLJQDOLQJV\VWHPV([S&OLQ(QGRFULQRO
'LDEHWHV
 5H[URGH.0&DUH\9-+HQQHNHQV&+HWDO$EGRPLQDODGLSRVLW\DQGFRURQDU\KHDUWGLVHDVHLQZRPHQ-$0$

 &DUH\9-:DOWHUV((&ROGLW]*$HWDO%RG\IDWGLVWULEXWLRQDQGULVNRIQRQLQVXOLQGHSHQGHQWGLDEHWHVPHOOLWXVLQ
ZRPHQ7KH1XUVHV+HDOWK6WXG\$P-(SLGHPLRO
 'DJHQDLV*5<L40DQQ-)%RVFK-HWDO3URJQRVWLFLPSDFWRIERG\ZHLJKWDQGDEGRPLQDOREHVLW\LQZRPHQDQG

77
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

PHQZLWKFDUGLRYDVFXODUGLVHDVH$P+HDUW-
 (PSDQD-3'XFLPHWLHUH3&KDUOHV0$HWDO6DJLWDODEGRPLQDOGLDPHWHUDQGULVNRIVXGGHQGHDWKLQDV\PSWRPDWLF
PLGGOHDJHGPHQWKH3DULV3URVSHFWLYH6WXG\&LUFXODWLRQ
 &RXWLQKR7*RHO.&RUUHDGH6D'HWDO&HQWUDOREHVLW\DQGVXUYLYDOLQVXEMHFWVZLWKFRURQDU\DUWHU\GLVHDVH
D V\VWHPDWLF UHYLHZ RI WKH OLWHUDWXUH DQG FROODERUDWLYH DQDO\VLV ZLWK LQGLYLGXDO VXEMHFW GDWD -$P &ROO &DUGLRO

 7UHYLVDQ0/LX-%KDVDV)6\QGURPH;DQGPRUWDOLW\$SRSXODWLRQEDVHGVWXG\5LVNIDFWRUDQG/LIH([SHFWDQF\
5HVHDUFK*URXS$P-(SLGHPLRO
 /DNND+0/DDNVRQHQ'(/DNND7$HWDO7KHPHWDEROLFV\QGURPHDQGWRWDODQGFDUGLRYDVFXODUGLVHDVHPRUWDOLW\
LQPLGGOHDJHGPHQ-$0$
 +X*4LDR27XRPLOHKWR-3UHYDOHQFHRIWKHPHWDEROLFV\QGURPHDQGLWVUHODWLRQWRDOOFDXVHDQGFDUGLRYDVFXODU
PRUWDOLW\LQQRQGLDEHWLF(XURSHDQPHQDQGZRPHQ$UFK,QWHUQ0HG
 0F1HLOO$05RVDPRQG:*LUPDQ&7KHPHWDEROLFV\QGURPHDQG\HDUULVNLQFLGHQWFDUGLRYDVFXODUGLVHDVHLQ
WKH$WKHURVFOHURVLV5LVN,Q&RPPXQLWLHVVWXG\'LDEHWHV&DUH
 5LGNHU30%XULQJ-(&RRN15HWDO&UHDFWLYHSURWHLQWKHPHWDEROLFV\QGURPHDQGULVNRILQFLGHQWFDUGLRYDVFXODU
HYHQWV$Q\HDUIROORZXSRILQLWLDOO\KHDOWK\DPHULFDQZRPHQ&LUFXODWLRQ
 :LOVRQ3'$JRVWLQR53DULVH+0HWDEROLFV\QGURPHDVDSUHFXUVRURIFDUGLRYDVFXODUGLVHDVHDQGW\SHGLDEHWHV
PHOOLWXV&LUFXODWLRQ
71. Schillaci G, Pirro M, Vaudo et al. Metabolic syndrome Is associated With aortic stiffness in untreated essential
K\SHUWHQVLRQ-$P&ROO&DUGLRO
 +XJJHWW5-%XUQV-0DFNLQWRVK$)HWDO6\PSDWKHWLFQHXUDODFWLYDWLRQLQQRQGLDEHWLFPHWDEROLFV\QGURPHDQGLWV
IXUWKHUDXJPHQWDWLRQE\K\SHUWHQVLRQ+\SHUWHQVLRQ
 Schillaci G, Pirro M, Vaudo G et al. Prognostic value of the metabolic syndrome in essential hypertension. J Am Coll
&DUGLRO
 *RUWHU 3 2OLMKRHN - *UDDI < 3UHYDOHQFH RI WKH PHWDEROLF V\QGURPH LQ SDWLHQWV ZLWK FRURQDU\ KHDUW GLVHDVH
FHUHEURYDVFXODUGLVHDVHSHULSKHUDODUWHULDOGLVHDVHRUDEGRPLQDODQHXU\VP$WKHURVFOHURVLV
 2OLMKRHN-*UDDI<%DQJD-7KHPHWDEROLFV\QGURPHLVDVVRFLDWHGZLWKDGYDQFHGYDVFXODUGDPDJHLQSDWLHQWVZLWK
FRURQDU\KHDUWGLVHDVHVWURNHSHULSKHUDODUWHULDOGLVHDVHRUDEGRPLQDODRUWLFDQHXU\VP(XU+HDUW-
 6ROLPRVV&%RXUDVVD0&DPSHDX/(IIHFWRILQFUHDVLQJPHWDEROLFVtQGURPHVFRUHRQDWKHURVFOHURWLFULVNSUROH
DQGFRURQDU\DUWHU\GLVHDVHDQJLRJUDSKLFVHYHULW\$P-&DUGLRO
77. 0DUURTXLQ2.LS..HOOH\'0HWDEROLFV\QGURPHPRGLHVWKHFDUGLRYDVFXODUULVNDVVRFLDWHGZLWKDQJLRJUDSKLF
FRURQDU\DUWHU\GLVHDVHZRPHQ&LUFXODWLRQ
 Isomaa B, Alegren P, Tuomi T. Cardiovascular rmorbidity and mortality associated with the metabolic sndrome.
'LDEHWHV&DUH
79. 0HQWH$<XVXI6,VODP6HWDO0HWDEROLFV\QGURPHDQGULVNRIDFXWHP\RFDUGLDOLQIDUFWLRQ$FDVHFRQWUROVWXG\
RIVXEMHFWVIURPFRXQWULHV-$P&ROO&DUGLRO
 *DPL$:LWW%+RZDUG'(UZLQ3HWDO0HWDEROLFV\QGURPHDQGULVNRILQFLGHQWFDUGLRYDVFXODUHYHQWVDQGGHDWK
-$P&ROO&DUGLRO
 0RWWLOOR6)LOLRQ.%*HQHVW-HWDO7KHPHWDEROLFV\QGURPHDQGFDUGLRYDVFXODUULVN$V\VWHPDWLFUHYLHZDQG
PHWDDQDO\VLV-$P&ROO&DUGLRO
 ,JOHVLDV5,PSDFWRFDUGLRYDVFXODUGHOVLQGURPHPHWDEROLFR(Q/HUPDQM,JOHVLDV5(QIRTXHLQWHJUDOGHOVtQGURPH
PHWDEyOLFRGDHGLFLyQ(GLWRULDO,QWHUPpGLFD%XHQRV$LUHV&DStWXORSiJLQD


&$3,78/2

MIOCARDIOPATA
HIPERTRFICA
C. SARA BERENSZTEIN

FRQWUiFWLO !YDULDQWHV  (QHODQiOLVLV


/D PLRFDUGLRSDWtD KLSHUWURFD 0+  IXH GHVFULSWD
LQLFLDOPHQWH HQ HO DxR  SRU HO 'U 7HDUH   \
de la secuencia de un gen de un paciente con MH
es mucho lo que ha evolucionado el conocimiento revel que una mutacin patognica en el gen de la
FDGHQD SHVDGD GH OD EHWDPLRVLQD 0<+$UJ 
GH HVWD SDWRORJtD HQ  PHGLR VLJOR (Q     VH
descubri que es una enfermedad de origen genti- *OQ  HUD HO UHVSRQVDEOH GH OD HQIHUPHGDG    (O
co autosmica dominante con penetrancia variable poder del anlisis de las mutaciones en MH reside en
\ XQD H[SUHVLyQ IHQRWtSLFD GH DPSOLR HVSHFWUR 6H
investigar miembros en riesgo de una misma familia
caracteriza por ser un proceso mioptico generaliza- \H[FOXLUDORVIDPLOLDUHVQRDIHFWDGRVDVtFRPRDQD-
do que compromete ambos ventrculos y aurculas, lizar fenocopias con diferentes historias naturales y
si bien predomina del lado izquierdo con alteracin opciones de tratamientos pero no sirve como estrate-
fundamentalmente de la funcin diastlica. La MH JLDFRQDEOHHQSUHGHFLUSURQyVWLFR/D0+HVXQD
se caracteriza por un ventrculo izquierdo hipertr- enfermedad autosmica dominante de penetrancia
FR JHQHUDOPHQWH VHSWDO  QR GLODWDGR HQ DXVHQFLD
UHODFLRQDGDFRQODHGDG JHQHUDOPHQWHODKLSHUWURD
de otra enfermedad cardaca o sistmica capaz de SXHGHQRHVWDUSUHVHQWHDQWHVGHODGpFDGD   
SURGXFLUOR SHMHVWHQRVLVYDOYXODUDyUWLFDRKLSHU-
Slo uno de los alelos heredados es defectuoso y el
WHQVLyQDUWHULDOVLVWpPLFD 6HREVHUYDHQGHFDGDotro es normal. El carcter dominante de la enferme-
LQGLYLGXRVHVGHFLUTXHODincidencia de la MH GDGVLJQLFDTXHFRQXQVRORDOHORDIHFWDGRSRUXQD
KLSHUWUyFDHVDSUR[LPDGDPHQWHDGHOD mutacin ya se puede provocar la enfermedad. Las
poblacin general que la convierte en la miocardio- mutaciones autosmicas dominantes son heredadas
pata gentica ms frecuente. Otra caracterstica es SRUHOGHORVKLMRV&DGDJHQHUDFLyQWLHQHDIHF-
lo heterogneo de la poblacin ya que vara desde el WDGRV \ WDQWR ORV YDURQHV FRPR ODV PXMHUHV SXHGHQ
paciente asintomtico hasta aquel muy comprometi- heredar y transmitir la enfermedad. En los casos es-
do con disnea, angor, palpitaciones y/o sncope con pordicos pueden deberse a mutaciones de novo en la
riesgo de muerte sbita. Debido a esto, la mortalidadpersona afectada que est ausente en la de los padres.
DQXDOYDUtDGHVGHXQDXQ  HQHVWH~OWLPR La gentica humana ha establecido que la MH
tipo de pacientes estudiado generalmente en centros se debe a las mutaciones proteicas dominantes que
HVSHFLDOL]DGRVHQPLRFDUGLRSDWtDKLSHUWUyFDDPH- comprenden el aparato contrctil o sarcmero, cau-
QRVGHOHQSDFLHQWHVDVLQWRPiWLFRV   sada por mutaciones en uno o varios genes que codi-
FDQGLIHUHQWHVFRPSRQHQWHVGHODSDUDWRFRQWUiFWLO
GENTICA la novedad es que en la actualidad se descubri que
puede deberse tambin a una anormalidad en el dis-
La MH es una enfermedad gentica del sarcmero co intercalado. Hoy en da se ha descubierto cerca
cardaco, causada por mutaciones en 11 o ms ge- GHGLIHUHQWHVPXWDFLRQHVHQJHQHVTXHFRGLFDQ
QHVTXHFRGLFDQGLIHUHQWHVFRPSRQHQWHVGHODSDUDWR las distintas protenas sarcomricas que enumerare-

79
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

mos a continuacin. En cuanto a la alteracin en el HOHMHUFLFLR\PXHUWHV~ELWDHQIDPLOLDUHVGHJUDGR


sarcmero, sta puede deberse a una alteracin en el Este ltimo parmetro es importante porque todos los
ODPHQWRQRRHQHOODPHQWRJUXHVRRHQHOGLVFR miembros afectados comparten una mutacin genti-
= /DV GHO ODPHQWR QR VRQ ODV PiV QXPHURVDV \ ca idntica que causa MH.
VRQGHELGDVD ODVFDGHQDVSHVDGDVGH miosina /DVJXtDVHQJHQpWLFDGHOD0+HVWDEOHFHQ
0<+ TXHWLHQHQKLSHUWURDYDULDEOH ODPLRVL- lo siguiente:
QDXQLGDDODSURWHtQD& 0<%3& TXHHVGHEXHQ Clase I
SURQyVWLFR   OD PLRVLQD GH FDGHQDV OLYLDQDV UHJX-  La evaluacin de la herencia familiar para un
ODWRULDV 0</ TXHHVWiDVRFLDGDDDUULWPLDVDXUL- HYHQWXDOFRQVHMRJHQpWLFRVHUHFRPLHQGDFRPR
FXODUHV ODPLRVLQDGHFDGHQDVOLYLDQDVHVHQFLDOHV parte de la aseveracin de la MH. (Nivel de Evi-
0</  FX\RV VtQWRPDV DXPHQWDQ FRQ OD GXUDFLyQ dencia: B)
GHODHQIHUPHGDG\ ODWLWLQD 771 DVRFLDGDFRQ  Los pacientes que realizan dicho estudio gen-
DUULWPLDVYHQWULFXODUHV/DVGHODPHQWRJUXHVRVRQ WLFR GHEHQ VHU DFRQVHMDGRV SRU H[SHUWRV HQ OD
GHELGDVD ODWURSRQLQD7 7117 JHQHUDOPHQWH gentica de enfermedad cardiovascular para una
QRGDVtQWRPDVWLHQHSRFDRQLQJXQDKLSHUWURD\HV FRUUHFWD YDORUDFLyQ FRQMXQWD FRQ HO SDFLHQWH
ODPiVSHOLJURVD ODWURSRQLQD, 7117 DVRFLDGD (Nivel de Evidencia: B)
DLQVXFLHQFLDFDUGtDFD ODDWURSRPLRVLQD 730   El screening clnico con o sin test gentico es re-
que es de relativa benignidad y se observa el comien- comendable en familiares de primer grado con
]RGHODHQIHUPHGDGUHFLpQHQDQFLDQRV\ ODDFWLQD riesgo de desarrollar MH. (Nivel de Evidencia: B)
$&7& DVRFLDGDDOD0+DSLFDO/DVGHOGLVFR=  El test gentico para MH y otras causas genti-
VRQ GH UHFLHQWH GHVFXEULPLHQWR \ VRQ GHELGDV D   FDVGHKLSHUWURDFDUGtDFDLQH[SOLFDEOHVHUHFR-
ODSURWHtQDPXVFXODU/,0 &653 DVRFLDGDDKLSHU- mienda en pacientes con una presentacin clni-
WURDYDULDEOH\DPLRSDWtDHVTXHOpWLFD ODWHOHWR- ca atpica o cuando se sospecha otra condicin
QLQD 7&$3 \ ODPLR]HQLQD 0<2= HVWDV gentica. (Nivel de Evidencia: B)
~OWLPDVDVRFLDGDVDKLSHUWURDYDULDEOH(QWUHHVWRV Clase IIa
JHQHVODVPXWDFLRQHVGHODGH0<+\OD0<3%&  El test gentico es razonable para facilitar la
VRQODVPiVIUHFXHQWHV\GHODV0+VHGHEHQ LGHQWLFDFLyQGHIDPLOLDUHVGHSULPHUJUDGRFRQ
D HOODV GRV 0LHQWUDV TXH ODV GHELGDV D 7117 ULHVJRGHGHVDUUROODU0+ 1LYHOGH(YLGHQFLD
711,$&7& 730 0</ \ 0</  HQ IRUPD %
FRQMXQWDUHSUHVHQWDQPHQRVGHOGHWRGDVODV Clase IIb
0+/DHQIHUPHGDGSXHGHHVWDUDXVHQWHHQORVMyYH-  La utilidad del test gentico para la aseveracin
QHVSHURFRQODHGDGKD\H[SUHVLyQSURJUHVLYDGHOD del riesgo de muerte sbita en MH es incierto.
histopatologa debida a la diferente penetrancia. Las 1LYHOGH(YLGHQFLD%
GLIHUHQWHVSDWHQWHVPRUIROyJLFDVGHKLSHUWURDGHOD Clase III6LQEHQHFLR
0+ DVLPpWULFDFRQFpQWULFDRDSLFDO QRVHUHODFLR-  No se recomienda el estudio gentico en fami-
QDQFRQHOJHQRWLSRVXE\DFHQWHFRQODH[FHSFLyQGH liares de un paciente que no tenga una mutacin
una nica mutacin de la actina que uniformemente SDWRJpQLFDGHQLGD 1LYHOGH(YLGHQFLD%
SURGXFH KLSHUWURD DSLFDO 6H GHEH UHPDUFDU TXH OD  No se recomienda el estudio gentico en fami-
posibilidad de obtener un test positivo en la persona liares de pacientes con MH con genotipo negati-
DIHFWDGD HV GH VyOR HO  SRUTXH WRGDYtD QR KDQ YRV 1LYHOGH(YLGHQFLD%
VLGR LGHQWLFDGRV WRGRV ORV JHQHV TXH FDXVDQ 0+
En los casos con mutaciones raras an no se puede PACIENTES CON GENOTIPO
prever el curso benigno o maligno de la enfermedad POSITIVO / FENOTIPO NEGATIVO
 (QUHDOLGDGODHVWUDWLFDFLyQGHULHVJRFRQPDU-
FDGRUHVFOtQLFRVRHFRFDUGLRJUiFRVFRQYHQFLRQDOHV Clase I
ha sido de mayor utilidad para ver que pacientes se En individuos con mutaciones patognicas que no
EHQHFLDUtDQ FRQ OD WHUDSLD GHO FDUGLRGHEULODGRU H[SUHVDQ HO IHQRWLSR SDUD 0+ VH UHFRPLHQGD UHD-
 (VWRVSDUiPHWURVFOtQLFRVWUDGLFLRQDOHVTXHGH- lizar electrocardiogramas seriados, ecocardiogra-
QHQDORVSDFLHQWHVFRQULHVJRDXPHQWDGRGHPXHUWH mas y revisaciones clnicas a intervalos peridicos
sbita incluyen sncope, gradientes muy aumentados FDGDDPHVHVHQFKLFRV\DGROHVFHQWHV\FDGD
GHO WUDFWR GH VDOLGD GHO YHQWUtFXOR L]TXLHUGR  DxRVHQDGXOWRV EDVDGRVHQODHGDGGHOSDFLHQWH\
PP+J KLSHUWURDPDVLYDGHOYHQWUtFXORL]TXLHUGR VXFDPELRHQHOHVWDWXVFOtQLFR 1LYHOGH(YLGHQFLD
JURVRUSDULHWDOPP KLSRWHQVLyQLQGXFLGDSRU %  


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

0DURQHWDO  GLVFXWHQODJHQpWLFDGHOD0+HQ   /RV DXWRUHV VXJLHUHQ TXH SDUD WHQHU FRQDQ]D
ORV~OWLPRVDxRV\ORUHVXPHQHQSXQWRV en el resultado de los tests genticos se requiere
1. La MH es una enfermedad cardaca de origen que la interpretacin de las mutaciones sean es-
IDPLOLDU FRQ XQD SUHYDOHQFLD GH  /D 0+ tandardizadas
WLHQHXQDH[SUHVLyQIHQRWtSLFDKHWHURJpQHDTXH
se hereda con una patente autosmica dominante ANATOMA PATOLGICA
con penetrancia variable.
 ([LVWHQ  PiV GH  JHQHV FDXVDOHV TXH FRQWLH- (OFRUD]yQHQOD0+HVWDDXPHQWDGRGHWDPDxRJH-
QHQPiVGHPXWDFLRQHVTXHFRGLFDQODV neralmente al doble de lo normal con aumento de la
SURWHtQDV GH ORV PLRODPHQWRV QRV \ JUXHVRV PDVDPLRFiUGLFDFRQODH[FHSFLyQGHOD0+DSLFDO
GHO VDUFyPHUR \ GHO GLVFR = 0iV GHO  GH en el que est casi normal. En aquellos casos de MH
las MH con test genticos positivos tienen mu- y muerte sbita, el corazn puede aparecer normal en
WDFLRQHV HQ HO 0<+ FDGHQDV SHVDGDV GH OD la macroscopa y en el peso pero con una histologa
PLRVLQD RHQHO0%3& ODPLRVLQDXQLGDD DQRUPDOSXHVHOSDFLHQWHQRYLYLyHOWLHPSRVXFLHQ-
ODSURWHLQD&  te para desarrollar la MH en forma completa. Como
 /DVPXWDFLRQHVLGHQWLFDGDVFRQHOWHVWJHQpWLFR VHVDEHODKLSHUWURDYHQWULFXODUHVXQSUHGLFWRUGH
pueden ser consideradas patognicas, no patog- PXHUWH V~ELWD  (Q OD 0+ OD KLSHUWURD SXHGH VHU
QLFDVRXQDYDULDQWHFRQVLJQLFDGRLQFLHUWR/DV simtrica pero lo habitual es que sea asimtrica en
mutaciones pueden moverse de una categora a PiVGHOFRQXQDUHODFLyQVHSWDOSDUHGOLEUHGH
otra a medida que la ciencia evolucione. DDGHPiVSXHGHWHQHURQRREVWUXFFLyQGHO
 Los test genticos pueden ayudar en diagnsti- tracto de salida del ventrculo izquierdo. De las for-
FRVDPELJXRVGHKLSHUWURDFDUGtDFDFRPRSDUD PDVDVLPpWULFDVODPiVFRP~QHVODEDVDOHQXQ
diferenciar MH de hipertensin o corazn de at- VHJXLGDOXHJRSRUODDSLFDOHQXQ\ODPHVRYHQ-
OHWD6LQHPEDUJRHQHVWRVWHVWVVyORHOGH WULFXODUHQXQ:LJOHHWDO  ODFODVLFDVHJ~Q
los pacientes con MH tienen un test positivo y HOOXJDUGHODKLSHUWURDVHSWDOHQWLSRV EDVDO
uno negativo no es concluyente.  EDVDO\PHGLD WRGRHOVHSWXP0DURQ  OR
 El screening de los miembros de una familia con KDFH HQ  WLSRV ,  OD KLSHUWURD VROR FRPSURPHWH
MH conocida debe comenzar con un chequeo HOVHJPHQWRDQWHULRUGHOVHSWXP XVXDOPHQWHHQOD
FOtQLFR HOHFWURFDUGLRJUDPD \ HFRFDUGLRJUDPD  EDVH  ,,  WRGR HO VHSWXP ,,,  HO VHSWXP \ OD SDUHG
SDUD LGHQWLFDU ORV IHQRWLSRV SRVLWLYRV (O WHVW OLEUH\QDOPHQWHHO,9 TXHFRPSURPHWHFXDOTXLHU
gentico puede ser til en los fenotipos nega- segmento del ventrculo salvo el septum anterior ba-
tivos siempre y cuando tengan un gen alterado sal. A nivel histolgico se comprueba el disarray
conocido. GH EUDV  TXH FRPSURPHWH HVSHFLDOPHQWH OD UHJLyQ
 Puede darse un test gentico falsamente negativo septal con mala alineacin de los miocitos que estn
FRQ 0+ IHQRWtSLFD SRVLWLYR  SRUTXH WLHQH XQD aumentados y ensanchados con un grado superior al
mutacin an desconocida y al revs ser falsa- \VXSHULRUDOHQHVSHFtPHQHVGHQHFURS-
mente positivo si es asignado a una variante con VLD PX\ SRU HQFLPD GHO  QRUPDO (Q DOUHGHGRU
VLJQLFDGRLQFLHUWRFXDQGRHQUHDOLGDGQRHV0+ GHOGHORVFDVRVODKLSHUWURDHVUHHPSOD]DGD
7. Los miembros de la familia que son genotipos SRUEURVLVFLFDWUL]DOTXHIDYRUHFHODGLODWDFLyQFD-
positivos pero fenotipos negativos es decir no vitaria. De las vlvulas, la mitral suele ser anormal
WLHQHQ KLSHUWURD GHO 9, HQ HO HFRFDUGLRJUDPD en los casos de obstruccin del tracto de salida del
deben ser estudiados a lo largo de la vida hasta ventrculo izquierdo en especial la valva anterior que
la edad adulta para ver cuando presentan estas suele estar engrosada y elongada con respecto a la
alteraciones. En la actualidad, en las guas, a este SRVWHULRUWDPELpQSXHGHQH[LVWLUDQRUPDOLGDGHQHO
JUXSRGHSDFLHQWHVQRVHORVH[FOX\HGHODSUiF- aparato valvular mitral y en los msculos papilares
tica deportiva.  (OYHQWUtFXORGHUHFKRSXHGHFRPSURPHWHUVHVR-
 Las mutaciones no pronostican la severidad de EUHWRGRHQODFDUDSRVWHULRUFHUFDQDDOiSH[SXHGH
la MH. H[LVWLU WDPELpQ REVWUXFFLyQ GHO WUDFWR GH VDOLGD GHO
9. Los pacientes a los cuales se les hace un test GLFKRYHQWUtFXOR([LVWHSRURWUDSDUWHDQRPDOtDVGH
gentico en caso de ser positivo deben recibir las coronarias intramurales con engrosamiento de la
soporte psicolgico y no ser discriminados para PHGLD DUWHULDO HQ PiV GHO  FRQ FRURQDULDV HSL-
WUDEDMRV R VHJXURV DXQTXH HVWR QR VH DSOLFD DO crdicas normales especialmente en la zona septal y
rea militar. HQHVWDGtRVFRQXQPD\RUJUDGRGHEURVLV(QQLxRV


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

puede observarse puentes musculares en la zona de la GHOFRQVXPRGH2SRUDXPHQWRPDUFDGRGHODPDVD


descendente anterior que suelen estar asociados con muscular sin el correspondiente aumento de las co-
PD\RUULHVJRGHPXHUWHV~ELWD   URQDULDV   HQIHUPHGDG GH ORV SHTXHxRV YDVRV por
anomalas de las coronarias intramurales con engro-
FISIOPATOLOGA VDPLHQWRGHODPHGLDDUWHULDO SXHQWHVFRURQDULRV
HVSHFLDOPHQWHHQQLxRV REVWUXFFLyQGHOWUDFWRGH
6HSHQVDEDTXHOD0+HUDQRREVWUXFWLYDHQXQ VDOLGD GHO YHQWUtFXOR L]TXLHUGR \   GLVPLQXFLyQ GH
 GH ORV FDVRV \ REVWUXFWLYD HQ HO  GH ORV UHV- ODGLVWHQVLEOLGDGGHOYHQWUtFXORL]TXLHUGRTXHGLFXO-
WDQWHVSHURHQXQHVWXGLRGH0DURQHWDO  VHGH- tara el lleno coronaria que se realiza principalmente
PRVWUyTXHDOUHGHGRUGHOGHORVSDFLHQWHVFRQ HQGLiVWROH 
MCH presentaban obstruccin en reposo o latente. En la MH obstructiva por la estrechez del tracto
/D FDUDFWHUtVWLFD VLRSDWROyJLFD FRP~Q D DPEDV HV de salida ventricular izquierdo causada por la hiper-
TXHH[LVWHXQOOHQRGLDVWyOLFRDOWHUDGRFRQDXPHQWR WURDVHSWDOHQHOWLSREDVDO\HOGHVSOD]DPLHQWRDQ-
de la presiones diastlicas tanto por una distensibi- terior de la valvas mitrales y los msculos papilares
lidad disminuda debido a un aumento de la masa al circular la sangre se genera un efecto de succin o
muscular, una disminucin del volumen ventricular Venturi que produce un movimiento anterior sistlico
\XQDXPHQWRGHODULJLGH]PXVFXODUSRUODEURVLV de la valva anterior mitral que causa la obstruccin
miocrdica como asimismo por una alteracin de la subartica. Aunque en la actualidad se piensa que
UHODMDFLyQYHQWULFXODUTXHSDUDDOJXQRVHVHOFRPSR- una fuerza hidrodinmica drag o la fuerza de em-
QHQWHPiVLPSRUWDQWH ). ([LVWHXQDXPHQWRGHOD SXMHHVHOPHFDQLVPRGRPLQDQWH   Luego, ms
Dp/ Dv, es decir la curva de presin volumen vira tarde en la sstole, la sangre que queda en el ventrcu-
KDFLD DUULED \ D OD L]TXLHUGD   (Q OD 0+ H[LVWH lo presiona y vence la obstruccin tal cual se observa
XQDDOWHUDFLyQGHOFDOFLRSRUXQUHXSWDNHDOWHUDGR HQHOSXOVRFDURWtGHRTXHHVGLJLWLIRPHRHQEDGDMR
del mismo por el retculo sarcoplasmtico que est de campana con una onda rpida inicial ms elevada
DXPHQWDGR(VWRFRQMXQWDPHQWHFRQODQRXQLIRUPL- \XQDVHJXQGDRQGDPiVEDMD3RU~OWLPRODLQVX-
GDGFRQWULEX\HDODUHODMDFLyQDOWHUDGDTXHDVXYH] ciencia mitral se producira porque en sstole la valva
genera un aumento compensatorio del llenado sist- anterior est desplazada hacia el septum y no coapta
OLFRGHODDXUtFXOD\SURGXFHXQUXLGRPX\DXGLEOH FRQODSRVWHULRU 
Con el tiempo, la aurcula se dilata y conduce a una
EULODFLyQDXULFXODUFRQXQVHYHURGHWHULRURKHPRGL- SNTOMAS Y EXAMEN FSICO
nmico por la importancia de la sstole auricular en
SUHVHQFLDGHXQDUHODMDFLyQDOWHUDGD0iVWDUGHHQOD Los sntomas de la MH son similares a los de la este-
evolucin sobreviene un tipo restrictivo de llenado nosis artica sintomtica: disnea, angor y sncope. La
diastlico en las cuales las presiones auriculares se GLVQHDVHJHQHUDUtDFRPR\DIXHH[SOLFDGRHQVLR-
encuentran elevadas y se genera un aumento del vo- patologa por disfuncin diastlica del ventrculo iz-
OXPHQHQODIDVHGHOOHQDGRUiSLGRTXHJHQHUDXQ quierdo con aumento de las presiones de llenado au-
UXLGRDXGLEOH  rcular izquierda y congestin venocapilar pulmonar.
La funcin sistlica en la MH es normal o supra El angor por isquemia miocrdica con sus diferentes
normal con fraccin de eyeccin aumentada en todas PHFDQLVPRV\DUHIHULGRV\HOVtQFRSHDFRPSDxDGR
las formas de MH obstructiva o no obstructiva aun- o no de palpitaciones por isquemia miocrdica, ta-
que en la fase terminal de la MH puede alterarse dicha quiarritmia auricular y/o ventricular o ms raramente
funcin en ambos ventrculos como consecuencia de bradiarritmias como el bloqueo aurculoventricular
ODEURVLVPLRFiUGLFDTXHFRQOOHYDDDGHOJD]DPLHQWR completo y por ltimo por obstruccin del tracto de
parietal, prdida del gradiente obstructivo, dilatacin salida del ventrculo izquierdo que puede degenerar
moderada del ventrculo con aumento del volumen de HQSDURFDUGtDFR  (QHOH[DPHQItVLFRVHSDOSD
QGHVtVWROH(VWRSXHGHGHEHUVHDOSURJUHVRGHOWH- XQSXOVRFDURWtGHRGLJLWLIRUPHRHQEDGDMRGHFDPSD-
MLGRFRQHFWLYRFRPRFRPSOLFDFLyQSRVRSHUDWRULDR na que debe ser palpado suavemente para evitar co-
SRULVTXHPLDPLRFiUGLFDSRULQIDUWRGHORVSHTXHxRV ODSVDUODSULPHUDRQGDTXHHVUiSLGD(VWHSXOVRMXQWR
vasos y ms raramente por enfermedad aterosclerti- DOELVIHULHQVVRQORV~QLFRVSXOVRVDGREOHRQGDVLV-
FDGHODVFRURQDULDVHSLFiUGLFDV  /DLVTXHPLD tlica que debe ser diferenciados entre s ya que este
miocrdica ha sido observada en ambas formas de ~OWLPRGHELGRDODLQVXFLHQFLDDyUWLFDJUDYHVHSDO-
MH con comprobacin del aumento del lactato mio- SDPHMRUHQODDUWHULDKXPHUDO/RLPSRUWDQWHHQOD
FiUGLFR6HSXHGHGHEHUDYDULDVUD]RQHV DXPHQWR 0+HVTXHDGHPiVGHO\UXLGR HVWH~OWLPRHQ


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

HVWDGtRVDYDQ]DGRV HQODVIRUPDVREVWUXFWLYDVTXH ERHPEROLVPR LQVXFLHQFLD FDUGtDFD EDMR YROXPHQ


son basales se ausculta un soplo sistlico eyectivo en minuto y muerte. Es la arritmia ms frecuentemente
la regin mesocrdica que se caracteriza por aumen- REVHUYDGDHQOD 0+ /RV HSLVRGLRVSDUR[tVWLFRVGH
WDU ODREVWUXFFLyQWDPELpQ FRQODGLVPLQXFLyQGHOD EULODFLyQ DXULFXODU SURGXFHQ XQ UiSLGR GHWHULRUR
pre y poscarga y el aumento de la contractilidad. Es clnico al reducir el llenado diastlico con un des-
as que las situaciones que disminuyen la precarga censo marcado del volumen minuto, especialmente
como sentarse o pararse, la fase de presin de la ma- HQODVIRUPDVREVWUXFWLYDVHQJHQWHMRYHQPHQRUHVGH
niobra de Valsalva y medicamentos como los nitritos DxRV6HDVRFLDQFRQHPEROLDVSHULIpULFDVFRQXQD
y diurticos aumentan el soplo. Estas maniobras son LQFLGHQFLDGHDQXDOSRUORTXHHOSDFLHQWHGHEH
tiles para diferenciarlo del soplo de la estenosis ar- ser debidamente anticoagulado. La amiodarona es la
tica pues en esta ltima disminuye el soplo al sentar- droga de eleccin tras una efectiva anticoagulacin,
se o pararse y con la fase de presin de la maniobra PLHQWUDVTXHORVEORTXHDQWHV\HOYHUDSDPLORFRQ-
de Valsalva. Asimismo, el soplo de la MH obstructi- WURODQHIHFWLYDPHQWHODIUHFXHQFLDFDUGtDFD  (Q
va aumenta con la disminucin de la poscarga por lo XQ  R PHQRV SXHGH DVRFLDUVH FRQ XQ VtQGURPH
que no pueden ser utilizados vasodilatadores como GH:ROI3DUNLQVRQ:KLWH\WHUPLQDUXQDEULODFLyQ
los inhibidores de la enzima convertidora, sartanes y DXULFXODUHQYHQWULFXODU  'HODVYHQWULFXODUHVOD
EORTXHDQWHV FiOFLFRV FRQ H[FHSFLyQ GHO YHUDSDPLOR WDTXLFDUGLD YHQWULFXODU QR VRVWHQLGD RFXUUH HQ 
por su escasa accin vasodilatadora. Por ltimo, el de los casos y es un predictor de muerte sbita en
soplo aumentara con el aumento de la contractilidad DGXOWRV/DWDTXLFDUGLDYHQWULFXODUPRQRPyUFDRFX-
por lo que no se pueden utilizar en esta patologa, di- rre muy raramente. El sustrato que la favorece es el
gital o inotrpicos en general y estara contraindica- GLVDUUD\ GH EUD PLRFiUGLFD OD LVTXHPLD PLRFiUGL-
GDODSUiFWLFDGHHMHUFLFLR7DPELpQVHDXVFXOWDXQVR- ca, cuando est presente la obstruccin del tracto de
SORGHLQVXFLHQFLDPLWUDOSRUODIDOWDGHFRDSWDFLyQ salida del ventrculo izquierdo y la disfuncin auto-
GHODYDOYDDQWHULRUGHODPLWUDOHQVtVWROH GHELGRDO QyPLFDSHULIpULFD  6LELHQVHSXHGHQXWLOL]DU
movimiento anterior sistlico que lo succiona al sep- bloqueantes y amiodarona, en la actualidad el cardio-
WXP SHURHVGHQRWDUTXHHVWHVRSORGLVPLQX\HFRQOD GHEULODGRULPSODQWDEOHHVODWHUDSLDGHHOHFFLyQHQ
disminucin de la pre y poscarga a diferencia del so- pacientes con alto riesgo de muerte sbita. Por otra
SORREVWUXFWLYR  /DVIRUPDVPHVRYHQWULFXODU SDUWHHOHMHUFLFLRLQWHQVR puede desencadenar muerte
y apical tiene una clnica similar a las no obstructivas V~ELWD  .
FRQXQDPHMRUHYROXFLyQ3RUFLHUWRODDSLFDOSXHGH
complicarse con un aneurisma apical. ELECTROCARDIOGRAMA
Las complicaciones de la MH son: LQVXFLHQFLD
cardaca congestiva, muerte sbita, arritmias, blo- Si bien el electrocardiograma puede ser normal en la
queo aurculoventricular completo y endocarditis 0+HOGHORVSDFLHQWHVSRUWDGRUHVGHXQDPLR-
LQIHFFLRVD /D LQVXFLHQFLD FDUGtDFD HV IXQGDPHQ- FDUGLRSDWtDKLSHUWUyFDSUHVHQWDQDOJXQDDOWHUDFLyQ
talmente izquierda aunque puede ser global con sig- HOHFWURFDUGLRJUiFDQRSDWRJQRPyQLFD/RVFULWHULRV
nos derechos en casos de compromiso de la MH del HOHFWURFDUGLRJUiFRVSXHGHQVHUPD\RUHVRPHQRUHV
lado derecho. En estos casos adems de los edemas,  /RVSULPHURVVRQ
ingurgitacin yugular, etc, el pulso venoso se carac- 1. Signos de agrandamiento del ventrculo izquier-
teriza por una onda a aumentada que no siempre es do con cambios en la repolarizacin ventricular
indicador de hipertensin pulmonar sino puede de- )LJXUDV\
berse a obstruccin del tracto de salida del ventrcu-  2QGDV7QHJDWLYDVFRQDPSOLWXGGHPPHQODV
lo derecho. La endocarditis infecciosa se produce derivaciones I y aVL, con un ngulo entre los
especialmente sobre la valva anterior generalmente HMHV HOpFWULFRV GHO FRPSOHMR 456 \ GH OD RQGD
redundante que erosiona la regin basal septal al 7GHJUDGRVGH9D9RPP\HQODV
succionarse por efecto Venturi al septum y puede de- GHULYDFLRQHV,,,,,\D9)GHPP )LJXUD
rivar en una vegetacin tanto sobre la valva mayor  2QGDV4DQRUPDOHV GXUDFLyQPD\RUGHPVHJ
de la mitral como sobre el septum interventricular. RDPSOLWXGPD\RUGHOGHOYROWDMHGHODRQGD
En cuanto a las arritmias, las bradiarritmias son me- R en por lo menos dos derivaciones. Los crite-
nos frecuentes que las taquiarritmias Estas ltimas ULRV PHQRUHV VRQ  EORTXHR FRPSOHWR GH UDPD
pueden ser supra y ventriculares. De las primeras, la o alteraciones de la conduccin intraventricular
EULODFLyQDXULFXODUHVXQDDUULWPLDPX\ULHVJRVDHQ HQ ODV GHULYDFLRQHV TXH H[SORUDQ HO YHQWUtFXOR
la MH porque se asocia con un aumento del trom- L]TXLHUGR DOWHUDFLRQHVOHYHVGHODUHSRODUL]D-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 6.1. Electrocardiograma en donde se visualiza hipertroa ventricular izquierda en una paciente con MH tipo 2 de Maron

Figura 6.2. Electrocardiograma en donde se visualiza hipertroa ventricular izquierda en una paciente con MH tipo 3 y trastor-
nos de la repolarizacin ventricular en cara anterior compatible con isquemia.

cin ventricular en las derivaciones precordiales RADIOGRAFA DE TRAX


L]TXLHUGDV\ RQGD6SURIXQGDHQ9 !PP 
Adems pueden observarse ondas P con agranda- /DUDGLRJUDItDGHWyUD[SXHGHVHUQRUPDOSHURHQORV
PLHQWRDXULFXODUL]TXLHUGR\GHUHFKRH[WUDVtVWR- FDVRVDYDQ]DGRVFRQFOtQLFDGHLQVXFLHQFLDFDUGtDFD
les ventriculares prematuras o arritmias ventricu- VXHOHYLVXDOL]DUVHUHGLVWULEXFLyQSXOPRQDU(ODUFR
ODUHV FRPSOHMDV WDTXLFDUGLDV VXSUDYHQWULFXODUHV suele ser normal o levemente aumentado pero puede
DOHWHR \R EULODFLyQ DXULFXODU  \ EUDGLDUULWPLDV REVHUYDUVH SRU GLODWDFLyQ DXULFXODU L]TXLHUGD XQ 
 &XDQWRPiVH[WHQVRHVODKLSHUWURDPD\RU DUFR\FXDQGRH[LVWHKLSHUWHQVLyQSXOPRQDUXQDUFR
HVODDOWHUDFLyQHOHFWURFDUGLRJUiFDWDOHVDVtTXH PHGLRFRQYH[R  
HOWLSR,,,GH0DURQ )LJXUD HVHOTXHPiV
KLSHUWURD WLHQH HQ HO HOHFWURFDUGLRJUDPD PLHQ- ECOCARDIOGRAFA-DOPPLER
tras que el tipo IV que no tiene compomiso sep-
tal anterior suele presentar ondas q patolgicas. El eco Doppler es el estudio complementario ms
Por ltimo se debe resaltar que la miocardiopata FRPSOHWRDQDWyPLFR\VLROyJLFRSDUDOD0+SXHV
KLSHUWUyFDDSLFDOVXHOHWHQHURQGDV7QHJDWLYDV SHUPLWH YLVXDOL]DU OD KLSHUWURD OD H[WHQVLyQ \ HO
gigantes que impresionan isqumicas de ms de WLSR FODVLFDFLyQ GH :LJJOH R 0DURQ  OD REVWUXF-
PPSHURH[LVWHQIRUPDVIUXVWUDVFRQSURIXQGL- cin, la disfuncin diastlica y el grado y forma de la
GDGGHKDVWDPP   LQVXFLHQFLDPLWUDODVtFRPRSHUPLWHHOVHJXLPLHQ-


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

to posoperatorio y de la ablacin septal con etanol o de la. miocardiopata dilatada. En la MH obstructiva


marcapasos. se comprueba el movimiento anterior sistlico tanto
El eco modo M y el bidimensional permite com- HQ PRGR 0  )LJXUD   \ ELGLPHQVLRQDO FX\D -
SUREDUODKLSHUWURDHQXQYHQWUtFXORSULQFLSDOPHQWH siopatologa fue previamente analizada y el colapso
L]TXLHUGR FRQ XQ JURVRU VHSWDO  PP HQ DXVHQ- mesosistlico artico con temblor grueso visualizado
cia de otra enfermedad sistmica o cardaca capaz HQHOQLYHOSRUODREVWUXFFLyQ )LJXUD 
GH SURGXFLU HVH QLYHO GH KLSHUWURD (Q ODV IRUPDV
asimtricas que como ya se mencion son las ms
frecuentes la relacin entre septum y pared posterior
HV PD\RU GH   7DPELpQ SHUPLWH FRPSUREDU
ORVGLIHUHQWHVWLSRVGH0+ FODVLFDFLyQGH:LJJOH\
0DURQ\DPHQFLRQDGDV  )LJXUD (VLPSRUWDQWH
UHFRQRFHUTXHODKLSHUWURDDVLPpWULFDHQVtPLVPD
no es patognomnica de la MH y puede ser visuali-
zada en diferentes enfermedades como hipertensin
arterial, estenosis artica, amiloidosis, enfermedad
GH)DEU\DWD[LDGH)ULHGUHLFK\GHSRVLWRGHPXFRSR-
OLVDFiULGRV  $PHGLGDTXHSURJUHVDODHQIHUPH-
dad se comprueba dilatacin de la aurcula izquier-
da mientras que la fraccin de eyeccin permanece
VLHPSUHQRUPDORVXSUDQRUPDOFRQODH[FHSFLyQGH
la evolucin a la fase terminal de la MH en que se Figura 6.5. Ecocardiograma modo M nivel 4. Se visualiza cie-
deteriora la misma con dilatacin del ventrculo iz- rre mesosistlico artico en MH.
quierdo que no suele ser tan marcada como en el caso

En el eco Doppler se evidencia una patente de


UHWUDVRHQODUHODMDFLyQ WLHPSRGHUHODMDFLyQLVRYR-
lmico alargado, relacin E/A menor de 1, tiempo
GHGHVDFHOHUDFLyQSURORQJDGR HQWRGDVODV0+SUR-
GXFLGRSRUODDOWHUDFLyQGHODUHODMDFLyQHQHOPLR-
FDUGLRKLSHUWUyFR(OGHVFHQVRGHODSUHVLyQYHQ-
tricular izquierda despus del cierre artico es ms
lenta y a medida que el ventrculo izquierdo es me-
nos distensible y la presin de la aurcula izquierda
se eleva, aumenta la onda E y se acorta el tiempo de
desaceleracin. Sin embargo, el mismo grado de au-
mento de la presin en la aurcula izquierda no pro-
duce un acortamiento del tiempo de desaceleracin
Figura 6.3. Ecocardiograma bidimensional en eje transversal
a nivel de la vlvula mitral. Se visualiza hipertroa septal an- en la MH como lo hace en la miocardiopata dilata-
terior y posterior (tipo 2 de Maron) da, debido a que en la MH el tiempo de desacelera-
cin es ms alargado basalmente por lo que puede
SHUVLVWLUFRQXQDSDWHQWHGHUHWUDVRHQODUHODMDFLyQ
an cuando las presiones de llenado estn elevadas.
Tambin la velocidad de propagacin en el modo M
color no es tan til en la MH como lo es en la mio-
cardiopata dilatada. Es por esto que esta situacin
HVPHMRUUHHMDGDSRUODRQGD$UHYHUVDSURORQJDGD
de las venas pulmonares con respecto a la duracin
GHODRQGD$PLWUDO  \SRUODUHODFLyQ(( GHO
'RSSOHUWLVXODU DXQTXHKDKDELGRXQDSXEOLFDFLyQ
HQODTXHODFRUUHODFLyQGHXQD((!GHQRSUH-
Figura 6.4. Eco modo M en nivel 2 (mitral). La echa indica el deca un aumento de las presiones de llenado > de
movimiento anterior sistlico en una MH obstructiva. PP+JHQHOGHORVSDFLHQWHV  $YHFHV


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

la patente mitral puede mostrar una forma trifsica


con una onda mesodiastlica por marcado retraso
GHODUHODMDFLyQ  
Otro elemento de anlisis fundamental en el eco
Doppler es el gradiente del tracto de salida del ventr-
culo izquierdo que se correlaciona con el movimiento
anterior sistlico del eco bidimensional. Tiene una ima-
JHQFDUDFWHUtVWLFDHQGDJDiUDEHFRQSLFRWDUGtR )LJXUD
 $YHFHVVHYLVXDOL]DHQSDFLHQWHVFRQREVWUXFFLyQ
grave, una disminucin de la velocidad ventricular iz-
quierda en mesosstole que le da un aspecto en garras
de langosta y es causado por una detencin del acor-
WDPLHQWR ORQJLWXGLQDO  YHQWULFXODU L]TXLHUGR   8Q
JUDGLHQWHVXSHULRUDPP+JHVGHPDOSURQyVWLFR\ Figura 6.7. Eco-Doppler color desde 5 cmaras desde pex.
XQ SRWHQWH SUHGLFWRU GH PXHUWH \ SURJUHVLyQ D LQVX- Se visualiza hipertroa septal de todo el septum (tipo1 de Wi-
ggle) y ujo con aliaising en tracto de salida del ventrculo
FLHQFLDFDUGtDFD  /DPD\RUtDGHORVLQGLYLGXRVQR
izquierdo correspondiente a obstruccin del tracto de salida
presentan un gradiente basal y en pacientes sintom- y ujo con aliaising en aurcula izquierda correspondiente a
WLFRVFRQJUDGLHQWHVPHQRUHVGHPP+JUHVXOWDGH la insuciencia mitral cuyo jet se dirige a la pared lateral y
utilidad provocar la aparicin o aumento del gradiente posterior.
mediante la maniobra de Valsalva, la administracin de
QLWULWRGHDPLORGREXWDPLQDRLVRSURWHUHQRO\HMHUFLFLR
que parece ser el mtodo ms efectivo pues en ms del YiOYXOD PLWUDO SURODSVR R UXSWXUD FRUGDO GH YDOYD
GHORVFDVRVJHQHUDJUDGLHQWHVPD\RUHVGHO PHQRUSRUHMHPSOR
(OMHWGHLQVXFLHQFLDPLWUDOHQOD0+HPSLH]D Otro tipo de obstruccin es la mesoventricular, en
al comienzo de la sstole, generalmente la velocidad esta no hay movimiento anterior sistlico como en
HV PD\RU GH  PV \ HV KRORVLVWyOLFR SXHGH FRQ- la MH basal y es consecuencia de la aposicin del
IXQGLUVHFRQHOMHWGHODREVWUXFFLyQ\KDFHUSHQVDU septum ventricular con la pared lateral o de la inser-
que el gradiente es severo cuando no lo es, por eso cin directa de un msculo papilar posterior anmalo
GHVFRQDU GH MHWV REVWUXFWLYRV VXSHULRUHV D  PV KDFLDODYDOYDDQWHULRUGHODPLWUDO  
6L ELHQ OD LQVXFLHQFLD PLWUDO HV SURGXFLGD SRU HO De las nuevas tcnicas, el eco Doppler tisular
movimiento anterior sistlico mitral, el grado de se- puede realizarse como pulsado o en modo color. La
veridad de la misma incrementa si la valva posterior onda S del Doppler pulsado tisular que es una medida
GHODPLWUDOHVWiUHVWULQJLGDHQVXPRWLOLGDG  /D de la funcin sistlica longitudinal suele estar dismi-
GLUHFFLyQGHOMHWHVSRVWHULRU\ODWHUDO )LJXUD  QXtGRHQOD0+D~QHQORVVHJPHQWRVQRKLSHUWURD-
VL VH YLVXDOL]D XQ MHW GH LQVXFLHQFLD FRQ RWUD GL- GRV  /DRQGD6HVWiGLVPLQXtGDD~QHQSDFLHQWHV
reccin se debe a una alteracin concomitante de la con genotipo positivo que an no presenten hiper-
WURD JHQHUDOPHQWHGHFPVHQHODQLOORPLWUDO
ODWHUDO   $GHPiVXQDRQGD6GHFPVVLUYH
SDUDGLIHUHQFLDUXQD0+GHXQDKLSHUWURDVLROyJL-
FDFRQXQDSUHFLVLyQGLDJQyVWLFDGHO8QDRQGD
S disminuda en el Doppler tisular del anillo mitral
lateral es un predictor de mal pronstico para muerte
\ KRVSLWDOL]DFLyQ SRU LQVXFLHQFLD FDUGtDFD   (O
ndice que correlaciona la onda temprana E mitral
del Doppler con la onda temprana tisular E lateral
o septal se ha utilizado para comprobar o descartar
elevacin de las presiones de llenado de importancia
HQHOGLDJQyVWLFRGHLQVXFLHQFLDFDUGtDFDVREUHWRGR
diastlica. Pero lo novedoso es que este ndice es til
en la MH para predecir eventos cardacos. Es as que
HQHOWUDEDMRGH.LWDRND et al.  se siguieron pa-
Figura 6.6. Eco-Doppler de una MH. Se visualiza velocidad FLHQWHVSRUPiVGHDxRV\DTXHOORVFRQUHODFLyQ(
muy aumentada en tracto de salida del ventrculo izquierdo (PHQRUGHHVWXYLHURQOLEUHGHHYHQWRVPLHQWUDV
con imagen en daga propia de la forma obstructiva de una MH.


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

TXH DTXHOORV FRQ UHODFLyQ ((! GH  HPSH]DURQ strain o deformacin es analizado consecutivamente
FRQ ORV HYHQWRV D~Q DQWHV GHO DxR  3RU RWUD SDUWH cuadro a cuadro por bidimensional y/o tridimensio-
el Doppler tisular sirve para medir la asincrona in- nal independientemente del ngulo. Esta secuencia
traventricular. La prevalencia de asincrona es mayor provee informacin tanto cuali como cuantitativa de
en la MH en comparacin con hipertensos y contro- ODGHIRUPDFLyQWLVXODU\GHODPRWLOLGDG  7DQWR
les. En un estudio que ha utilizado Doppler tisular un ODVIXQFLRQHVGHODDXUtFXODL]TXLHUGDFRPRODVGHO
UHWDUGRLQWUDYHQWULFXODU!GHPVSUHGLMRXQULHVJR ventrculo izquierdo pueden ser analizadas por spec-
aumentado de taquiarritmias y muerte sbita en un NOHWUDFNLQJ
VHJXLPLHQWRDDxRV   (OHFRWULGLPHQVLRQDO ' SHUPLWHDVHYHUDUFRQ
El Doppler tisular puede servir tambin para me- mayor precisin el mecanismo del movimiento ante-
dir el strain miocrdico as como el strain rate y estos rior sistlico, la masa miocrdica, la funcin sistlica
QRHVWiQLQXHQFLDGRVSRUODWUDVODFLyQHOWHWKHULQJ ventricular izquierda, el rea del tracto de salida del
o tironeamiento como las velocidades del Doppler ventrculo izquierdo tanto despus de la ciruga como
convencional. El strain y strain rate permiten diferen- tras la ablacin septal pero sobre todo es superior a
ciar la motilidad miocrdica en relacin al miocardio los mtodos anteriores en cuanto al diagnstico de la
adyacente mientras que el Doppler tisular slo lo hace MH apical en especial en el aneurisma en esa locali-
en relacin al transductor y permite la primera tcnica zacin. El contraste por otra parte es de suma utilidad
aseverar con mayor precisin la funcin miocrdica tambin para este tipo de MH y aneurisma apical y
regional alterada en forma ms precoz. Otra aplicacin SDUD GHOLPLWDU OD H[WHQVLyQ GHO LQIDUWR VHSWDO WUDV OD
de utilidad de este mtodo es para diferenciar MH de DEODFLyQVHSWDOFRQHWDQRO 
KLSHUWHQVLyQDUWHULDOFRQKLSHUWURDDVLPpWULFD  La Desde el punto de vista de la ecocardiografa, los
deformacin longitudinal tanto del ventrculo izquier- predictores de mal pronstico en las formas de MH
GR VWUDLQORQJLWXGLQDOGHO9, FRPRGHODDXUtFXODL]- QRDSLFDOHVVRQORVVLJXLHQWHV KLSHUWURDYHQWUL-
TXLHUGD VWUDLQ DXULFXODU L]TXLHUGD GH Q GH GLiVWROH FXODUL]TXLHUGD!GHPP JUDGLHQWHVXEYDOYXODU
durante la contraccin auricular, strain rate sistlico, !GHPP+J GLVIXQFLyQVLVWyOLFDGHOYHQWUtFX-
\VWUDLQUDWHGHODGLiVWROHWHPSUDQD VRQGHSHQGLHQWHV ORL]TXLHUGRFRQIUDFFLyQGHH\HFFLyQGHO 
mutuamente y estn ambos alterados en la MH a pesar GLODWDFLyQGHDXUtFXODL]TXLHUGD!GHPPRtQGLFH
de que la fraccin de eyeccin est conservada. Esta YROXPpWULFR!GHPOPP\ DVLQFURQtDYHQWUL-
alteracin se determina en el ECO por las velocidades FXODU!GHPVHJ 
tisulares y por el strain y strain rate. A pesar de que las
 IXQFLRQHV GH OD DXUtFXOD L]TXLHUGD HVWiQ DOWHUDGDV ERGOMETRA
la que ms lo est es la de bomba. La dilatacin de la
aurcula izquierda afecta el pronstico en la MH y la 6L ELHQ HO HMHUFLFLR HVWi FRQWUDLQGLFDGR HQ OD 0+
alteracin del strain longitudinal de la aurcula izquier- obstructiva pues al aumentar la contractilidad car-
GDFRQXQVWUDLQDXULFXODUL]TXLHUGDGHQGHGLiVWROH daca, esta actividad incrementa la obstruccin, se
GHVIXHHOYDORUGHFRUWHLGHDOFRPRSUHGLFWRU VROLFLWD XQD HUJRPHWULD SDUD OD HVWUDWLFDFLyQ GH
GH LQVXFLHQFLD FDUGtDFD HQ SDFLHQWHV FRQ 0+ DGH- riesgo para muerte sbita. En un tercio de los casos,
ms de indicar mal pronstico. Asimismo, un strain los pacientes con MH suelen tener una respuesta
VLVWyOLFR Pi[LPR UHGXFLGR D ! GH HQ PiV GH  anormal en la prueba ergomtrica caracterizada por
segmentos sirve para discriminar pacientes con y sin una cada de la presin. El mecanismo responsable
taquicardia ventricular no sostenida en el Holter por de estas alteraciones todava es desconocido pero se
lo que la deformacin o strain longitudinal disminuido EDUDMDQGLIHUHQWHVKLSyWHVLV UHVSXHVWDYDVRGLODWD-
VLUYHSDUDODHVWUDWLFDFLyQGHULHVJRHQODSUHYHQFLyQ GRUDSHULIpULFDFRQFDtGDGHODUHVLVWHQFLD  
de la muerte sbita.  GLVIXQFLyQVLVWyOLFD  H LVTXHPLDVXEHQGR-
El strain tiene sus limitaciones pero estas son me- FiUGLFD  
QRUHVFRQHOVSHFNOHWUDFNLQJTXHGLUHFWDPHQWHDVH- (QODVJXtDV$+$$&&GHOH[LVWtDXQDFRQ-
vera la motilidad miocrdica desde el eco bidimen- WUDLQGLFDFLyQ UHODWLYD GHO HMHUFLFLR FRPR WHVW SURQyV-
VLRQDO\HVLQGHSHQGLHQWH(OVSHFNOHWUDFNLQJ es una WLFRHQOD0+(QODVJXtDVDFWXDOHVGHOSHUVLVWH
WpFQLFDHFRFDUGLRJUiFDTXHDQDOL]DODPRWLOLGDGGH HO PLHGR  D HVWXGLDU SDFLHQWHV FRQ HMHUFLFLR HQ FDVRV
ORVSXQWRVRUHH[LRQHVGHQWURGHXQDYHQWDQDXOWUD- con obstrucciones muy elevadas del tracto de salida
VyQLFD(VWDVUHH[LRQHVVHGHVFULEHQWDPELpQFRPR GHOYHQWUtFXORL]TXLHUGR\HOWHVWFRQHMHUFLFLRHQHVWD
VSHFNOHV PDUFDGRUHV SDWHQWHV UDVJRV R patologa tiene una indicacin clase II a. El eco estrs
caractersticas, o huellas digitales en donde el FRQHMHUFLFLRSXHGHWHQHUXQUROSDUDGHVHQPDVFDUDUOD


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

GLVIXQFLyQVLVWyOLFDHQWUHHODOGHODV0+FRQ
alteracin de la motilidad y disminucin del engrosa-
PLHQWR VLVWyOLFR HQ VHJPHQWRV KLSHUWUyFRV  3HUR OD
indicacin principal sigue siendo para desenmascarar
la obstruccin del tracto de salida del ventrculo iz-
quierdo cuando no est presente en reposo. Peteiro et
DO  UHSRUWDURQODFRUUHODFLyQHQWUHORVSDUiPHWURV
GHOHFRHVWUpVFRQHMHUFLFLR HOJUDGLHQWHGHOWUDFWRGH
VDOLGDGHOYHQWUtFXORL]TXLHUGR ODLQVXFLHQFLDPL-
WUDO ODIUDFFLyQGHH\HFFLyQ HOtQGLFHGHOVFRUHGH
PRWLOLGDGGHORVVHJPHQWRVFRQHYHQWRVFDUGLDFRV
duros como muerte, transplante cardaco, infarto agu- Figura 6.8. Signo de Brockenborough. La echa superior indi-
ca la presin artica y la inferior la presin del VI
GRGHPLRFDUGLRLQVXFLHQFLDFDUGtDFDKRVSLWDOL]DGD
FRUUHFWDGHVFDUJDGHOFDUGLRGHVEULODGRULPSODQWDEOH
WDTXLFDUGLD YHQWULFXODU VRVWHQLGD \ EODQGRV FRPR -
EULODFLyQDXULFXODU\VtQFRSHHQSDFLHQWHVFRQ NUCLEAR
obstruccin del tracto de salida del ventrculo izquier-
GR\FRQREVWUXFFLyQVyORFRQHMHUFLFLR VHGHVFDU- (OUHDOFHWDUGtRLQGLFDEURVLVTXHYDGHODO
WDURQHQIHUPHGDGFRURQDULD\GLVIXQFLyQVLVWyOLFD FRQ se asocia a anomalas de perfusin y alteracin de
XQVHJXLPLHQWRGHDxRV6HREVHUYyXQWUDVWRUQRGH OD PRWLOLGDG FRQ HO HMHUFLFLR /D KLSHUWURD VH DVR-
ODPRWLOLGDGHQHOORQRWRULRHVTXHQRVHUHODFLR- FLDPiVFRQPXHUWHV~ELWDHQHVSHFLDOHQMyYHQHV/D
n con el gradiente del tracto de salida del ventrculo obstruccin puede ser un predictor independiente de
L]TXLHUGRODKLSRWHQVLyQHQHOHMHUFLFLR\ODKLSHUWURD LQVXFLHQFLDFDUGtDFD\PXHUWHPLHQWUDVTXHHOUHDO-
al revs de la literatura. En el multivariado se encontra- ce tardo puede asociarse con taquicardia ventricu-
URQYDULDEOHVHFRFDUGLRJUiFDVSUHGLFWLYDV HOJUR- ODU LQVXFLHQFLD FDUGtDFD  \ PXHUWH /D UHVRQDQFLD
VRU Pi[LPR GHO YHQWUtFXOR L]TXLHUGR   HTXLYDOHQWHV magntica nuclear resulta superior a la ecocardiogra-
PHWDEyOLFRVRFDSDFLGDGIXQFLRQDO PHWV  VFRUHGHO ItDHQHOGLDJQyVWLFRGHOD0+DOLGHQWLFDUiUHDVGH
tQGLFHGHPRWLOLGDGHQUHSRVR\ FDPELRGHOtQGLFH KLSHUWURDVHJPHQWDULDFRPRODUHJLyQDQWHURODWHUDO
FRQHOHMHUFLFLR$VLPLVPRQRVHUHODFLRQyFRQODREV- RiSH[TXHUHVXOWDQVXEHVWLPDGDVHQWpUPLQRVGHVX
truccin del tracto de salida del ventrculo izquierdo, H[WHQVLyQSRUODHFRFDUGLRJUDItD7DPELpQORHVSDUD
historia familiar de muerte sbita, sncope y respuesta JUXSRVGHDOWRULHVJRGH0+FRPR SDFLHQWHVFRQ
GHODWHQVLyQDUWHULDOHQHOHMHUFLFLR aneurismas apicales que previamente a la resonan-
cia magntica nuclear no se detectaban y no se poda
HEMODINAMIA GLIHUHQFLDUGHXQD0+DSLFDO )LJXUD  HQOD
GLVIXQFLyQ VLVWyOLFD WHUPLQDO \   HQ HO FRPSURPL-
En la actualidad con la ecocardiografa y la reso- so del ventrculo derecho. Asimismo, la resonancia
nancia magntica nuclear el estudio hemodinmico magntica nuclear permiti detectar en familiares de
ha sido relegado y su indicacin se limita a la bs-
queda de enfermedad coronaria aterosclertica en
las arterias epicrdicas en los casos en donde el an-
gor se sospecha que sobrepasa las causas propias de
OD0+(OVLJQRGH%URFNHQEURXJK   )LJXUD 
utilizado en la hemodinamia para el diagnstico di-
ferencial de MH obstructiva con estenosis artica
valvular consiste en que en la primera, el gradien-
te entre el ventrculo izquierdo y la aorta aumenta
mientras que la presin del pulso artico diminuye
HQ OD SDXVD SRVH[WUDVLVWyOLFD \ HQ OD HVWHQRVLV OD
presin del pulso aumenta, hoy es reemplazado por
el gradiente subvalvular y valvular respectivamente
obtenido en la ecocardiografa
Figura 6.9. Resonancia magntica. Se visualiza miocardiopa-
RESONANCIA MAGNTICA ta hipertrca apical.


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

pacientes con MH aquellos que a pesar de no presen- a. 510 FRQ LPDJHQ GH UHDOFH WDUGLy 1LYHO GH
WDUKLSHUWURDWHQtDQUHDOFHWDUGtRFULSWDVPLRFiUGL- (YLGHQFLD&
FDV\HORQJDFLyQGHODVYDOYDVPLWUDOHV   b. 0XWDFLRQHV GREOHV R FRPSXHVWDV  !  1LYHO
GH(YLGHQFLD&
PRONSTICO c. Obstruccin del tracto de salida del ventrculo
L]TXLHUGRPDUFDGD 1LYHOGH(YLGHQFLD%
Los marcadores de alto riesgo para muerte sbita y ne-
FHVLGDGGHFRORFDFLyQGHXQFDUGLRGHVEULODGRUVRQFR- Clase III: Dao
PLHQ]RGHODHQIHUPHGDGHQMyYHQHVGHDxRVKLV- (OHVWXGLRHOHFWURVLROyJLFRGHUXWLQDSDUDODHVWUDWL-
toria familiar maligna de muerte sbita, mutaciones ge- FDFLyQGHULHVJRGHPXHUWHV~ELWDQRVHGHEHUHDOL-
QpWLFDVTXHIDYRUHFHQODPXHUWHV~ELWD HM$UJ*OQ  ]DUHQSFRQ0+ 1LYHOGH(YLGHQFLD&
historia de muerte sbita, taquicardia ventricular no Las recomendaciones para la colocacin de un CDI
VRVWHQLGD R VRVWHQLGD VtQFRSH UHFXUUHQWH HQ MyYHQHV VRQODVVLJXLHQWHV
taquicardia ventricular no sostenida en el Holter y bra-
GLDUULWPLDV HQIHUPHGDGGHOWHMLGRGHFRQGXFFLyQ    Clase I
/DVJXtDVGHPXHUWHV~ELWDHQ0+HVWDEOH- 1. La decisin para colocar un CDI en pacientes
cen lo siguiente: FRQ 0+ GHEH LQFOXLU XQ MX]JDPLHQWR FOtQLFR
individual as como una profunda discusin de
Clase I OD IXHU]D GH OD HYLGHQFLD EHQHFLRV \ ULHVJRV
A todos los pacientes con MH se les debera realizar FRQMXQWDPHQWH FRQ OD SDUWLFLSDFLyQ DFWLYD GHO
OD HVWUDWLFDFLyQ GH ULHVJR SDUD PXHUWH V~ELWD HQ OD SDFLHQWH 1LYHOGH(YLGHQFLD&
evaluacin inicial para determinar la presencia de lo  Es razonable recomendar un CDI en pacientes
siguiente: (Nivel de Evidencia: B) con MH con paro cardaco previo documentada,
a. +LVWRULD GH EULODFLyQ YHQWULFXODU WDTXLFDUGLD EULODFLyQ YHQWULFXODU R WDTXLFDUGLD YHQWULFXODU
ventricular sostenida o muerte sbita incluyendo KHPRGLQiPLFDPHQWH VLJQLFDWLYD 1LYHO GH
descarga apropiada de un CDI para taquicardia (YLGHQFLD%
YHQWULFXODUREULODFLyQYHQWULFXODU
b. Historia familiar de muerte sbita incluyendo Clase IIa
descarga apropiada de un CDI para taquicardia 1. Es razonable recomendar un CDI en p con MH con:
YHQWULFXODUREULODFLyQYHQWULFXODU a. 0XHUWHV~ELWDFDXVDGDHQIDPLOLDUHVGHJUDGR
c. 6tQFRSHLQH[SOLFDEOH GHSDFLHQWHVFRQ0+ 1LYHOGH(YLGHQFLD&
d. Taquicardia ventricular no sostenida documen- a. 8Q JURVRU Pi[LPR SDULHWDO GHO 9, GH  PP
WDGD GHQLGD  FRPR  R PiV H[WUDVtVWROHV YHQ- 1LYHOGH(YLGHQFLD&
WULFXODUHVFRQXQDIUHFXHQFLD!D[PLQXWR a. 8QR R PiV HSLVRGLRV VLQFRSDOHV LQH[SOLFDEOHV
en el Holter. UHFLHQWHV 1LYHOGH(YLGHQFLD&
e. *URVRUSDULHWDOGHOYHQWUtFXORL]TXLHUGRGHPP  Un CDI puede ser til en p selectos con MH con
WDTXLFDUGLDYHQWULFXODUQRVRVWHQLGD SDUWLFXODU-
Clase IIa PHQWHHQDTXHOORVGHDxRV HQSUHVHQFLDGH
1. Es razonable aseverar la respuesta de la presin RWURVIDFWRUHVGHULHVJRGHPXHUWHV~ELWD 1LYHO
DUWHULDOGXUDQWHHOHMHUFLFLRFRPRSDUWHGHODHV- GH(YLGHQFLD&
WUDWLFDFLyQ GH ULHVJR GH PXHUWH V~ELWD HQ SD-  Un CDI puede ser til en pacientes selectos con
cientes con MH. (Nivel de Evidencia: B) MH con una respuesta anormal de la presin ar-
 /D HVWUDWLFDFLyQ GH ULHVJR GH PXHUWH V~ELWD WHULDO HQ HO HMHUFLFLR HQ SUHVHQFLD GH RWURV IDF-
GHEHGHWHUPLQDUVHHQIRUPDSHULyGLFD FDGD WRUHVGHULHVJRGHPXHUWHV~ELWD 1LYHOGH(YL-
DPHVHV HQSDFLHQWHVFRQ0+TXHQRUHFL- GHQFLD&
bieron un CDI pero que pueden eventualmente  (V UD]RQDEOH UHFRPHQGDU XQ &', HQ QLxRV GH
presentar factores de riesgo para la implantacin DOWRULHVJRFRQVtQFRSHLQH[SOLFDEOHKLSHUWURD
del mismo. (Nivel de Evidencia: C) masiva del ventrculo izquierdo o historia fa-
miliar de muerte sbita, teniendo en cuenta el
Class IIb rango de complicaciones elevadas que conlleva
Los siguientes factores de riesgo para muerte sbita la implantacin de un CDI a tan escasa edad.
deben ser considerados en pacientes con MH con in- 1LYHOGH(YLGHQFLD&
dicacin de CDI borderline:


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Clase IIb ORVPP+JD~QFXDQGRHVWDEDPHGLFDGRFRQDOJX-


1. La utilidad de la colocacin de un CDI con slo QRGHORVSULPHURVIiUPDFRV(YHQWXDOPHQWHVHKD
algunas corridas de taquicardia ventricular no HPSOHDGRODDPLRGDURQDSRUVXDFFLyQ\FDOFLEOR-
sostenido es incierto en pacientes con MH en queante as como antiarrtmico. Por ltimo, los diu-
ausencia de otros factores de riesgo de muerte UpWLFRVVHXWLOL]DQFXDQGRVREUHYLHQHODLQVXFLHQFLD
V~ELWD 1LYHOGH(YLGHQFLD& cardaca con retencin hidrosalina con suma precau-
 La utilidad de la colocacin de un CDI es in- cin pues como ya ha sido mencionado aumenta la
cierto en pacientes con MH con una respuesta obstruccin y el gradiente.
DQRUPDOGHODSUHVLyQDUWHULDOHQHOHMHUFLFLRHQ El tratamiento quirrgico se indica slo en los casos
ausencia de otros factores de riesgo de muerte en que ha fallado el tratamiento mdico y el paciente
sbita, particularmente en presencia de obstruc- FRQWLQ~DVLQWRPiWLFRJUDGR,,,,9GHOD1<+$(VXQD
cin del tracto de salida del ventrculo izquierdo. indicacin clase I nivel de evidencia B y deben tener
1LYHOGH(YLGHQFLD& DGHPiVXQJUDGLHQWHHQUHSRVRRHMHUFLFLRPD\RUGH
PP+JFRQXQHVSHVRUVHSWDOPD\RUGHPP\UHDOL-
Clase III: Dao ]DUVHHQFHQWURVTXLU~UJLFRVFRQH[SHULHQFLDHQHVWDSD-
1. La colocacin de un CDI en pacientes con MH WRORJtD  &RQVLVWHIXQGDPHQWDOPHQWHHQXQDPLHFWR-
en ausencia de factores de riesgo de muerte s- ma pero debido a las anormalidades concomitantes de
ELWDHVSRWHQFLDOPHQWHGDxLQD 1LYHOGH(YLGHQ- la vlvula mitral a veces es necesario el reemplazo o si
FLD& HVIDFWLEOHVHSUHHUHODSOiVWLFDPLWUDO(QXQDSXEOL-
 La colocacin de un CDI en pacientes con MH FDFLyQ  DORVDxRVGHOGLDJQyVWLFRHOGH
como estrategia para permitirles participar en los pacientes sin miomectoma fallecieron mientras que
GHSRUWHVFRPSHWLWLYRVHVSRWHQFLDOPHQWHGDxLQD VyORHOGHORVTXHWXYLHURQODPLRPHFWRPtDPXULH-
1LYHOGH(YLGHQFLD& ron y adems hubo desaparicin o disminucin franca
 La colocacin de un CDI en pacientes con geno- DODxRGHORVVtQWRPDV  (OEORTXHRGHUDPDL]TXLHU-
tipo de MH pero sin manifestaciones clnicas es da puede ser una complicacin posoperatoria que requi-
SRWHQFLDOPHQWHGDxLQR 1LYHOGH(YLGHQFLD& ULHXQPDUFDSDVRVGHQLWLYRSRUEORTXHR$9FRPSOHWR
HQHO  DGHPiVODPLRPHFWRPtDQRPHMRUDHO
TRATAMIENTO engrosamiento muscular de las arteriolas coronarias por
lo que puede persistir la isquemia.
El tratamiento puede ser farmacolgico, quirrgico, La ablacin septal con etanol fue realizada por
ablacin septal con etanol y marcapasos bicameral SULPHUDYH]SRU6LJZDUWHQ  6HLQGLFDHQ
  (Q FXDQWR DO SULPHUR  QR VH GHEH XWLOL]DU IiU- casos en que ha fallado el tratamiento mdico y el
macos que disminuyan la precarga, como los veno- riesgo quirrgico es elevado. Se requiere que las co-
GLODWDGRUHV QLWULWRV \GLXUpWLFRV\ODSRVFDUJDFRPR URQDULDVQRWHQJDQOHVLRQHVVLJQLFDWLYDV\XQDGLHV-
los vasodilatadores del tipo de los calcibloqueantes, tramiento del hemodinamista pues se inyecta etanol a
inhibidores de la enzima convertidora, inhibidores de ODVHSWDOFRQHOFRUD]yQHQPRYLPLHQWR\HOFDWpWHU
la angiotensina II o alfa bloqueantes y por ltimo que puede retroceder y el lquido penetrar en la descen-
aumenten la contractilidad como los inotrpicos po- dente anterior y producir un infarto masivo en lugar
sitivos , entre ellos la digital, pues aumentan la obs- del infarto localizado. Las complicaciones de este
truccin y el gradiente. La teraputica est dirigida a procedimiento son el bloqueo de rama derecha en un
ODPHMRUtDVLQWRPiWLFD GLVQHDDQJRUSDOSLWDFLRQHV \HOEORTXHRDXUtFXORYHQWULFXODUFRPSOHWRHQ
VtQFRSH  (Q ORV DVLQWRPiWLFRV  QR KD\ FRQVHQVR R XQHQHOPRPHQWRGHOSURFHGLPLHQWRSHUROXH-
estudio multicntrico de lo que se debe hacer, pero JRUHTXLULHURQPDUFDSDVRVGHQLWLYRVyORHOGH
HQ ODV KLSHUWURDV LPSRUWDQWHV PD\RUHV GH  PP ORVFDVRV  \HQORV~OWLPRVDxRVKDGLVPLQXLGRD
HQHOHFRFDUGLRJUDPDPiVD~QVLVRQMyYHQHVRFRQ PHQRVGHO  
JUDGLHQWHVVLJQLFDWLYRVEDVDOHVPD\RUHVGHPP Las indicaciones del marcapasos bicameral DDD
Hg podra indicarse tratamiento. Los frmacos ms en la MH son por disfuncin del ndulo sinusal o
XWLOL]DGRVVRQORVEORTXHDQWHVVLQDFFLyQYDVRGLOD- EORTXHR DXUtFXORYHQWULFXODU FODVH , &  0+ VLQWR-
tadora y si los mismos no pueden ser indicados por mtica refractaria al tratamiento mdico con obstruc-
patologa vascular perifrica o bronquial el verapa- FLyQVLJQLFDWLYDGHOWUDFWRGHVDOLGDGHOYHQWUtFXOR
PLORGHDPJG/DGLVRSLUDPLGDGHD L]TXLHUGRHQUHSRVRRSURYRFDGD &ODVH,,E&   
PJGQRVHFRQVLJXHHQQXHVWURSDtVSHUR:LJJOH (OHVWXGLRPXOWLFpQWULFR03DWK\  FRQFOX\yTXH
comenz a prescribirla cuando el gradiente superaba no puede ser considerado un tratamiento de primera


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

OtQHDSDUDOD0+2\ODPHMRUtDREVHUYDGDVHH[SOLFD- variado demostr que una intervencin invasiva


ra por un efecto placebo y la reduccin del gradiente IXH XQ GHWHUPLQDQWH VLJQLFDWLYR GH OD PRUWDOLGDG
LQWUDYHQWULFXODUHVPRGHVWDWDQVyORHQHOGHORV WRWDO +5   LQWHUYDOR GH FRQDQ]D  D
SDFLHQWHV(QORVPD\RUHVGHDxRVTXHPRVWUDURQ S  /DVREUHYLGDWRWDOIXHPD\RUHQOD
una respuesta clnica adecuada sugirieron que el mar- UDPDLQYDVLYD DODxRDORVDxRV\
capasos DDD puede ser una opcin terapetica para DORVDxRVGHVREUHYLGD TXHHQODFRQVHU-
FLHUWRVJUXSRVGHSREODFLyQDxRVD8QHVWXGLRFRQXQ YDGRUD DODxRDORVDxRVD
VHJXLPLHQWRDDxRV  HOPiVODUJRKDVWDDKRUD ORV DxRV GH VREUHYLGD S   6LQ HPEDUJR
REWHQLGRGHPRVWUyTXHHQSDFLHQWHVKXERXQDPH- la terapia invasiva no fue un predictor independien-
MRUtDFOtQLFD\GHUHGXFFLyQLPSRUWDQWH DOUHGHGRUGHO WHVLJQLFDWLYRGHPRUWDOLGDGUHODFLRQDGDFRQ0+
 GHOJUDGLHQWHHQWUHHOSULPHUPHV\ORVPHVHV +5LQWHUYDORGHFRQDQ]DDS
an cuando se apagaba el marcapasos. Se establece la    /D VREUHYLGD UHODFLRQDGD FRQ 0+ IXH GHO
LPSRUWDQFLDGHHVWHWUDWDPLHQWRHQDxRVRVHQORVTXH  DxR GHO DxR \GHO 
la ciruga tendra una alta tasa de morbimortalidad o DxR HQHOFRKRUWHLQYDVLYR\GHO DxR GHO
bien no tendran una circulacin coronaria adecuada  DxR \GHO DxR HQHOFRKRUWH
SDUDODDEODFLyQVHSWDO   FRQVHUYDGRU S  3RUORTXHVHFRQFOX\yTXH
En pacientes con MH obstructiva con gradien- los pacientes tratados en forma invasiva tenan una
WHVHQUHSRVRVLJQLFDWLYRVHVPHMRUODVREUHYLGD sobrevida total superior a la terapia conservadora, y
DODUJRSOD]RFRQHOPDQHMRFRQVHUYDGRUFRQHOWUD- que este ltimo grupo era ms factible que murie-
tamiento mdico o con el tratamiento invasivo ya ra de causas no cardacas por lo que la mortalidad
sea ciruga, tratamiento septal con etanol o marca- relacionada a MH es similar, sin importar el tipo
SDVRV" (VWD GXGD OD WUDWR GH FRQWHVWDU HO JUXSR GH GHWHUDSLD3RURWUDSDUWH5DNRZVNL\VXJUXSRDOH-
+DUU\5DNRZVNL\SDUDHVWRHVWXGLyXQFRKRUWHGH garon que la ciruga con miomectoma es ideal en
SDFLHQWHVFRQJUDGLHQWHVHQUHSRVRVLJQLFDWL- PHQRUHVGHDxRV\DTXHHQORVPD\RUHVDXPHQWD
vos y se compar la muerte total y la relacionada ODPRUELPRUWDOLGDG  
FRQ OD 0+  SDFLHQWHV IXHURQ WUDWDGRV HQ IRU- Por ltimo en los pacientes que evolucionan a una
PDFRQVHUYDGRUD\SDFLHQWHVIXHURQPDQHMDGRV forma dilatada, el tratamiento es acorde a esta pato-
mediante ciruga con miomectoma, ablacin septal loga y en los casos refractarios estara indicado el
con etanol, o marcapasos dual. El anlisis multi- WUDVSODQWHFDUGtDFR  

91
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

BIBILIOGRAFA
 7HDUH'$V\PPHWULFDOK\SHUWURSK\RIWKHKHDUWLQ\RXQJDGXOWV%U+HDUW-
 Geisterfer-Lowrance AA, Kass S, Tanigawa G et al. A molecular basis for familial hypertrophic cardiomyopathy: a
EHWDFDUGLDFP\RVLQKHDY\FKDLQJHQHPLVVHQVHPXWDWLRQ&HOO
 )LGGOHU*/7DMLN$-:HLOGPDQ:+HWDO,GLRSDWKLFK\SHUWURSKLFVXEDRUWLFVWHQRVLVLQWKH\RXQJ$P-&DUGLRO

7. Adelman AG, Wigle ED, Ranganathan N et al. The clinical course in muscular subaortic stenosis: a retrospective and
SURVSHFWLYHVWXG\RIKHPRG\QDPLFDOO\SURYHGFDVHV$QQ,QWHUQ0HG
 0F.HQQD : 'HDQHOG - )DUXTXL$ HW DO 3URJQRVLV LQ K\SHUWURSKLF FDUGLRP\RSDWK\ UROH RI DJH DQG FOLQLFDO
HOHFWURFDUGLRJUDSKLFDQGKHPRG\QDPLFIHDWXUHV$P-&DUGLRO
9. )UDQN6%UDXQZDOG(,GLRSDWKLFK\SHUWURSKLFVXEDRUWLFVWHQRVLVFOLQLFDODQDO\VLVRISDWLHQWVZLWKHPSKDVLVRQ
QDWXUDOKLVWRU\&LUFXODWLRQ
 0DURQ %- 5REHUWV :& (SVWHLQ 6( 6XGGHQ GHDWK LQ K\SHUWURSKLF FDUGLRP\RSDWK\ D SUROH RI  SDWLHQWV
&LUFXODWLRQ
11. 6ZDQ'$%HOO%2DNOH\&0HWDO$QDO\VLVRIV\PSWRPDWLFFRXUVHDQGSURJQRVLVDQGWUHDWPHQWRIK\SHUWURSKLF
REVWUXFWLYHFDUGLRP\RSDWK\%U+HDUW-
 Hardarson T, de la Calzada CS, Curiel R et al. Prognosis and mortality of hypertrophic obstructive cardiomyopathy.
/DQFHW
 0F.HQQD:-'HDQHOG-(+\SHUWURSKLFFDUGLRP\RSDWK\DQLPSRUWDQWFDXVHRIVXGGHQGHDWK$UFK'LV&KLOG

 0DURQ%-+HQU\:/&ODUN&(HWDO$V\PPHWULFVHSWDOK\SHUWURSK\LQFKLOGKRRG&LUFXODWLRQ
 0DURQ%-/LSVRQ/&5REHUWV:&HWDO0DOLJQDQWK\SHUWURSKLFFDUGLRP\RSDWK\LGHQWLFDWLRQRIDVXEJURXSRI
IDPLOLHVZLWKXQXVXDOO\IUHTXHQWSUHPDWXUHGHDWKV$P-&DUGLRO
 Cecchi F, Maron BJ, Epstein SE. Long-term outcome of patients with hypertrophic cardiomyopathy successfully
UHVXVFLWDWHGDIWHUFDUGLDFDUUHVW-$P&ROO&DUGLRO
17. 7DNDJL ( <DPDNDGR 7 1DNDQR 7 3URJQRVLV RI FRPSOHWHO\ DV\PSWRPDWLF DGXOW SDWLHQWV ZLWK K\SHUWURSKLF
FDUGLRP\RSDWK\-$P&ROO&DUGLRO
 0DURQ%-0DURQ066HPVDULDQ&*HQHWLFVRI+\SHUWURSKLF&DUGLRP\RSDWK\DIWHU<HDUV-$P&ROO&DUGLRO
  
19. Geisterfer-Lowrance AA, Kass S, Tanigawa G et al. A molecular basis for familial hypertrophic cardiomyopathy:
DEHWDFDUGLDFP\RVLQKHDY\FKDLQJHQHPLVVHQVHPXWDWLRQ&HOO
 +R&*HQHWLFVDQGFOLQLFDOGHVWLQ\LPSURYLQJFDUHLQK\SHUWURSKLFFDUGLRP\RSDWK\&LUFXODWLRQ

 5LFKDUG3&KDUURQ3&DUULHU//HGHXLO&HWDO (852*(1(+HDUW)DLOXUH3URMHFW +\SHUWURSKLFFDUGLRP\RSDWK\
distribution of disease genes, spectrum of mutations, and implications for a molecular diagnosis strategy. Circulation

 6HPVDULDQ&<X%5\FH&/DZUHQFH&HWDO6XGGHQFDUGLDFGHDWKLQIDPLOLDOK\SHUWURSKLFFDUGLRP\RSDWK\
DUHEHQLJQPXWDWLRQVUHDOO\EHQLJQ"3DWKRORJ\
 0DURQ%-6SLULWR36KHQ:.HWDO,PSODQWDEOHFDUGLRYHUWHUGHEULOODWRUVDQGSUHYHQWLRQRIVXGGHQFDUGLDFGHDWK
LQK\SHUWURSKLFFDUGLRP\RSDWK\-$0$
 .RQQR7&KDQJ66HLGPDQ-*HWDO*HQHWLFVRI+\SHUWURSKLF&DUGLRP\RSDWK\&XUU2SLQ&DUGLRO  

 :LJOH'5DNRZVNL+.LPEDOO%3HWDO+\SHUWURSKLF&DUGLRP\RSDWK\&LUFXODWLRQ
 Maron BJ. Echocardiographic assessment of left ventricular hypertrophy in patients with obstructive or nonobstructive
K\SHUWURSKLFFDUGLRP\RSDWK\(XU+HDUW-
 9LUPDQL53DWKRORJ\RI&DUGLRP\RSDWKLHVLQ0DQWK$QQXDO0HHWLQJRIWKH$PHULFDQ&ROOHJHRI9HWHULQDU\
3DWKRORJLVWV $&93  WK$QQXDO0HHWLQJRIWKH$PHULFDQ6RFLHW\RI&OLQLFDO3DWKRORJ\ $69&3 $&93DQG
$69&3 (GV 1RY
 0DURQ%-:&5REHUWV:&0F$OOLVWHU+$HWDO6XGGHQGHDWKLQ\RXQJDWKOHWHV&LUFXODWLRQ
 Maron MS, Olivotto I, Zenovich AG et al. Hypertrophic cardiomyopathy is predominantly a disease of left
YHQWULFXODURXWRZWUDFWREVWUXFWLRQ&LUFXODWLRQ
 :LJOH(':LODQVN\6'LDVWROLFG\VIXQFWLRQLQK\SHUWURSKLFFDUGLRP\RSDWK\+HDUW)DLOXUH
 *DDVFK:+/HYLQH+-4XLQRQHV0$HWDO/HIWYHQWULFXODUFRPSOLDQFHPHFKDQLVPVDQGFOLQLFDOLPSOLFDWLRQV$P
-&DUGLRO
 $SSOHWRQ&+DWOH/.3RSS5/5HODWLRQRIWUDQVPLWUDORZYHORFLW\SDWWHUQVWROHIWYHQWULFXODUGLDVWROLFIXQFWLRQ
QHZLQVLJKWVIURPDFRPELQHGKHPRG\QDPLFDQG'RSSOHUHFKRFDUGLRJUDSKLFVWXG\-$P&ROO&DUGLRO

 Cate FJ, Roelandt J. Progression to left ventricular dilatation in patients with hypertrophic obstructive cardiomyopathy.


CAPTULO 6 0LRFDUGLRSDWtDKLSHUWUyFD

$P+HDUW-
 Waller BF, Maron BJ, Epstein SE. Transmural myocardial infarction in hypertrophic cardiomyopathy: a cause of
conversion from left ventricular asymmetry to symmetry and from normal sized to dilated left ventricular cavity.
&KHVW
 :LJOH('6DVVRQ=+HQGHUVRQ0$HWDO+\SHUWURSKLFFDUGLRP\RSDWK\WKHLPSRUWDQFHRIWKHVLWHDQGWKHH[WHQW
RIK\SHUWURSK\DUHYLHZ3URJ&DUGLRYDVF'LV
 6KHUULG09*XQVEXUJ'=0ROGHQKDXHU6HWDO6\VWROLFDQWHULRUPRWLRQEHJLQVDWORZOHIWYHQWULFXODURXWRZ
WUDFWYHORFLW\LQREVWUXFWLYHK\SHUWURSKLFFDUGLRP\RSDWK\-$P&ROO&DUGLRO
 Shah PM, Taylor RD, Wong M. Abnormal mitral valve coaptation in hypertrophic obstructive cardiomyopathy:
SURSRVHGUROHLQV\VWROLFDQWHULRUPRWLRQRIPLWUDOYDOYH$P-&DUGLRO
 0F.HQQD:+DUULV/'HDQHOG-6\QFRSHLQK\SHUWURSKLFFDUGLRP\RSDWK\%U+HDUW-
 Nellen M,. Gotsman MS. The systolic murmur in hypertrophic obstructive cardiomyopathy and the nature of the
REVWUXFWLRQ3RVWJUDG0HG-  
 :\QH - %UDXQZDOG ( 7KH FDUGLRP\RSDWKLHV DQG P\RFDUGLWLGHV WR[LF FKHPLFDO DQG SK\VLFDO GDPDJH WR WKH
KHDUW,Q%UDXQZDOG(HG+HDUWGLVHDVHDWH[WERRNRIFDUGLRYDVFXODUPHGLFLQHWKGH9RO3KLODGHOSKLD:%
6DXQGHUV
 0DURQ%-+\SHUWURSKLF&DUGLRP\RSDWK\$6\VWHPDWLF5HYLHZ-$0$
 0DF5DH&$*KDLVDV1.DVV6HWDO)DPLOLDOK\SHUWURSKLFFDUGLRP\RSDWK\ZLWK:ROII3DUNLQVRQ:KLWHV\QGURPH
PDSVWRDORFXVRQFKURPRVRPHT-&OLQLFDO,QYHVW
 6KDNHVSHDUH&).HHOLQJ3-6ODGH$.HWDO$UUK\WKPLDDQGK\SHUWURSKLFFDUGLRP\RSDWK\$UFK0DO&RHXU9DLVV

 Maron BJ, Shirani J, Poliac LC et al. Sudden death in young competitive athletes: clinical, demographic and
SDWKRORJLFDOSUROHV-$0$
 0DURQ %- &HFFKL ) 0F.HQQD :- 5LVN IDFWRUV DQG VWUDWLFDWLRQ IRU VXGGHQ FDUGLDF GHDWK LQ SDWLHQWV ZLWK
K\SHUWURSKLFFDUGLRP\RSDWK\%U+HDUW-6
 &RQVHQVRGH0LRFDUGLRSDWtD+LSHUWUyFDGHOD6RFLHGDG$UJHQWLQDGH&DUGLRORJtD5HYLVWD$UJHQWLQDGH&DUGLRORJtD

 6DNDPRWR77HL&0XUD\DPD0,FKL\DVX+HWDO*LDQW7ZDYHLQYHUVLRQDVDPDQLIHVWDWLRQRIDV\PPHWULFDODSLFDO
K\SHUWURSK\ $$+ RIWKHOHIWYHQWULFOH(FKRFDUGLRJUDSKLFDQGXOWUDVRQRFDUGLRWRPRJUDSKLFVWXG\-DSDQHVH+HDUW
-RXUQDO
 (ULNVVRQ0-6RQQHQEHUJ%:RR$HWDO/RQJWHUPRXWFRPHLQSDWLHQWVZLWKDSLFDOK\SHUWURSKLFFDUGLRP\RSDWK\
-$P&ROO&DUGLRO
 Chapman AH, Raphael MJ, Steiner RE et al. Unusual chest X-ray appearances in hypertrophic cardiomyopathy. Clin
5DGLRO
 Klues HG, Schiffers A, Maron BJ. Phenotypic spectrum and patterns of left ventricular hypertrophy in hypertrophic
FDUGLRP\RSDWK\0RUSKRORJLFREVHUYDWLRQVDQGVLJQLFDQFHDVDVVHVVHGE\WZRGLPHQVLRQDOHFKRFDUGLRJUDSK\LQ
SDWLHQWV-$P&ROO&DUGLRO
 :H\PDQ$(3ULQFLSOHVDQG3UDFWLFHRI(FKRFDUGLRJUDSK\QGHGLWLRQ/HDDQG)HELJHU1HZ<RUN1<
 7RUUHFLOOD(**DUFtD)HUQiQGH]0$%XHQR+HWDO3XOPRQDU\YHQRXVRZLQK\SHUWURSKLFFDUGLRP\RSDWK\DV
DVVHVVHGE\WKHWUDQVHVRSKDJHDODSSURDFK7KHDGGLWLYHYDOXHRISXOPRQDU\YHQRXVRZDQGOHIWDWULDOVL]HYDULDEOHV
LQHVWLPDWLQJWKHPLWUDOLQRZSDWWHUQLQK\SHUWURSKLFFDUGLRP\RSDWK\(XURSHDQ+HDUW-RXUQDO
 *HVNH-%6RUDMMD31LVKLPXUD5$HWDO(YDOXDWLRQRIOHIWYHQWULFXODUOOLQJSUHVVXUHVE\'RSSOHUHFKRFDUGLRJUDSK\
in patients with hypertrophic cardiomyopathy: correlation with direct left atrial pressure measurement at cardiac
FDWKHWHUL]DWLRQ&LUFXODWLRQ
 -DH2+6HZDUG-%7DMLN-$&DUGLRP\RSDWKLHVLQ7KH(FKR0DQXDOSiJ
 %DUDF,8SDG\D63LOFKLN5HWDO(IIHFWRIREVWUXFWLRQRQORQJLWXGLQDOOHIWYHQWULFXODUVKRUWHQLQJLQK\SHUWURSKLF
FDUGLRP\RSDWK\-$P&ROO&DUGLRO
 0DURQ062OLYRWWR,%HWRFFKL6HWDO(IIHFWRIOHIWYHQWULFXODURXWRZWUDFWREVWUXFWLRQRQFOLQLFDORXWFRPHLQ
K\SHUWURSKLFFDUGLRP\RSDWK\1(QJO-0HG
 6FKZDPPHQWKDO(1DNDWDQL6+H6HWDO0HFKDQLVPRIPLWUDOUHJXUJLWDWLRQLQK\SHUWURSKLFFDUGLRP\RSDWK\
PLVPDWFKRISRVWHULRUWRDQWHULRUOHDHWOHQJWKDQGPRELOLW\&LUFXODWLRQ
 6SLULWR 3 %HOORQH 3 +DUULV .0 HW DO 0DJQLWXGH RI OHIW YHQWULFXODU K\SHUWURSK\ DQG ULVN RI VXGGHQ GHDWK LQ
K\SHUWURSKLFFDUGLRP\RSDWK\1(QJO-0HG
 Cardim N, Oliveira AG, Longo S, et al. Doppler tissue imaging: regional myocardial function in hypertrophic
FDUGLRP\RSDWK\DQGLQDWKOHWHVKHDUW-$P6RF(FKRFDUGLRJU
 1DJXHK6)%DFKLQVNL//0H\HU'HWDO7LVVXH'RSSOHULPDJLQJFRQVLVWHQWO\GHWHFWVP\RFDUGLDODEQRUPDOLWLHV
in patients with hypertrophic cardiomyopathy and provides a novel means for an early diagnosis before and
LQGHSHQGHQWO\RIK\SHUWURSK\&LUFXODWLRQ
 %D\UDN).DKYHFL*0XWOX%HWDO7LVVXH'RSSOHULPDJLQJWRSUHGLFWFOLQLFDOFRXUVHRISDWLHQWVZLWKK\SHUWURSKLF
FDUGLRP\RSDWK\(XU-(FKRFDUGLRJU


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 .LWDRND+.XER72NDZD0HWDO7LVVXH'RSSOHU,PDJLQJDQG3ODVPD%13/HYHOVWR$VVHVVWKH3URJQRVLVLQ
3DWLHQWVZLWK+\SHUWURSKLF&DUGLRP\RSDWK\-$P6RF(FKRFDUGLRJU
 DAndrea A, Caso P, Severino S et al. Prognostic value of intra-left ventricular electromechanical asynchrony in
SDWLHQWVZLWKK\SHUWURSKLFFDUGLRP\RSDWK\(XU+HDUW-
 Kato TS, Noda A, Izawa H et al. Discrimination of nonobstructive hypertrophic cardiomyopathy from hypertensive
left ventricular hypertrophy on the basis of strain rate imaging by tissue Doppler ultrasonography. Circulation

 $PXQGVHQ%++HOOH9DOOH7(GYDUGVHQ7HWDO1RQLQYDVLYHP\RFDUGLDOVWUDLQPHDVXUHPHQWE\VSHFNOHWUDFNLQJ
echocardiography: validation against sonomicrometry and tagged magnetic resonance imaging. J Am Coll Cardiol

 1DJXHK 6) /DNNLV 10 +H =; HW DO 5ROH RI P\RFDUGLDO FRQWUDVW HFKRFDUGLRJUDSK\ GXULQJ QRQVXUJLFDO VHSWDO
UHGXFWLRQWKHUDS\IRUK\SHUWURSKLFREVWUXFWLYHFDUGLRP\RSDWK\-$P&ROO&DUGLRO
 $IRQVR/&%HUQDO-%D[--HWDO(FKRFDUGLRJUDSK\LQ+\SHUWURSKLF&DUGLRP\RSDWK\7KH5ROHRI&RQYHQWLRQDO
DQG(PHUJLQJ7HFKQRORJLHV-$P&ROO&DUGLRO,PJ
 &RXQLKDQ 3- )UHQQHDX[ 03 :HEE '- HW DO $EQRUPDO YDVFXODU UHVSRQVH WR VXSLQH H[HUFLVH LQ K\SHUWURSKLF
FDUGLRP\RSDWK\&LUFXODWLRQ
 )UHQQHDX[03&RXQLKDQ3-&DIRULR$/3HWDO$EQRUPDOEORRGSUHVVXUHUHVSRQVHGXULQJH[HUFLVHLQK\SHUWURSKLF
FDUGLRP\RSDWK\&LUFXODWLRQ
 &LDPSL4%HWRFFKL6/RPEDUGL5HWDO+HPRG\QDPLF'HWHUPLQDQWVRI([HUFLVH,QGXFHG$EQRUPDO%ORRG3UHVVXUH
5HVSRQVHLQ+\SHUWURSKLF&DUGLRP\RSDWK\-$P&ROO&DUGLRO
71. <RVKLGD1,NHGD+:DGD7HWDO([HUFLVHLQGXFHGDEQRUPDOEORRGSUHVVXUHUHVSRQVHDUHUHODWHGWRVXEHQGRFDUGLDO
LVFKHPLDLQK\SHUWURSKLFFDUGLRP\RSDWK\-$P&ROO&DUGLRO
 3HWHLUR-0RQWVHUUDW/&DVWUR%HLUDV$/DELOVXEDRUWLFREVWUXFWLRQGXULQJH[HUFLVHVWUHVVHFKRFDUGLRJUDSK\$P-
&DUGLRO
 %URFNHQEURXJK(&%UDXQZDOG(0RUURZ$*$KHPRG\QDPLFWHFKQLFIRUWKHGHWHFWLRQRIK\SHUWURSKLFVXEDRUWLF
VWHQRVLV&LUFXODWLRQ
 Maron MS. Clinical Utility of Cardiovascular Magnetic Resonance in Hypertrophic Cardiomyopathy. Journal of
&DUGLRYDVFXODU0DJQHWLF5HVRQDQFH
 *HUVK%-0DURQ%-%RQRZ52HWDO$&&)$+$JXLGHOLQHVIRUWKHGLDJQRVLVDQGWUHDWPHQWRIK\SHUWURSKLF
FDUGLRP\RSDWK\&LUFXODWLRQ
Ommen SR, Maron BJ, Olivotto I et al. Long-Term Effects of Surgical Septal Myectomy on Survival in Patients
:LWK2EVWUXFWLYH+\SHUWURSKLF&DUGLRP\RSDWK\-$P&ROO&DUGLRO
 Dearani JA, Ommen SR, Gersh BJ et al. Surgery insight: Septal myectomy for obstructive hypertrophic
FDUGLRP\RSDWK\WKH0D\R&OLQLFH[SHULHQFH1DW&OLQ3UDFW&DUGLRYDVF0HG6HS  
77. Ralph-Edwards A, Woo A, McCrindle BW, Shapero JL et al Hypertrophic obstructive cardiomyopathy: comparison
RI RXWFRPHV DIWHU P\HFWRP\ RU DOFRKRO DEODWLRQ DGMXVWHG E\ SURSHQVLW\ VFRUH -7KRUDF &DUGLRYDVF 6XUJ 

 6LJZDUW81RQVXUJLFDOP\RFDUGLDOUHGXFWLRQIRUK\SHUWURSKLFREVWUXFWLYHFDUGLRP\RSDWK\/DQFHW

79. 6KDPLP:<RXVXIXGGLQ0:DQJ'HWDO1RQVXUJLFDOUHGXFWLRQRIWKHLQWHUYHQWULFXODUVHSWXPLQSDWLHQWVZLWK
K\SHUWURSKLFFDUGLRP\RSDWK\1(QJO-0HG
 Hess OM, Sigwart U. New treatment strategies for hypertrophic obstructive cardiomyopathy: alcohol ablation of the
VHSWXPWKHQHZJROGVWDQGDUG"-$P&ROO&DUGLRO
 *UHJRUDWRV * &KHLWOLQ 0' &RQLOO$  HW DO$&&$+$ JXLGHOLQHV IRU LPSODQWDWLRQ RI FDUGLDF SDFHPDNHUV DQG
DQWLDUUK\WKPLDGHYLFHVDUHSRUWRIWKH$PHULFDQ&ROOHJHRI&DUGLRORJ\$PHULFDQ+HDUW$VVRFLDWLRQ7DVN)RUFHRQ
3UDFWLFH*XLGHOLQHV &RPPLWWHHRQ3DFHPDNHU,PSODQWDWLRQ -$P&ROO&DUGLRO
 Maron BJ, Nishimura RA, McKenna WJ et al. Assessment of permanent dual-chamber pacing as a treatment for
drug-refractory symptomatic patients with obstructive hypertrophic cardiomyopathy. A randomized, double-blind,
FURVVRYHUVWXG\ 03$7+< &LUFXODWLRQ
 Megevand A, Ingles J, Richmond DR et al. Long-term follow-up of patients with obstructive hypertrophic
FDUGLRP\RSDWK\WUHDWHGZLWKGXDOFKDPEHUSDFLQJ$P-&DUGLRO
 6SLULWR36HLGPDQ&(0F.HQQD:-HWDO7KHPDQDJHPHQWRIK\SHUWURSKLFFDUGLRP\RSDWK\1(QJO-0HG

 %DOO : ,YDQRY - 5DNRZVNL + HW DO /RQJWHUP VXUYLYDO LQ SDWLHQWV ZLWK UHVWLQJ REVWUXFWLYH K\SHUWURSKLF
FDUGLRP\RSDWK\FRPSDULVRQRIFRQVHUYDWLYHYHUVXVLQYDVLYHWUHDWPHQW-$P&ROO&DUGLRO
 :LOOLDPV/5DNRZVNL+3UHGLFWLQJWKH)XWXUHLQ+\SHUWURSKLF&DUGLRP\RSDWK\)URP+LVWRSDWKRORJ\7R)ORZ7R
)XQFWLRQ(GLWRULDO-$P6RF(FKRFDUGLRJU
 Collins RT, Gossett JM, Swearingen C. Long-Term Survival of Patients With Resting Obstructive Hypertrophic
&DUGLRP\RSDWK\ 0RUH 4XHVWLRQV 7KDQ$QVZHUV &RUUHVSRQGHQFH OHWWHU WR WKH HGLWRU -$P &ROO &DUGLRO 



CAPITULO 7

MIOCARDIOPATA
RESTRICTIVA
C. SARA BERENSZTEIN

/DV 0LRFDUGLRSDWtDV 5HVWULFWLYDV 05  UHSUHVHQ- aurculas dilatadas y ventrculos normales o peque-


tan la forma menos frecuente dentro del grupo de xRV  HVWDDQRPDOtDSXHGHGHQLUVHGHIRUPDLQ-
las miocardiopatas y la nica para la que la WHO/ cruenta por el ecocardiograma. Por ltimo, presenta
,6)&7DVN)RUFHQRRIUHFHXQRVFULWHULRVGLDJQyVWL- distinta histologa de acuerdo a la etiologa que la
FRVHVSHFtFRV  3XHGHQGHQLUVHFRPRDTXHOODV produce.
afecciones caracterizadas por una restriccin al lleno La MR puede ser idioptica, o secundaria a diver-
YHQWULFXODUSRUWHMLGRHQGRFiUGLFRVXEHQGRFiUGLFRR VDVHQIHUPHGDGHVVLVWpPLFDVTXHFXUVDQFRQLQOWUD-
miocrdico anormal que produce una alteracin en la cin miocrdica, no siendo en estos casos considera-
GLVWHQVLELOLGDGYHQWULFXODU  6HFDUDFWHUL]DQSRU da como una autntica miocardiopata en el sentido
una curva de presin ventricular llamada dip-plateau estricto, sino como una enfermedad del msculo
o signo de la raz cuadrada en la cual la presin ven- cardiaco. La MR a diferencia de la miocardiopata
WULFXODUGLVPLQX\HVLJQLFDWLYDPHQWHHQHOFRPLHQ]R GLODWDGD\HVSHFLDOPHQWHGHODKLSHUWUyFDUDUDYH]
y aumenta brusca y rpidamente en la distole tem- WLHQHFDUiFWHUIDPLOLDU  /DVSULQFLSDOHVHWLRORJtDV
SUDQD )LJXUD   (VWHVLJQRKHPRGLQiPLFRHV de la MR son:
compartido por la pericarditis constrictiva, razn por  Idioptica y familiar.
la cual el diagnstico diferencial ms importante es  Endomiocardiopatas HQIHUPHGDG GH /IHU
FRQODPLVPD  $GHPiVH[LVWHXQDLQYHUVLyQGHO HQGRPLRFDUGLREURVLV%HFNHU\FDUFLQRLGH
WDPDxR DXUtFXORYHQWULFXODU QRUPDO SXHV VH REVHUYD  Amiloidosis.
 Hemocromatosis.
 Enfermedad de Gaucher, de Hurler y de Fabry.
 Fibroelastosis subendocrdica.
 Sarcoidosis.
 Esclerodermia y glucogenosis.
 Hipotiroidismo y miocardiopata diabtica.
 Miopatas.
 1HRSODVLD PHODQRPD 
 6HXGR[DQWRPDHOiVWLFR
 &DOFLFDFLyQREURVLVHQGRFiUGLFD
 Trombosis ventricular asociada a prtesis mitral.
 Policitemia vera y reticulosis.
 Radiacin.
 (IHFWRWy[LFRSRUDQWUDFLFOLQDV
 Rechazo de trasplante cardaco.
Fig 7.1: Patente de dip-plateau


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

El aumento de las presiones de llenado de los la- YDSXHVSHUPLWHFRPSUREDUODLQYHUVLyQGHOWDPDxR


dos derecho e izquierdo del corazn y la consiguiente aurculoventricular, las caractersticas propias de
congestin venosa pulmonar y sistmica dan lugar a FDGD HWLRORJtD HQGRPLRFDUGLREURVLV DPLORLGRVLV
la sintomatologa de la MR. Los sntomas y signos FDUFLQRLGH HWF  OD SDWHQWH PLWUDO UHVWULFWLYD HQ HO
PiV FRPXQHV VRQ WRV GLVQHD FRQ HO HMHUFLFLR R DO Doppler, la valoracin de la presin pulmonar y la
DGRSWDUHOGHF~ELWRRUWRSQHDGLVQHDSDUR[tVWLFDQRF- IDOWDGHYDULDFLyQIiVLFDUHVSLUDWRULDHQODV05  
turna y edema pulmonar. Son frecuentes la debilidad En el cateterismo cardaco se observa adems de
PXVFXODU DVt FRPR OD LQWROHUDQFLD DO HMHUFLFLR GHUL- observarse el signo del dip-plateau ya mencionado,
vada de la imposibilidad de aumentar el volumen de el descenso del valle y que se hace ms profundo du-
llenado ventricular y por lo tanto el gasto cardiaco de rante la inspiracin, y que las presiones del lado iz-
acuerdo a la demanda. Tambin consultan por angor, TXLHUGRVXSHUDQDODVGHOGHUHFKRHQDOPHQRVPP
SXOVRLUUHJXODURWDTXLFDUGLD SXHVVHWUDWDGHPDQWH- +J   6XHOH DVLPLVPR REVHUYDUVH KLSHUWHQVLyQ
QHUHOYROXPHQPLQXWR DQRUH[LDFRQFHQWUDFLyQGLV- SXOPRQDU JHQHUDOPHQWH SRU HQFLPD GH  PP+J
minuda, oliguria y nicturia e hipotensin arterial y En el transcurso del cateterismo suele realizarse la
VKRFN(OHVSHFWURFOtQLFRGHOD05LQFOX\HVtQWRPDV biopsia endomiocrdica para determinar la etiologa,
derivados del aumento de la presin venosa central ya que de acuerdo a la misma variar el tratamiento.
como hepatomegalia, ascitis, edemas perifricos, ab- Un procedimiento relativamente nuevo es la re-
domen distendido o anasarca. Tambin, la ingurgi- sonancia magntica que adems de ver la alteracin
tacin yugular suele estar presente y a veces puede anatmica aurculoventricular permite establecer la
verse el incremento inspiratorio de la presin venosa caracterizacin tisular y el compromiso de la sustan-
yugular o signo de Kussmaul. cia anmala en las distintas capas resultando de gran
Las complicaciones ms frecuentes son: trom- ayuda en el diagnstico incruento de las MR.
ERHPEROLVPRFLUURVLVFDUGtDFDLQVXFLHQFLDFDUGtD- Las caractersticas ms sobresalientes que dife-
FDDUULWPLDVHLQVXFLHQFLDPLWUDO\RWULFXVStGHD(V rencian a las MR de la pericardits constrictiva es la
GH UHVDOWDU TXH FXDQGR OD LQVXFLHQFLD FDUGtDFD HV historia de enfermedad sistmica para las primeras
global o derecha se caracteriza por presentar adems y de pericarditis para las segundas, la auscultacin
de los edemas, ingurgitacin yugular y derrame pe- GLIHUHQWHSXHVHQODV05SXHGHQDXVFXOWDUVHXQR
ricrdico y/o pleural e importante ascitis por lo cual UXLGRFRQVRSORGHLQVXFLHQFLDPLWUDO\RWULFXV-
muchos de estos pacientes son errneamente ingre- StGHD\HQODVHJXQGDXQNQRFNSHULFiUGLFRSHURVLQ
sados en los servicios de gastroenterologa pensando soplos. A diferencia de la pericarditis constrictiva, el
que son portadores de cirrosis heptica. En los casos choque de la punta suele ser palpable y se ubica nor-
secundarios a enfermedad sistmica pueden encon- PDOPHQWH  
trarse sntomas propios de la alteracin de otros r- (QODUDGLRJUDItDGHWyUD[VHYLVXDOL]DQKDOOD]JRV
ganos o aparatos. SURSLRVGHFDGDHWLRORJtDHQODV05\FDOFLFDFLyQ
El electrocardiograma puede ser normal y su pericrdica en la pericarditis constrictiva.
anormalidad tiene relacin con la etiologa de base El diagnstico diferencial ms importante se
como comprobaremos ms adelante. Son frecuentes logra con la ecocardiografa Doppler porque en la
los bloqueos de rama tanto izquierdos como dere- SHULFDUGLWLVFRQVWULFWLYDH[LVWHYDULDELOLGDGGHOFLFOR
chos, as como diversos grados de bloqueo aurculo- UHVSLUDWRULRKDOOD]JRTXHHVLQH[LVWHQWHHQODV05
YHQWULFXODU\WUDVWRUQRVGHODUHSRODUL]DFLyQ  (Q- Por ltimo, en la hemodinamia de las MR se
tre las arritmias, las ms frecuentes son las de origen comprueba mayor presin en las cavidades izquier-
VXSUDYHQWULFXODU\HQWUHHOODVODEULODFLyQDXULFXODU das que las derechas, especialmente en la presin de
SXHGHDSDUHFHUHQKDVWDXQGHORVFDVRV QGHGtDVWROHGHO9,FRQUHVSHFWRDOGHUHFKRPLHQ-
/D UDGLRJUDItD GH WyUD[ SXHGH VHU QRUPDO R VH tras que en la pericarditis constrictiva se evidencia
SXHGH YLVXDOL]DU XQ  DUFR FRPR LQGLFDGRU GHO ecualizacin de las presiones. Tanto en la ecocardio-
DJUDQGDPLHQWRGHODRUHMXHODGHODDXUtFXODL]TXLHUGD grafa Doppler como en la hemodinamia se comprue-
y / o un doble contorno como indicador de dilatacin ba hipertensin pulmonar generalmente slo en las
GHDPEDVDXUtFXODVFRQRVLQ HQODVGHUHFKDVSXUDV  MR y OD SUHVLyQ GLDVWyOLFD SXOPRQDU PD\RU GH 
VLJQRV GH UHGLVWULEXFLyQ SXOPRQDU  \ QDOPHQWH XQ de la presin sistlica pulmonar predominantemente
DUFRPHGLRFRQYH[RSRUKLSHUWHQVLyQSXOPRQDU   en la pericarditis constrictiva.
La ecocardiografa Doppler tiene un lugar de pri- /DSURJUHVLyQGHODHQIHUPHGDGVXHOHVHULQH[R-
maca en el diagnstico de las MR as como en su UDEOHSHURHQDOJXQRVFDVRVH[LVWHWUDWDPLHQWRHVSH-
diagnstico diferencial con la pericarditis constricti- FtFR WHQLHQGR DSHQDV XQ  GH VXSHUYLYHQFLD D


CAPTULO 7 Miocardiopata restrictiva

ORVDxRVOLEUDGRDVXHYROXFLyQ  3RURWUDSDU- PXFRSROLVDFiULGRGHOWHMLGRHQGRFiUGLFRRGHODSRU-


te, los casos de MR de aparicin en la infancia suelen FLyQLQWHUQDGHOPLRFDUGLRGHVDUUROODQGRYDVRV\EUR-
VHUGHSHRUSURQyVWLFR   blastos que convertiran la zona en una cicatriz desin-
(OGLDJQyVWLFRGHODV05WLHQHIDVHV HOVLQ- tegrando el colgeno y generando por un mecanismo
drmico en donde debe sospecharse MR ante toda de hipersensibilidad anticuerpos por autoinmunidad
LQVXFLHQFLDFDUGtDFDGHRULJHQLQFLHUWRFRQDXUtFXODV  (VWRVXFHGHUtDWDPELpQHQODVXSHUFLHGHOHRVL-
GLODWDGDV\YHQWUtFXORVSHTXHxRV\GLVIXQFLyQGLDVWy- noflico que en un principio se multiplicara por este
OLFD  SHUR QR VLVWyOLFD JHQHUDOPHQWH   HO HWLROyJLFR mecanismo inmunoalrgico y se fabricara en su inte-
en el que muchas veces la bsqueda debe realizarse rior una protena catinica eosinoflica que producira
QRHQHOFRUD]yQVLQRHQHOUHVWRGHORUJDQLVPR\ HO GDxRHQGRPLRFiUGLFRSRUXQHIHFWRWy[LFRGLUHFWRVR-
diagnstico diferencial con la pericarditis constrictiva. EUHODPHPEUDQDSODVPiWLFDGHODEULOODPLRFiUGLFD
Es por esto que es una indicacin clase I realizar un DVtFRPRVREUHFRPSOHMRVHQ]LPiWLFRVHOGHSLUXYD-
ecocardiograma Doppler ante todo paciente con sos- WRGHVKLGURJHQDVD\HOGHR[RJOXWDUDWRGHVKLGURJH-
pecha de MR y en especial para observar la falta de va- QDVD  3RURWUDSDUWHHVWDSURWHtQDFDWLyQLFD
riacin fsica respiratoria en el mismo como elemento HRVLQyOLFDDFWLYDUtDHOVLVWHPD\HOEULQROtWLFRIDYR-
diferencial fundamental con la pericarditis constrictiva UHFLHQGRODIRUPDFLyQGHWURPERV  
y es una indicacin clase IIa, el cateterismo cardaco ([LVWHXQDWHRUtDXQLFLVWDSRUODFXDOODHQIHUPH-
con biopsia endomiocrdica. El tratamiento de esta l- GDGGH/RIHU\ODHQGRPLRFDUGLREURVLVVHUtDQXQD
WLPDHVTXLU~UJLFR ODSHULFDUGLHFWRPtD SRUORTXHD misma enfermedad en distintos estados evolutivos.
veces es mandatorio llegar a la biopsia endomiocrdi- 5HDOPHQWHH[LVWLUtDQHVWDGtRV DJXGRQHFUyWLFR
FDSDUDHYLWDUWRUDFRWRPtDVLQQHFHVDULDV   SRU PLRFDUGLWLV HRVLQRItOLFD GH  VHPDQDV GH GXUD-
(Q FXDQWR DO WUDWDPLHQWR H[LVWH XQR JHQHUDO HQ FLyQ WURPEyWLFRGHVHPDQDVGHGXUDFLyQTXH
base a diurticos que deben ser utilizados con cui- FRUUHVSRQGHUtDDODHQIHUPHGDGGH/IHUFRQYDVFX-
dado para evitar la deplecin y la cada del volu- OLWLV EUyWLFRFRUUHVSRQGHUtDDODHQGRPLRFDUGLR-
men minuto y uno particular segn la etiologa que EURVLVVLQYDVFXOLWLV\HRVLQROLDJHQHUDOPHQWHSXHV
desencaden la MR. Los inhibidores de la enzima ODQR[DTXHRULJLQyHOSURFHVRGHVDSDUHFLy\ORTXH
convertidora o los sartenes as como los bloqueantes SHUVLVWHHVXQLQFRUUHFWRSURFHVRGHFXUDFLyQ  
FiOFLFRV  QR WLHQHQ XQ URO FODUR QL H[LVWHQ HVWXGLRV /DSUHYDOHQFLDGHODHQIHUPHGDG  HQXQHV-
multicntricos que avalen o descarten su uso. WXGLRUHDOL]DGRHQ0R]DPELTXHIXHGHOFRQ
'HELGRDORH[WHQVRGHOWHPDVHDERUGDUiQODV SUHGRPLQLR HQ OD GpFDGD GH ORV  D ORV  DxRV \
etiologas ms frecuentes de las MR que son la endo- IXHPD\RUHQKRPEUHV YV VLELHQHQ
PLRFDUGLREURVLV\ODDPLORLGRVLV ODH[SHULHQFLDGHODDXWRUDODPD\RUSUHYDOHQFLDIXH
HQ OD HGDG GH  D  DxRV FRQ IUDQFR SUHGRPLQLR
ENDOMIOCARDIOFIBROSIS IHPHQLQR   +D\ FRQVHQVR TXH ODV IRUPDV PiV
IUHFXHQWHV VRQ ODV ELYHQWULFXODUHV ([LVWHQ DGHPiV
/DHQGRPLRFDUGLREURVLV  GHVFXELHUWDSRU'DYLHV formas izquierdas y derechas puras, estas ltimas son
HQ8JDQGD  HVXQDHQGRPLRFDUGLRSDWtDFRQMXQWD- GHPiVIUHFXHQWHRFXUUHQFLDHQSDtVHVDIULFDQRV  
PHQWHFRQODHQIHUPHGDGGH/IHUODHQIHUPHGDGGH Los sntomas como en todas las MR es la disnea, el
%HFNHU \ HO FDUFLQRLGH 6X HWLRORJtD HV GHVFRQRFLGD angor y/o las palpitaciones El sndrome clnico de pre-
pero se han enumerado diferentes hiptesis:   ,1- VHQWDFLyQ PiV IUHFXHQWH HV OD  LQVXFLHQFLD FDUGtDFD
)(&&,26$ EDFWHULDV HVWUHSWRFRFRV HVWDORFRFRV derecha, izquierda o global, seguido por el sndrome
HVSLURTXHWDV  SDUiVLWRV ODULDVLV /RD ORD  YLUXV  febril prolongado y/o las arritmias supraventriculares.
1875,&,21$/ SRU GpFLW GH YLWDPLQD $   +,- (QHOH[DPHQItVLFRVHVXHOHDXVFXOWDUXQVRSORKROR-
3(56(52721,1(0,$ GLHWDV ULFDV HQ EDQDQD  VLVWyOLFRPLWUDO\RWULFXVStGHRFRQXQUXLGRRXQ
HIPERSENSIBILIDAD: a ciertas plantas, hierbas, soplo proto u holosistlico mitral y/o tricuspdeo a ve-
HWF   *(1(7,&$6   72;,&$ EXVXOIDQ PHWL- FHVDFRPSDxDGRGHXQFKDVTXLGRGHDSHUWXUDRXQ
VHUJLGD GDXQRUUXELFLQD   5(80$7,&$   ,1- ruido seguido de un rollido mesodiastlico.
0812$/(5*,&$ HRVLQyORV SURWHtQD FDWLyQLFD El electrocardiograma puede ser normal o presen-
HRVLQRItOLFD (VWD~OWLPDHVODTXHKDJHQHUDGRPiV WDUPLFURYROWDMHFRQWUDVWRUQRVGHO677KLSHUWURD
DGHSWRV 8QD QR[D GHVFRQRFLGD FRPR HQ HO VtQGUR- ventricular izquierda o bloqueos de rama derecho o
me hipereosinflico o conocida como la parasitosis izquierdo.
u otras no infecciosas como los tuberculostticos, el /DUDGLRJUDItDGHWyUD[YDUtDVHJ~QHOFRPSURPL-
asma bronquial o el cncer gstrico, edematizara el so ventricular. En las formas derechas puras se ase-

97
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

PHMDDODLPDJHQGHXQ(EVWHLQFRQXQDPHJDDXUtFXOD
GHUHFKDHKLSRXMRSXOPRQDUHQODL]TXLHUGDSXUDVH
HYLGHQFLD XQ  DUFR SRU OD GLODWDFLyQ GHO YHQWUtFX-
ORL]TXLHUGR\HODUFRWLHQHXQDIRUPDWULDQJXODU
como el ventrculo izquierdo de la estenosis mitral
pues en ambas situaciones el mismo es normal o pe-
TXHxR\DQLYHOSXOPRQDUVHREVHUYDFRQJHVWLyQ(Q
las formas biventriculares es similar a la izquierda
pura, pero sin redistribucin pulmonar.
De los mtodos complementarios de diagnstico,
el ecocardiograma es el de ms utilidad en la endomio-
FDUGLREURVLV (Q HO HFRFDUGLRJUDPD PRGR 0 SXHGH
YLVXDOL]DUVHHOVLJQRGHODDOPHQD  SRUPRWLOLGDG
Figura 7.2: Ecocardiograma bidimensional de cuatro cma-
SDUDGRMDOGHOVHSWXPFRQHOVLJQRGHODUDt]FXDGUDGD ras desde pex donde se visualiza brotrombo enla punta del
en el septum y la pared posterior. En el septum suele ventrculo izquierdo (tipo 1 de Shaper).
observarse, adems engrosamiento sistlico aumen-
WDGRFX\DVLRSDWRORJtDVHGHEHUtDDXQPRYLPLHQWR
H[DJHUDGRGHODSDUWHQRREOLWHUDGDGHRORVYHQWUtFX-  (OHVWXGLRGHODSDWHQWHPLWUDO\WULFXVStGHDOD
ORVSRUH[SXOVDUODVDQJUH6XHOHVHUPiVIUHFXHQWHGHO PHGLFLyQGHOXMRGHODVYHQDVSXOPRQDUHV\VLVWpPL-
lado derecho y es muy raro en las formas izquierdas cas como las suprahepticas y la vena cava superior,
puras. En el ecocardiograma bidimensional se com- el eco tisular y el Eco modo M color ayudan al diag-
prueba obliteracin apical de uno o ambos ventrculos QyVWLFRGHHVWDHQIHUPHGDG(QHO(FR'RSSOHUH[LV-
SRUPDWHULDOHFRJpQLFRVXJHVWLYRGHEURWURPER   WHQGLVWLQWRVSDWURQHVGHODSDWHQWHPLWUDO  
(VWHPDWHULDOVHFRPSRUWDFRPRXQUHHFWRUHVSHFXODU segn la funcin diastlica ventricular izquierda. En
FHUFDQRDOUHERUGHHQGRFiUGLFR\VXJLHUHFDOFLFDFLyQ las miocardiopatas restrictivas y por ende, en la en-
intramiocrdica que puede ser diferenciada de la calci- GRPLRFDUGLREURVLVVHHQFXHQWUDQORVSDFLHQWHVPX\
FDFLyQSHULFiUGLFDTXHHVPiVH[WHUQD  6HJ~QOD sintomticos con disnea y la patente mitral es la de-
XELFDFLyQGHHVWHEURWURPER6KDSHUHWDO  GHV- nominada restrictiva. La patente restrictiva izquierda
FULELyWLSRV7LSRODEURVLVRFXSDHOiSH[ )LJXUD se correlaciona con una patente de venas pulmonares
 WLSRODEURVLVRFXSDHOiSH[\DVFLHQGHSRUHO  FDUDFWHUL]DGDSRUXQDXPHQWRGHODYHORFLGDGGH
PXVFXORSDSLODUSRVWHULRUWUDFFLRQDQGRKDFLDDEDMROD OD RQGD UHYHUVD  SXOPRQDU$ PD\RU GH FPVHJ \
YDOYDPHQRUGHODPLWUDO VLJQRGHOJDQFKRRKRRN  XQDGXUDFLyQ!GHPVTXHODGHODRQGD$PLWUDO
JHQHUDQGR LQVXFLHQFLD PLWUDO WLSR  FRPSURPHWH SRUHOLQFUHPHQWRGHODSUHVLyQGHQGHGLiVWROHGHO
slo la vlvula mitral y es indiferenciable de un pro- YHQWUtFXORL]TXLHUGRSRUHQFLPDGHPP+J D
ODSVRWLSRFRPSURPHWHODYiOYXODPLWUDO\HOiSH[ veces, disminuye la velocidad de la onda reversa por
\WLSRODEURVLVHVHQSDUFKHV/RVWLSRVPiVIUH- GDxRPLRFiUGLFRDXULFXODUFRQFRPLWDQWH (VWHLQFUH-
FXHQWHVVRQHO\HO$SHVDUGHODSUHVHQFLDGHHVWH mento suele ser de tal magnitud que en las miocar-
EURWURPERHOiSH[FRQVHUYDVXPRWLOLGDGFHQWUtSHWD GLRSDWtDVUHVWULFWLYDVFRPRODHQGRPLRFDUGLREURVLV
a diferencia de la motilidad disquintica o hipoquinti- VXHOHLQYHUWLUVHHOMXHJRGHSUHVLRQHVQRUPDOHVGHOD
FDGHXQWURPERLPSODQWDGRHQHOiSH[SRUHQIHUPHGDG curva de presin ventricular produciendo una inver-
FRURQDULDRFKDJiVLFD  GHELGRDTXHHOEURWURPER VLyQ GHO XMR GH YHQWUtFXOR D DXUtFXOD L]TXLHUGD DO
GHODHQGRPLRFDUGLREURVLVHQYtDVHSWRVEURVRVTXH revs de lo normal, a veces en tele y o mesodistole
slo compromete al tercio interno del miocardio. Suele \JHQHUDQGRXQDLQVXFLHQFLDPLWUDOWHOH\PHVRGLDV-
FRH[LVWLUGHUUDPHSHULFiGLFRGHUUDPHSOHXUDO\DVFLWLV tlica respectivamente, a diferencia de la pericarditis
El primero suele no ser ms que moderado y no es in- constrictiva en la que no suele haber tal compromiso.
frecuente que el lquido tenga un elevado contenido de Con respecto a la tricspide, se evidencia una patente
SURWHtQDV\VHWUDWHGHXQH[XGDGRJHQHUDOPHQWHQRVH marcadamente restrictiva pero suele detectarse un
produce taponamiento cardaco. acortamiento franco del tiempo de desaceleracin
La ecocardiografa-Doppler es diagnstica, con- tricuspdeo superior al observado en los pacientes
UPDODSDWHQWHUHVWULFWLYD  \DGHPiVSHUPLWHGL- con pericarditis constrictiva. Asimismo, al observar
ferenciarla de la pericarditis constrictiva. En esta l- ODYHORFLGDGPi[LPDGHOUHXMRWULFXVStGHRVHSXH-
WLPDH[LVWHQFDPELRVIiVLFRVHQHOFLFORUHVSLUDWRULR de inferir la presin sistlica pulmonar que resulta
TXH QR HVWiQ SUHVHQWHV HQ OD HQGRPLRFDUGLREURVLV de utilidad, ya que por lo general, en las miocar-


CAPTULO 7 Miocardiopata restrictiva

GLRSDWtDV UHVWULFWLYDV DO H[LVWLU FRPSURPLVR PLRFiU- (QODUHVWULFFLyQHQHO'RSSOHUWLVXODU  H[LVWH


GLFRVXHOHH[LVWLUSUHVLRQHVSXOPRQDUHVPD\RUHVGH una disminucin de la velocidad sistlica y la onda E
PP+J QR DVt HQ ODSHULFDUGLWLVFRQVWULFWLYD   WLVXODUPHQRUGHFPV\XQDUHODFLyQRQGD(PLWUDO
&XDQGR H[LVWH FRPSURPLVR XQL R ELYHQWULFXODU HV- RQGD(WLVXODU!GH TXHVXJLHUHIXHUWHPHQWHUHVWULF-
SHFLDOPHQWHGHOWLSRGH6KDSHU )LJXUD VXHOH cin y es considerado actualmente el signo ms preciso
comprobarse traccin de la valva menor por compro- SDUDHVWDEOHFHUODGLIHUHQFLDHQWUHHVWDVHQWLGDGHV
miso de los msculos papilares respectivos que gene- (OPRGR0FRORU  HVXQDWpFQLFDGHUHFLHQ-
UDLQVXFLHQFLDPLWUDO\RWULFXVStGHDUHVSHFWLYDPHQ- te utilizacin que tambin permite diferenciar entre
te, que puede ser comprobada por el eco-Doppler, miocardiopata restrictiva y pericarditis constricti-
preferentemente, el color y que por lo general nunca va. En la restriccin, la velocidad de propagacin
llega a ser grave. DO iSH[ EDVDO \ WRWDO VH HQFXHQWUDQ PDUFDGDPHQWH
En las venas suprahepticas y en la vena cava GLVPLQXtGRV JHQHUDOPHQWH PHQRU GH  FPV  \
superior suele comprobarse en las miocardiopatas el tiempo de retardo basal-apical est francamente
restrictivas, una patente con predominio de la onda alargado con respecto a los valores de la pericarditis
antergrada diastlica a lo largo de todo el ciclo constrictiva.
respiratorio, pero en inspiracin suele evidenciarse (O (FR WUDQVHVRIiJLFR   SHUPLWH FRUUR-
un aumento de sta, as como adelantamiento de la EDUFRQPiVSUHFLVLyQORTXHVHUHHUHDODSDWRORJtD
RQGD$UHWUyJUDGD GHELGDDODFRQWUDFFLyQDXULFXODU GHOODGRL]TXLHUGR\DTXHSHUPLWHXQPHMRUHVWXGLR
GHUHFKD FRQUHVSHFWRDOD3GHOHOHFWURFDUGLRJUDPD GHODVYHQDVSXOPRQDUHVGHOJUDGRGHLQVXFLHQFLD
comprobndose que a veces el fenmeno mecnico mitral y en aquellos casos con mala ventana ultras-
precede al elctrico. QLFD SHUPLWH XQD PHMRU YLVLyQ GHO EURWURPER DVt
como su ubicacin y del estudio Doppler en general.
En la hemodinamia se observa la dilatacin de las
aurculas del lado comprometido y la obliteracin
GHOiSH[\VHJ~QHOWLSRGH6KDSHUVHSXHGHFRPSUR-
bar el compromiso de la valva posterior de la mitral
\RWULFXVStGHDFRQODFRQVLJXLHQWHLQVXFLHQFLDSRU
retraccin valvular. Tambin puede estudiarse tras el
SRVRSHUDWRULR GH OD HQGRPLRFDUGLREURVLV FRQ XQD
endocardiectoma como se discutir ms adelante en
GRQGHVHFRPSUREDUiXQDPHMRUtD\GHVDSDULFLyQGH
la obliteracin ventricular. Como ya ha sido mencio-
nado en la hemodinamia de las MR se comprobar
las caractersticas que permiten diferenciarla de la
pericarditis constrictiva.
La resonancia magntica se ha convertido en una
tcnica muy til para el diagnstico de la endomio-
FDUGLREURVLVGHELGRDVXKDELOLGDGHQODFDUDFWHUL-
zacin tisular, para establecer el estado de la enfer-
medad y para realizar un diagnstico temprano y as
HYLWDUODSURJUHVLyQDODIDVHEUyWLFD(QHVWDGtRV
tempranos se puede observar trastornos en la motili-
GDGSDULHWDOUHJLRQDOSHURHVSHFLDOPHQWHLQOWUDFLyQ
HQGRPLRFiUGLFDYLVXDOL]DGDFRPR7RXQDLQWHQVL-
GDGGHVHxDO67,5HQHOiSH[DQLYHOHQGRFiUGLFR
o subendocrdico o en la regin posterolateral de
los ventrculos. Cuando la enfermedad progresa ya
se avisora el trombo como una banda hipointensa
en secuencias GRE y SSFP. En la secuencia DEIR
Fig 7.3: Ecocardiograma transesofgico donde se visualiza
aparece una hipointensidad entre el endocardio re-
brotrombo (tipo 2 de Shaper) en la punta del ventrculo iz- saltado y la sangre brillante que se conoce como la
quierdo que asciende por el msculo papilar posterior y trac- apariencia en sndwich. Luego cuando se desa-
ciona hacia el ventrculo la valva menor de la mitral generan- UUROODODEURVLVVHREOLWHUDHOiSH[TXHVHYLVXDOL-
do insuciencia mitral.

99
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

]D FRPRXQD EDQGDEULOODQWH HQGRPLRFiUGLFD   \RWULFXVStGHR VHJ~QODXELFDFLyQGHOEURWURPER 


Segn los hallazgos de la ecocardiografa y la re- y se intent realizar una plstica de la vlvula au-
sonancia se establecen criterios mayores y menores riculoventricular correspondiente as como evitar la
que son los siguientes: UHVHFFLyQEUyWLFDHQOD]RQDVHSWDOFHUFDQDDOKD]GH
+LVSDUDHYLWDUODFRORFDFLyQGHXQPDUFDSDVRV  
Criterios Mayores 8QD VHULH TXLU~UJLFD  GHVFULELy XQD VREUHYLGD D 
 3ODFDGHEURVLV!GHPPGHJURVRUSXQWRV DxRVGHO 
 3ODFDGHEURVLVR GHPPGHJURVRUTXH
DIHFWHQPiVGHXQDSDUHGYHQWULFXODUSXQWRV AMILOIDOSIS
 %RUUDGXUDGHOiSH[YHQWULFXODU9'R9,SXQ-
tos La amiloidosis es un grupo de enfermedades raras
 Trombos o contraste espontneo sin deterioro de y de causa desconocida, que se caracterizan por el
ODIXQFLyQYHQWULFXODUSXQWRV GHSyVLWRGHVXVWDQFLDDPLORLGHHQORVHVSDFLRVH[WUD-
 &RQWUDFFLyQGHOiSH[GHO9'FRQGLVIXQFLyQGH FHOXODUHVGHGLYHUVRVyUJDQRV\WHMLGRVFRQGLFLRQDQ-
ODV  YDOYDV DXUtFXORYHQWULFXODUHV GHELGR D OD do alteraciones funcionales y estructurales segn la
adherencia del aparato valvular a la pared ven- localizacin e intensidad del depsito. Virchow fue
WULFXODUSXQWRV TXLpQ GHQRPLQy HQ  D HVWD HQIHUPHGDG SRU HO
QRPEUHGHDPLORLGRVLVSHURIXH5RNLWDQVN\HQ
Criterios Menores TXH GHVFULELy OD EULOOD DPLORLGHD SRU SULPHUD YH]
 3ODFDGHEURVLVORFDOL]DGRVHQXQDSDUHGYHQ-  (OPDWHULDODPLORLGHHVWiIRUPDGRHQXQ
tricular: 1 punto SRUEULOODVGHDPLORLGH(VWDVEULOODVGHDPLORLGH
 3DWUyQGHXMRUHVWULFWLYRGHODVYiOYXODVPLWUDO son polmeros insolubles formados por subunidades
RWULFXVSLGHDSXQWRV SURWHLFDV GH EDMR peso molecular que provienen de
 $SHUWXUD GLDVWyOLFD GH OD YiOYXOD SXOPRQDU  precursores solubles que adquieren una estructura
puntos secundariaDQRUPDOHQOiPLQDDQWLSDUDOHOD(ORWUR
 Espesamiento difuso de la valva mayor de la mi- GHOPDWHULDODPLORLGHFRUUHVSRQGHDIDFWRUHVTXH
tral: 1 punto. probablemente, contribuyen a la estabilizacin de
 $XUtFXOD DJUDQGDGD FRQ YHQWUtFXOR GH WDPDxR ODVEULOODVGHORVFXDOHVORVPiVLPSRUWDQWHVVRQHO
normal: 1 punto FRPSRQHQWHVpULFR3 XQDPROpFXODGHODIDPLOLDGH
 Movimiento anormal del septum interventricu- ODVSHQWUD[LQDVPX\VLPLODUDODSURWHtQD&UHDFWLYD 
lar y de la pared posterior: 1 punto y proteoglicanos y glicosaminglicanos, procedentes
 Aumento de la densidad de las paredes interven- de la PDWUL]H[WUDFHOXODUGHOWHMLGRGHGHSyVLWR  
triculares: 1 punto La amiloidosis es una enfermedad de etiologa des-
conocida que suele atacar a la poblacin adulta senil
Es as que se puede establecer un score para el HQDOUHGHGRUGHSRUPLOOyQGHKDELWDQWHVSRUDxR
GLDJQyVWLFRFRQODVXPDGHDPERVFULWHULRVD GH A pesar de que las causas de la formacin y depsito
SXQWRV EDMDSUREDELOLGDG E GHD PRGHUDGD de amiloide no han sido an dilucidadas, hay eviden-
SUREDELOLGDG \F !GHGHDOWDSUREDELOLGDG cias que avalan un disturbio del metabolismo protei-
(OWUDWDPLHQWRLQLFLDOFRQVLVWHHQPDQHMDUODLQVX- co, en especial de las protenas sricas secundario a
FLHQFLDFDUGtDFDGLDVWyOLFDFRQGLXUpWLFRVHYHQWXDO- XQD HVWLPXODFLyQ DQWLJpQLFD FRQWtQXD FRQJXUDQGR
mente el uso de inhibidores de la enzima convertido- as una teora inmunolgica que tendra relacin con
ra y sartenes tiene un uso emprico. Si el diagnstico el comportamiento de los plasmocitos. Es la nica
se realiza en forma temprana cuando todava est etiologa de las miocardiopatas restrictivas en que se
SUHVHQWHODHRVLQROLDVHSXHGHGHWHQHUHOSURFHVR\ altera la funcin sistlica en los estados terminales
HYLWDUODSURJUHVLyQDODEURVLVPHGLDQWHKLGR[LXUHD SRU UHHPSOD]R GH OD EULOOD PLRFiUGLFD SRU OD DPL-
o eventualmente corticoides si la Ig E se encuentra ORLGHD  /DVPDQLIHVWDFLRQHVFOtQLFDVHVWiQ
HOHYDGD  8QDYH]TXHODLQVXFLHQFLDFDUGtD- determinadas por el rgano afectado y el diagnstico
ca es refractaria, se indica el tratamiento quirrgico se basa en la sospecha clnica y la demostracin de
que consiste en la endocardiectoma. En el inicio de ODSUHVHQFLDGHODVXVWDQFLDDPLORLGHHQORVWHMLGRV
este procedimiento como la mortalidad perioperato- /DDPLORLGRVLVFDUGtDFDHVXQDPLRFDUGLRSDWtDLQO-
ULDHUDPX\HOHYDGD  VHSHQVyHQLQGLFDUGLUHFWD- trativa que conforma la causa ms comn de mio-
PHQWHXQWUDVSODQWHFDUGtDFRSHUROXHJRVHPHMRUy cardiopata restrictiva. La afectacin cardaca en la
la tcnica quirrgica evitando el reemplazo mitral DPLORLGRVLVVLVWpPLFDRFXUUHKDVWDHQHO\WLHQH


CAPTULO 7 Miocardiopata restrictiva

un mal pronstico con una supervivencia media de nutren o en los nervios que los inervan. En aquellos
PHVHV HVSHFLDOPHQWHHQODIRUPDSULPDULD    casos que consultan por angor debido al compromiso
([LVWHQGLIHUHQWHVFODVLFDFLRQHVSHURHQJHQH- GHODVDUWHULDVLQWUDPXUDOHVFRURQDULDVVXHOHQH[LVWLU
ral se trata de hacerlo por las caractersticas histo- cambios del ST-T como en los de la coronariopata
TXtPLFDVGHODEULOODDPLORGHDDGHPiVGHOFRPSUR- DWHURVFOHUyWLFDWtSLFD  
miso orgnico anatomopatolgico. Es as que se la (QHOH[DPHQItVLFRSRUORJHQHUDOQRVHDXVFXO-
FODVLFDHQ primaria en donde el tipo de protena tan soplos aunque las vlvulas aurculoventriculares
es la AL compuesta por cadenas livianas cuyo pre- VH HQFXHQWUHQ LQOWUDGDV SRU DPLORLGH \ HQ HO (FR
FXUVRU HV F R N   \ TXH FRPSURPHWH HO FRUD]yQ Doppler cardaco puedan observarse regurgitacio-
RULJLQDQGR XQD PLRFDUGLRSDWtD UHVWULFWLYD \ JHQHUD QHVOHYHV3XHGHDXVFXOWDUVHXQUXLGR\HQHVWDGRV
DGHPiV KLSRWHQVLyQ RUWRVWiWLFD  OHQJXD PDFURJOR- DYDQ]DGRVXQUXLGRFRQUDOHVSXOPRQDUHV$VLPLV-
VLD  WUDFWR JDVWURLQWHVWLQDO QHUYLRV QHXURSDWtD  \ PRVHREVHUYDQVLJQRVGHLQVXFLHQFLDFDUGtDFDGH-
piel, compromete generalmente a personas mayores recha como edemas, ingurgitacin yugular y al igual
GHDxRV\HVPiVIUHFXHQWHHQHOVH[RPDVFXOLQR que en otras miocardiopatas restrictivas, ascitis que
 Dsociada a mieloma mltiple que es como la pri- confunde el diagnstico y hace pensar en un cuadro
PDULDSHURDVRFLDGDDOHVLRQHVRVWHROtWLFDV Vecun- heptico. Es llamativa la magnitud de los edemas
daria en donde el tipo de protena es la amiloide A en la amiloidosis cardaca especialmente en la for-
cuyo precursor es srico, de la protena amiloide A ma primaria debido a la marcada hipoalbuminemia
denominado SAP de sntesis heptica que circula en  HQRFDVLRQHVSURGXFWRGHOGDxRSDUHQTXLPDWR-
SODVPDXQLGRDODOLSRSURWHtQD+'/\FRPSURPHWH so renal con sndrome nefrtico y ms raramente por
KtJDGRED]R\ULxyQ\JHQHUDKLSRWHQVLyQRUWRVWiWLFD enteropata perdedora de protenas por compromiso
\ UDUDPHQWH SURGXFH PLRFDUGLRSDWtD UHVWULFWLYD  DPLORLGHR GHO LQWHVWLQR GHOJDGR   6XHOH H[LVWLU
heredofamiliar que es autosmica dominante y pue- hipotensin postural y anormalidades de la variabi-
GHVHUFRQFRPSURPLVRQHXURSiWLFR SURWHtQD$) \ lidad de la frecuencia cardaca en particular en las
sin compromiso con protena AA cuya composicin formas primarias y familiares por alteracin de los
es la transtiretina que tambin pueden desencadenar EDURUUHFHSWRUHVDUWHULDOHV  'HODVPDQLIHVWDFLR-
XQD PLRFDUGLRSDWtD UHVWULFWLYD   OD Venil que slo QHV H[WUDFDUGtDFDV TXH SHUPLWH VRVOD\DU OD H[LVWHQ-
compromete el corazn y eventualmente vasos y en cia de amiloidosis, la presencia de un sndrome del
FX\DFRPSRVLFLyQVHHQFXHQWUDXQDSUHDOE~PLQD OD tnel carpiano generalmente bilateral o la presencia
WUDQVWLUHWLQDVDOYDMHDQWHVOODPDGDSURWHtQD$6    de prpura de tronco, cuello o cara especialmente en
 ODDPLORLGRVLVDXULFXODUDLVODGDVHKDGHVFXELHUWR los prpados o la macroglosia debe hacer pensar en
TXHODEULOODWLHQHGHULYDGRVGHOSpSWLGRQDWULXUpWLFR DPLORLGRVLV  
DXULFXODU   ODGHYDVRVFHUHEUDOHVFRQSURWHtQDV En el electrocardiograma es caracterstico el mi-
$TXHVHKDOOyHQFDVRVGHVtQGURPHGH'RZQ\GH- FURYROWDMH  TXHVLELHQQRHVSDWRJQRPyQLFR
PHQFLDVHQLO ODDVRFLDGDDGLiOLVLVFUyQLFDTXHVH s lo es, el hecho que como veremos ms adelante se
PDQLHVWDSRUVtQGURPHGHOW~QHOFDUSLDQR\DUWURSD- DFRPSDxDHQHOHFRFDUGLRJUDPDGHKLSHUWURDYHQWUL-
ta erosiva dolorosa relacionada con la microglobuli- cular izquierda. Tambin puede comprobarse paten-
QDTXHGHSHQGHGHOVLVWHPD+/$  SRU~OWLPR tes de pseudoinfarto en la cara anterior e inferior. En
 ODTXHVHSUHVHQWDFRQHOFiQFHUPHGXODUWLURLGHR estados avanzados de la enfermedad con dilatacin
con algunos depsitos de protena AE. Alrededor del GH ODV DXUtFXODV VH FRPSUXHED EULODFLyQ DXULFXODU
GHORVSDFLHQWHVTXHSDGHFHQXQDDPLORLGRVLV  3XHGHQH[LVWLUGLIHUHQWHVWLSRVGHEUDGLDUULWPLDV
WLHQHQXQDIRUPDSULPDULD  HOGHOWRWDOSUH- y como es sabido en esta enfermedad especialmente
VHQWDDPLORLGRVLVVHFXQGDULD\PHQRVGHOGHVD- en las formas primarias es frecuente la muerte sbita
rrolla una forma de amiloidosis familiar.  TXHDGHPiVGHVHUGHELGDDEULODFLyQYHQWULFX-
La forma de presentacin ms frecuente de la lar pude serlo secundaria a bloqueo aurculoventri-
amiloidosis con compromiso miocrdico, al igual cular completo y paro sinusal sin respuesta efectiva
que en otras miocardiopatas restrictivas es con in- ventricular.
VXFLHQFLDFDUGtDFDJOREDOHOSDFLHQWHFRQVXOWDSRU /DUDGLRJUDItDGHWyUD[VXHOHPRVWUDUXQFRUD]yQ
GLVQHD R  KLSRWHQVLyQ RUWRVWiWLFD PHQRV IUHFXHQWH- normal y segn el estado de la enfermedad, conges-
mente lo hace por precordialgia y/o sncope por taqui tin pulmonar.
REUDGLDUULWPLDV/DEULOODDPLORLGHDSXHGHLQOWUDU El laboratorio demuestra generalmente una eri-
ODVFRURQDULDVHQHOSULPHUFDVRRLQOWUDUHOQyGXOR trosedimentacin elevada, anemia especialmente en
sinusal y el aurculoventricular en las arterias que los las formas asociadas a mieloma e hipoalbuminemia.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

(Q ODV IRUPDV SULPDULDV SXHGH H[LVWLU SURWHtQD PR- FKRGHDPPSDWHQWHPLWUDOFRQUHWUDVRHQOD


QRFORQDO GH FDGHQDV OLYLDQDV NDSSD R ODPEGD HQ HO UHODMDFLyQ \ XQD VREUHYLGD PD\RU GH  DxRV (Q HO
GHORVFDVRV\DOUHGHGRUGHOGHSURWHLQX- HVWDGtR,,H[LVWHXQDKLSHUWURDFRQFpQWULFD!GH
ria de Bence Jones. Es fundamental la electroforesis PPHKLSHUWURDGHSDUHGOLEUHGHOYHQWUtFXORGHUH-
proteica en suero y la inmunoelectroforesis, de esta FKR!GHPPODSDWHQWHPLWUDOHVFRQUHWUDVRHQOD
forma se ha detectado la protena monoclonal en el UHODMDFLyQRSVHXGRQRUPDOL]DGD\ODVREUHYLGDHVGH
GHORVFDVRVFXDQGRVHHVWXGLDWDPELpQODRULQD DDxRV3RU~OWLPRHQHOHVWDGtR,,,VHREVHUYDXQD
SRULQPXQRHOHFWURIRUHVLVHLQPXQRMDFLyQODSURWHt- KLSHUWURDPDUFDGDODSDWHQWHHVSVHXGRQRUPDOL]DGD
QDPRQRFORQDOVHKDOODHQHOGHORVFDVRV\HVWR o restrictiva, se visualiza dilatacin auricular izquier-
tiene importancia para el tratamiento precoz antes del GD\GHWHULRURGHODIXQFLyQVLVWyOLFD 
FRPSURPLVRFDUGtDFR   (Q RFDVLRQHV HQ HVWH HVWDGLR DVt FRPR SDUD ODV
([LVWHQ GLIHUHQWHV PpWRGRV FRPSOHPHQWDULRV GH miocardiopatas restrictivas en general y ya lo hemos
diagnstico pero los de ms utilidad son la ecocardio- PHQFLRQDGRHQODHQGRPLRFDUGLREURVLVIHQyPHQR
grafa Doppler y la resonancia magntica cardaca. ste que no suele avizorarse en la pericarditis cons-
(Q HO HFRFDUGLRJUDPD VH FRPSUXHED KLSHUWURD WULFWLYD VHYLVXDOL]DLQVXFLHQFLDPLWUDOPHVR\WHOH-
concntrica o asimtrica con un electrocardiograma GLDVWyOLFDSRUHOHYDFLyQPDUFDGDGHODSUHVLyQGHQ
TXHFRPR\DKDVLGRUHIHULGRWLHQHPLFURYROWDMHDGH- de distole del ventrculo izquierdo que conduce a
PiV FRQ KLSHUWURD GH ORV P~VFXORV SDSLODUHV \ GHO XMRUHWUyJUDGRGLDVWyOLFRGHVGHODDXUtFXODL]TXLHUGD
VHSWXPLQWHUDXULFXODUHKLSHUWURDGHSDUHGOLEUHGHO DODVYHQDVSXOPRQDUHV  
ventrculo derecho que no se observa en otras etiolo- En el lado derecho, los cambios tricuspdeos si-
JtDVGHKLSHUWURDYHQWULFXODUL]TXLHUGDFRPRODKLSHU- guen la misma evolucin que la mitral, aunque la pa-
tensin arterial o la estenosis artica. La acumulacin WHQWHWULFXVStGHDFRQUHWUDVRHQODUHODMDFLyQSHUVLVWH
desproporcionada de amiloide en el septo interven- ms hacia los estados terminales por la concomitan-
WULFXODU TXH DVHPHMD XQD PLRFDUGLRSDWtD KLSHUWUyFD cia de la hipertensin pulmonar. Esta ltima es un
con o sin obstruccin dinmica del tracto de salida del PDUFDGRUGHDPLORLGRVLVDYDQ]DGD  3DUDHYROX-
ventrculo izquierdo puede ocurrir, pero es rara Se ha cionar a la etapa pseudonormalizada y a la restricti-
VHxDODGRTXHODGLVWULEXFLyQVHSWDODVLPpWULFDHVPiV YDVHUHTXLHUHGHLQVXFLHQFLDWULFXVStGHDPRGHUDGD
propia de pacientes con formas hereditarias que con FRQMXQWDPHQWHFRQXQDGLVIXQFLyQYHQWULFXODUGHUH-
DPLORLGRVLV SULPDULD   &XDQGR OD HQIHUPHGDG cha sistlica muy importante. En las venas suprahe-
est avanzada puede visualizarse dilatacin de la aur- pticas se evidencian los cambios propios de las mio-
cula izquierda y deterioro de funcin sistlica puesto FDUGLRSDWtDV UHVWULFWLYDV FXDQGR H[LVWH FRPSURPLVR
que la amiloidosis cardaca es una de las pocas causas amiloideo de moderado a severo de la pared libre del
de restriccin que alteran la funcin sistlica. Uno YHQWUtFXORGHUHFKR  
de los elementos que ms ayuda en el diagnstico de El ndice de Tei o ndice de performance ven-
HVWDHQIHUPHGDGHVHOFDPELRHQODWH[WXUDWLVXODUHQ WULFXODU VLVWRGLDVWyOLFD VH GHQH FRPR OD VXPD GHO
vidrio esmerilado. Por otra parte, Se documenta con WLHPSR GH FRQWUDFFLyQ \ UHODMDFLyQ LVRYROXPpWULFR
IUHFXHQFLDGHUUDPHSHULFiUGLFRPRGHUDGRHQXQ medido a nivel mitral y o tricuspdeo dividido por el
GHORVFDVRV  TXHSRUORJHQHUDOQRRFDVLRQD tiempo de eyeccin artico o pulmonar respectiva-
taponamiento pericrdico pero que se observa cuando mente si es izquierdo o derecho respectivamente. En
ODHQIHUPHGDGHVWiDYDQ]DGD   la amiloidosis cardaca, los tiempos de contraccin
El Eco Doppler es de suma utilidad en la amiloi- \ UHODMDFLyQ LVRYROXPpWULFR HVWiQ PX\ SURORQJDGRV
dosis cardaca pues es la gran simuladora porque mientras que el de eyeccin se encuentra muy acorta-
HQHOFRPLHQ]RGHODHQIHUPHGDGH[LVWHXQDSDWHQWH do por lo que el ndice se encuentra muy aumentado
GH UHWUDVR HQ OD UHODMDFLyQ D PHGLGD TXH DYDQ]D OD FRQUHVSHFWRDORQRUPDO S HVSHFLDOPHQWHHQ
misma se comprueba una patente pseudonormaliada los pacientes con amiloidosis y tiempo de desacelera-
\UHFLpQHQHVWDGtRVQDOHVXQDSDWHQWHUHVWULFWLYD(O cin mitral y /o tricuspdeo acortado y la fraccin de
eco Doppler no slo se emplea en el diagnstico sino H\HFFLyQYHQWULFXODUL]TXLHUGDPX\GLVPLQXtGD 
WDPELpQSDUDODHVWUDWLFDFLyQGHODVREUHYLGDGHHVWD Se debe agregar que en los estadios iniciales en
HQIHUPHGDGHVDVtTXH&XHWR*DUFLDHWDO  HV- los que todava se observa una patente mitral y tri-
tableci diferentes estados segn los hallazgos del FXVStGHDFRQUHWUDVRHQODUHODMDFLyQHQHOHFRPRGR
eco Doppler cardaco. En el estado I se evidencia 0FRORUVLELHQODYHORFLGDGGHSURSDJDFLyQDOiSH[
KLSHUWURDFRQFpQWULFDYHQWULFXODUL]TXLHUGDGH basal y total se encuentran disminuidos y el tiempo
PPHKLSHUWURDGHSDUHGOLEUHGHOYDQWUtFXORGHUH- de retardo basal-apical alargado con respecto a los


CAPTULO 7 Miocardiopata restrictiva

valores de la pericarditis constrictiva, la onda A es de que ciertos parmetros clnicos y serolgicos como
PD\RUYHORFLGDGTXHODRQGD(FRORU  ODWURSRQLQD\HO17SUR%133RU~OWLPRHO'VLUYH
El eco transesofgico  VLUYHHQDTXHOORVFDVRV para el anlisis segmentario y los cambios de volu-
en que es difcil la visualizacin por eco transtorcico men ventricular izquierdo.
por la mala ventana ultrasnica pero lo que permite en La resonancia magntica es de utilidad en cardio-
la actualidad un diagnstico precoz es el eco tisular loga porque adems de visualizar las estructuras car-
y el strain rate con disminucin de la onda sistlica GtDFDV\VXVDOWHUDFLRQHVSHUPLWHGLIHUHQFLDUWHMLGRV
\XQDUHODFLyQRQGD(PLWUDORQGD(WLVXODU!GH DQRUPDOHV GH OD EULOOD PLRFiUGLFD QRUPDO Si bien
(QHO'RSSOHUWLVXODU  ODSUHVHQFLDGH el mecanismo del realce tardo no est del todo dilu-
movimiento temprano del anillo mitral y de veloci- cidado, la evidencia actual sugiere que se relaciona
dades miocrdicas durante el perodo isovolumtrico con una combinacin de lavado retardado con un vo-
diastlico son las variables ms precisas para detec- lumen de distribucin del gadolinio aumentado en el
WDULQOWUDFLyQDPLORLGHD/RVVLJXLHQWHVSDUiPHWURV HVSDFLRLQWHUVWLFLDOGHOPLRFDUGLRDQRUPDO  En la
GHYHORFLGDGGLDVWyOLFDPi[LPDSUHFR]GHODQLOORHQ amiloidosis cardaca, el realce tardo subendocrdico
HO ODGR ODWHUDO PHQRU R LJXDO GH FPV YHORFLGDG global producto del depsito amiloideo intersticial
GLDVWyOLFDPi[LPDSUHFR]GHODQLOORHQHOODGRPHGLDO VHSXHGHH[WHQGHUDOYHFLQRPLRFDUGLR9RJHOVEHUJHW
PHQRURLJXDOGHFPVYHORFLGDGLVRYROXPpWULFD DO  DOXVDUODSDWHQWHGHUHDOFHWDUGtRHQHOVXEHQ-
velocidad media miocrdica precoz menor o igual de GRFDUGLRFLUFXQIHUHQFLDOWRWDOFRQH[WHQVLyQYDULDEOH
FPVYHORFLGDGLVRYROXPpWULFDJUDGLHQWHGHYH- al miocardio adyacente obtuvieron una sensibilidad
ORFLGDGPLRFiUGLFDSUHFR]PHQRURLJXDOGHV de la resonancia magntica para amiloidosis cardaca
velocidad isovolumtrica- gradiente de velocidad GHOXQDHVSHFLFLGDGGHOXQYDORUSUHGLF-
PLRFiUGLFDWDUGtDPD\RURLJXDOGHVGLIHUHQ- WLYRSRVLWLYRGHO\XQRQHJDWLYRGHO
cia los pacientes con amiloidosis de los controles con 3XHGHH[LVWLUXQGHSyVLWRDPLORLGHRHQSDUFKHVR
XQ YDORU SUHGLFWLYR GH  \  en cebra especialmente en el septum interventricu-
UHVSHFWLYDPHQWH   (Q RWUD SXEOLFDFLyQ   VH lar y en los msculos papilares y que en algunos casos
FRPSDUyJUXSRVGHSDFLHQWHVFRQDPLORLGRVLVFDU- se hace difuso e incluso transmural y un realce tardo
GtDFD SULPDULD  VLQ FRPSURPLVR FDUGtDFR   FRQ subepicrdico, localizado en la pared lateral del ven-
FRPSURPLVRFDUGtDFRSHURVLQLQVXFLHQFLDFDUGtDFD trculo izquierdo. Se pueden llegar a visualizar lagos
\ SDFLHQWHVFRQLQVXFLHQFLDFDUGtDFD\IUDFFLyQ de sangre oscura con imagen de realce tardo produ-
GH DFRUWDPLHQWR PHQRU GHO  /DV YHORFLGDGHV cido por anomalas en la quintica del gadolinio. En
GLDVWyOLFDVPi[LPDVSUHFRFHVHQHOJUXSRHUDQPH- una persona normal, el punto cero de la sangre suele
QRUHV TXH HQ HO  \ D VX YH] PHQRUHV TXH HQ HO  ocurrir antes que la del miocardio, pero en la amiloi-
SHURHQFXDQWRDODVYHORFLGDGHVVLVWyOLFDVPi[LPDV GRVLV GHELGR D OD LQOWUDFLyQ GLIXVD \ OD DEVRUFLyQ
GHODPRWLOLGDGSDULHWDOHUDQVLJQLFDWLYDPHQWHPiV de gadolinio, el miocardio aparece ms oscuro en
EDMDVODVGHOJUXSRFRQUHVSHFWRDOSHURQRH[LV- un momento anterior a la inversin de la reserva de
WtDGLIHUHQFLDHQWUHHOJUXSR\HOHVGHFLUTXHOD sangre. (OUHDOFHWDUGtRSUHGLFHODPXHUWHPHMRUTXH
disfuncin sistlica puede ser detectada por Doppler RWURVSUHGLFWRUHVFRQYHQFLRQDOHV  . (QXQWUDEDMR
tisular an cuando la fraccin de eyeccin se encuen- GHOD&OLQLFD0D\RGHSDFLHQWHVFRQDPLORLGRVLV
tra en el rango normal. Por ltimo, la presencia de la FDUGtDFD FRQUPDGD SRU KLVWRORJtD HO UHDOFH WDUGtR
YDULDFLyQGHOEDFNVFDWWHULQWHJUDGRPLRFiUGLFRFL- HVWDED SUHVHQWH HQ HO  GH HOORV PLHQWUDV TXH OD
clo-dependiente en la pared posterior es un poderoso KLSHUWURDYHQWULFXODUL]TXLHUGDORHVWXYRHQHO
SUHGLFWRUGHPXHUWHFDUGtDFD S \GHPXHUWH El realce tardo del tipo global transmural o subendo-
WRWDO S   6LQHPEDUJRODHYDOXDFLyQGHO FiUGLFRIXHORPiVFRP~Q HQHOGHORVFDVRV \
VWUDLQ ORQJLWXGLQDO VLVWyOLFR Pi[LPR HQ HO VSHFNOH se asoci con mayor depsito intersticial amiloideo
WUDFNLQJ  \ HO VWUDLQ PHGLR EDVDO XQD PHGLGD GH OD FRQXQDS(QORVSDFLHQWHVFRQDPLORLGRVLV
funcin longitudinal del ventrculo izquierdo super cardaca, la presencia de realce tardo se asoci con
a todas las mediciones y permiti realizar el diagns- SHRUHYROXFLyQFOtQLFD\HOHFWURFDUGLRJUiFD\PD\RU
tico en aquellos casos sin evidencia de la enferme- DXPHQWRGHELRPDUFDGRUHV 
dad en el eco bidimensional o en el Doppler cardaco La precisin diagnstica de los diferentes mto-
 (QXQDQiOLVLVPXOWLYDULDGR%XVVHWDO  FRQ- dos complementarios de diagnstico vara, es as
UPDURQTXHXQDIXQFLyQORQJLWXGLQDOGHOYHQWUtFXOR TXHHOYDORUSUHGLFWLYRSRVLWLYRGHOPLFURYROWDMHHQHO
izquierdo disminuda es un predictor independiente HOHFWURFDUGLRJUDPDHVGHO\HOYDORUSUHGLFWLYR
de sobrevida y parece que ofrece mayor informacin QHJDWLYRHVGHOPLHQWUDVTXHGHOHOHFWURFDUGLR-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

JUDPDMXQWRDOHFR'RSSOHUHOYDORUSUHGLFWLYRSRVL- FLGDGTXHSURGXMRHODEDQGRQRGHODPHGLFDFLyQHQ
WLYRHVGHO\HOYDORUSUHGLFWLYRQHJDWLYRHVGHO GHORVFDVRV  $VLPLVPRVHKDHPSOHDGRHO
3RU~OWLPRHQFXDQWRDODUHVRQDQFLDPDJQpWL- WUDVSODQWHFDUGtDFRHQSDFLHQWHVPHQRUHVGHDxRV
FDODSUHFLVLyQGLDJQyVWLFDHVH[FHOHQWHSXHVHOYDORU HQFRQMXQFLyQFRQHOWUDVSODQWHGHFpOXODVPDGUH  
SUHGLFWLYRSRVLWLYRHVGHO\HOYDORUSUHGLFWLYR pero sin el tratamiento correcto del proceso subya-
QHJDWLYRHVGHO Una patente de realce tardo es cente es un procedimiento paliativo ya que la amilo-
ms precisa para el diagnstico y es un potente pre- dosis recidiva sobre el rgano nuevo y tiene una ele-
GLFWRUGHPRUWDOLGDGDODxRHQFDVRVGHDPLORLGRVLV YDGDPRUWDOLGDGSRVRSHUDWRULDFHUFDQDDO  
cardaca en comparacin con otros parmetros no El tratamiento de la coronariopata empeora con
LQYDVLYRV   bloqueantes clcicos a diferencia de la angina micro-
Para el diagnstico anatomopatolgico, la biopsia vascular del sndrome X que tambin compromete
GHJUDVDDEGRPLQDOFRQWLQFLyQGHURMR&RQJRWLHQH ODVDUWHULDVFRURQDULDVLQWUDPXUDOHV  &XDQGRVH
XQGHSRVLWLYLGDGHQODVIRUPDVSULPDULDVFRQ HPSOHDGLJLWDOHQODLQVXFLHQFLDFDUGtDFDVHSURGXFH
protena AL. Tambin se lleva a cabo en las encas, LQWR[LFDFLyQFRQIDFLOLGDGSRUODGLVPLQXFLyQGHODV
UHFWRRULxyQ(QHVWD~OWLPDVLELHQODVHQVLELOLGDG EULOODVPLRFiUGLFDVHQUHODFLyQFRQODVGHDPLORLGH
HVGHOHVPX\SHOLJURVD\DTXHHQODDPLORLGRVLV y eventualmente ha sido descripto aumento del gra-
hay alteracin de la coagulacin especialmente en el diente del tracto de salida ventricular izquierdo que
IDFWRU;SRUORTXHH[LVWHSHOLJURGHVDQJUDGR7UDV UHYLUWLy DO VXVSHQGHU OD GURJD   (O WUDWDPLHQWR
una biopsia positiva se debe determinar el tipo de WUDGLFLRQDO GH OD LQVXFLHQFLD FDUGtDFD HV DTXt SRU
amiloidosis. Se debe buscar una discrasia plasmoci- lo general, inefectivo. A pesar de la grave disfuncin
taria debido a que la forma primaria con protena AL diastlica no hay datos que avalen el uso de beta-
es la ms frecuente. Asimismo, las inmunoglobulinas EORTXHDQWHVVDOYRWDOYH]HQORVFDVRVGHEULODFLyQ
monoclonales o de cadenas livianas se detectan en auricular. Por lo general tampoco toleran los inhibi-
XQGHODVIRUPDVSULPDULDVFRQSURWHtQD$/WDQ- dores de la enzima convertidora de angiotensina ni
WRSRULQPXQRMDFLyQHOHFWURIRUpWLFDHQVDQJUHFRPR los antagonistas de los receptores de angiotensina, ya
en orina. Si es negativa se debe realizar una tincin que causan una grave hipotensin.
inmunohistoqumica con biopsia de mdula sea y El pronstico de la amiloidosis, especialmente
eventualmente un estudio gentico. GHODSULPDULD $/ XQDYH]DFDHFLGRHOFRPSURPLVR
En la hemodinamia se evidencia lo ya mencio- cardaco, como ya se ha mencionado previamente es
nado para las miocardiopatas restrictivas en general PDOR\QRVXSHUDORVPHVHV  ([LVWHQSXEOL-
\DGHPiVHVOODPDWLYDODKLSHUWURDYHQWULFXODU\GH caciones aisladas con sobrevidas ms prolongadas de
los msculos papilares con restriccin de la crista su- PiVGHDxRVFRQWUDWDPLHQWRTXLPLRWHUiSLFRSHUR
praventricular. En aquellos casos con angor en que HQXQUHGXFLGRQ~PHURGHSDFLHQWHV  1XHYDV
se realiza la cinecoronariografa se evidencia coro- drogas como la talidomida y el bortezomib son uti-
narias normales y una reserva coronaria anormal por lizadas en combinacin y especialmente esta ltima
LQOWUDFLyQ GH EULOOD DPLORLGHD HQ OD PHGLD GH ODV es altamente efectiva y bien tolerada en pacientes con
arterias de mediano calibre pues las epicrdicas ge- DPLORLGRVLV SULPDULD $/  'HVGH  VH KD HP-
QHUDOPHQWHHVWiQOLEUHVGHODHQIHUPHGDG   pleado bortezomib para el tratamiento de la amiloi-
(Q OD DFWXDOLGDG QR H[LVWH D~Q XQ WUDWDPLHQWR dosis primaria AL an en aquellos con compromiso
efectivo. El tratamiento habitual de la amiloidosis FDUGtDFR\SRWHQFLDOPHQWHPiVGHOGHSDFLHQWHV
primaria es con melfalan y prednisona, as como con que previamente no podan ser tratados por falta de
FROFKLFLQDSHURHQJHQHUDOFXDQGRH[LVWHODPLRFDU- un medicamento efectivo adquieren actualmente una
diopata restrictiva se prolonga la sobrevida en po- UHODWLYDUHPLVLyQKHPDWROyJLFD  &RQUHVSHFWRD
FRV PHVHV VDOYR SXEOLFDFLRQHV DLVODGDV   la amiloidosis hereditaria, actualmente estn en desa-
por lo que ltimamente se ha investigado el empleo UUROORSHTXHxRVOLJDQGRVTXHHVWDELOL]DQODHVWUXFWXUD
de altas dosis de melfalan seguido de trasplante de WHWUDPpULFDGHODWUDQVWLUHWLQD\SUHYLHQHQODEULOR-
FpOXODV0DGUH  &RQHVWHSURWRFRORVHHYLGHQFLy gnesis. Una droga capaz de estabilizar dicha mo-
PHMRUtDFOtQLFD\DXPHQWRGHODVREUHYLGDSHURVyOR OpFXOD HV HO DQWLLQDPDWRULR QR HVWHURLGH GLXVLQDO
en aquellos con compromiso cardaco limitado. Por Otras estrategias que utilizan anticuerpos y pptidos
otra parte, se ha empleado talidomida que ha resulta- sintticos seran aplicables tanto a la amiloidosis
do efectiva para el mieloma mltiple tras este ltimo primaria o a la heredofamiliar y lograran la estabi-
esquema mencionado con reduccin de la proteinuria lizacin de las estructuras nativas de otras protenas
GH%HQFH-RQHV\PHMRUtDFOtQLFDSHURFRQDOWDWR[L- amiloidognicas con la consiguiente prevencin de


CAPTULO 7 Miocardiopata restrictiva

ODEULORJpQHVLV  2WURVWUDWDPLHQWRVTXHVH En relacin al trasplante cardaco tras dosis ele-


han intentado es la asociacin talidomida/ lenolida- vadas de quimioterpicos, puede la amiloidosis desa-
mida o con combinacin con otros quimioterpicos rrollarse en el rgano nuevo por eso debe realizarse
 6HKDXWLOL]DGRHQORVFORQHV&'SRVLWLYRV HOWUDVSODQWHGHPpGXODyVHDGHQWURGHORVPHVHVGH
HOULWX[LPDEDVtFRPRHOERUWH]RPLETXH\DKDVLGR UHDOL]DGRHOSULPHUWUDVSODQWH  (QHOFDVRGHODV
mencionado. Un estudio reciente demostr una me- formas heredofamiliares portadores de la mutacin
MRUtDFRQGLVPLQXFLyQGHO%13VLQFDPELRVHFRFDU- 0HWVHGHEHUHDOL]DUHOWUDVSODQWHKHSiWLFR\HO
GLRJUiFRV FRQ TXLPLRWHUiSLFRV FRQ UHGXFFLyQ GHO FDUGtDFR  
SUHFXUVRUFLUFXODQWHDPLORLGRJpQLFR  


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

BIBLIOGRAFA
1. 5HSRUWRI:+2,6)&7DVN)RUFH'HQLWLRQDQGFODVVLFDWLRQRIFDUGLRP\RSDWKLHV%U+HDUW-
 Arbustini E, Buonanno C, Trevi GP et al. Cardiac ultrastructure in primary restrictive cardiomyopathy. Chest

 *RRGZLQ-)'HQLFLyQ\FODVLFDFLyQGHODVPLRFDUGLRSDWtDV5HY/DWLQRDPHU&DUGLRO
 :\QH - %UDXQZDOG ( 7KH FDUGLRP\RSDWKLHV DQG P\RFDUGLWLGHV WR[LF FKHPLFDO DQG SK\VLFDO GDPDJH WR WKH
KHDUW,Q%UDXQZDOG(HG+HDUWGLVHDVHDWH[WERRNRIFDUGLRYDVFXODUPHGLFLQHWKGH9RO3KLODGHOSKLD:%
6DXQGHUV
 Shabetai R, Fowler NO, Gunheroth WG. The hemodynamics of cardiac tamponade and constrictive pericarditis. Am
-&DUGLR
 Appleton CP, Hatle L, Popp R. Demonstration of restrictive ventricular physiology by Doppler echocardiography. J
$P&ROO&DUGLRO
7. )LW]SDWULFN$36KDSLUR/05LFNDUGV$)3RROH:LOVRQ3$)DPLOLDOUHVWULFWLYHFDUGLRP\RSDWK\ZLWKDWULRYHQWULFXODU
EORFNDQGVNHOHWDOP\RSDWK\%U+HDUW-
 +D\DVKL 7 7VXGD ( .XURVDNL . HW DO (OHFWURFDUGLRJUDSKLF DQG FOLQLFDO FKDUDFWHULVWLFV RI LGLRSDWKLF UHVWULFWLYH
FDUGLRP\RSDWK\LQFKLOGUHQ&LUF-
9. &DVHOODV%HUQDW$2FD1DYDUUR)5LEDV*DUDX06HPLORJtDUDGLROyJLFDGHOFRUD]yQ\YDVRVHG(VSD[V%DUFHORQD
(VSDxDSDJ
 Hatle LK, Appleton CP, Popp RL. Differentiation between constrictive pericarditis and restrictive cardiomyopathy
E\'RSSOHUHFKRFDUGLRJUDSK\&LUFXODWLRQ
11. $SSOHWRQ&3+DWOH/.3RSS5/5HODWLRQRIWUDQVPLWUDORZYHORFLW\SDWWHUQVWROHIWYHQWULFXODUGLDVWROLFIXQFWLRQ
QHZLQVLJKWVIURPDFRPELQHGKHPRG\QDPLFDQG'RSSOHUHFKRFDUGLRJUDSKLFVWXG\-$P&ROO&DUGLRO

 &KLOG-63HUORII-'7KHUHVWULFWLYHFDUGLRP\RSDWKLHV&DUGLRO&OLQ
 +RVHQSXG-'5HVWULFWLYHFDUGLRP\RSDWK\,Q=LSHV'3DQG5RZODQGV'- HGV 3URJUHVVLQ&DUGLRORJ\3KLODGHOSKLD
/HDDQG)HELJHUS
 /HZLV$%&OLQLFDOSUROHDQGRXWFRPHRIUHVWULFWLYHFDUGLRP\RSDWK\LQFKLOGUHQ$P+HDUW-
 Schoenfeld M, Supple E, Dec W et al. Restrictive cardiomyopathy versus constrictive pericarditis: role of
HQGRP\RFDUGLDOELRSV\LQDYRLGLQJXQQHFHVDU\WKRUDFRWRP\&LUFXODWLRQ
 &KHZ&<=LDG\*05DSKDHO0-HWDO3ULPDU\UHVWULFWLYHFDUGLRP\RSDWK\1RQWURSLFDOHQGRP\RFDUGLDOEURVLV
DQGK\SHUHRVLQRSKLOLFKHDUWGLVHDVH%U+HDUW-
17. %DOO-':LOOLDPV$:'DYLHV-1(QGRP\RFDUGLDOEURVLV/DQFHW
 %HUHQV]WHLQ&65RLVLQEOLW-7RULQR$6XDUH]/'0LRFDUGLRSDWtDVUHVWULFWLYDV(GLPHG%XHQRV$LUHV
19. 6SU\&-)7KHK\SHUHRVLQRSKLOLFV\QGURPHFOLQLFDOIHDWXUHVODERUDWRU\QGLQJVDQGWUHDWPHQW$OOHUJ\

 6SU\&-)7KH+\SHUHRVLQRSKLOLF6\QGURPH/DQFHW
 6SU\&-)(RVLQRSKLOVLQHRVLQRSKLOLFHQGRP\RFDUGLDOGLVHDVH3RVWJUDGXDWH0HGLFDO-RXUQDO
 Dahl R, Venge P, Olsson I. Variations of Blood Eosinophils and Eosinophil Cationic Proteins in Serum of Patients
ZLWK%URQTXLDO$VWKPD$OOHUJ\
 'DKO 59HQJH 3 (QKDQFHPHQW RI 8URNLQDVH,QGXFHG 3ODVPLQRJHQ$FWLYDWLRQ E\ WKH &DWLRQLF 3URWHLQ RI +XPDQ
(RVLQRSKLO*UDQXORF\WHV7KURPE5HV
 Roberts WC, Liegler DG, Carbone PP. Endomyocardial disease and eosinophilia. A clinical and pathologic spectrum.
$P-0HG
 6FRWW0(%UXFH-+/|IHUVHQGRFDUGLWLV%U+HDUW-
 Mocumbi AO, Ferreira MB, Sidi D, et al. A Population Study of Endomyocardial Fibrosis in a Rural Area of
0R]DPELTXH1(QJO-0HG
 'LHQRW%(NUD$%HUWUDQG(/HFKRFDUGLRJUDSKLHGDQVFDVGHEURVHVHQGRP\RFDUGLTXHFRQVWULFWLYHVGURLWHV
RXELODWpUDOHV$UFK0DO&RHXU
 $FTXDWHOOD+7ZRGLPHQVLRQDOHFKRFDUGLRJUDSK\LQHQGRP\RFDUGLDOGLVHDVH3RVWJUDG0HG-
 :H\PDQ$(5DQNLQ5.LQJ+/RHIHUVHQGRFDUGLWLVSUHVHQWLQJDVPLWUDODQGWULFXVSLGVWHQRVLV$P-&DUGLRO

 6KDSHU$*:KDWVQHZLQHQGRP\RFDUGLFDOEURVLV"/DQFHW
 Acquatella H, Schiller NB, Puigbo JJ et al. Value of two-dimensional echocardiography in endomyocardial disease
ZLWKDQGZLWKRXWHRVLQRSKLOLD&LUFXODWLRQ
 Appleton CP, Hatle L, Popp R. Demonstration of restrictive ventricular phisiology by Doppler echocardiography.
-$P&ROO&DUGLRO
 Klein AL, Cohen GI, Pietrolungo JF et al. Differentiation of constrictive pericarditis from restrictive cardiomyopathy
E\'RSSOHUWUDQVHVRSKDJHDOHFKRFDUGLRJUDSKLFPHDVXUHPHQWVRIUHVSLUDWRU\YDULDWLRQVLQSXOPRQDU\YHQRXVRZ


CAPTULO 7 Miocardiopata restrictiva

-$P&ROO&DUGLRO
 1LVKLPXUD5$EHO0'+DWOH/.7DMLN$-$VVHVVPHQWRIGLDVWROLFIXQFWLRQRIWKHKHDUWEDFNJURXQGDQGFXUUHQW
DSSOLFDWLRQVRI'RSSOHUHFKRFDUGLRJUDSK\3DUW,,0D\R&OLQ3URF
 Hatle L, Appleton CP, Popp R. Differentiation of constrictive pericarditis and restrictive cardiomyopathy by Doppler
HFKRFDUGLRJUDSK\&LUFXODWLRQ
 *URGHFNL 39 .OHLQ $/ 3LWIDOOV LQ WKH (FKR 'RSSOHU DVVHVVPHQW RI GLDVWROLF G\VIXQFWLRQ  (FKRFDUGLRJUDSK\

 Goldstein JA. Differentiation of constrictive pericarditis and restrictive cardiomyopathy. J Am Coll Cardiol, ACC
(GXFDWLRQDO+LJKOLJKWV
 Garcia MJ, Rodriguez L, Ares M,. Differentiation of constrictive pericarditis from restrictive cardiomyopathy:
$VVHVVPHQWRIOHIWYHQWULFXODUGLDVWROLFYHORFLWLHVLQORQJLWXGLQDOD[LVE\'RSSOHU7LVVXHLPDJLQJ-$P&ROO&DUGLRO

 Garcia MJ, Thomas JD, Klein AL. New Doppler echocardiographic applications for the study of diastolic funtion. J
$P&ROO&DUGLRO
 5RGULJXH]/$UHV09DQGHUYRRUW3HWDO'RHVFRORU00RGHRZSURSDJDWLRQGLIIHUHQWLDWHEHWZHHQSDWLHQWVZLWK
UHVWULFWLYHYV&RQVWULFWLYHSK\VLRORJ\ DEVWUDFW "-$P&ROO&DUGLRO
 6FKLDYRQH:$&DODRUH3$6DOFHGR(7UDQVHVRSKDJHDO'RSSOHUHFKRFDUGLRJUDSKLFGHPRQVWUDWLRQRISXOPRQDU\
YHQRXVRZYHORFLW\LQUHVWULFWLYHFDUGLRP\RSDWK\DQGFRQVWULFWLYHSHULFDUGLWLV$P-&DUGLRO
 %HUHQV]WHLQ&63LxHLUR'0DUFRWHJXL0HWDO8VHIXOQHVVRIHFKRFDUGLRJUDSK\DQGHFKR'RSSOHULQHQGRP\RFDUGLDO
GLVHDVHLQHQGRP\RFDUGLDOEURVLV-$P6RF(FKRFDUGLRJU
 *XSWD$6LQJK*XODWL*6HWK6HWDO&DUGLDF05,LQUHVWULFWLYHFDUGLRP\RSDWK\&OLQLFDO5DGLRORJ\

 'HE.'MDYLGDQL%%XFKHU6HWDO7LPHFRXUVHRIHRVLQRSKLOLFP\RFDUGLWLVYLVXDOL]HGE\&05-&DUGLRYDVF
0DJQ5HVRQ
 3RUHED05RVWRII3.RQGXUDFND(HWDO(QGRP\RFDUGLDOGLVHDVHDVWKHUVWPDQLIHVWDWLRQRIK\SHUHRVLQRSKLOLF
V\QGURPH.DUGLRO3RO
 9DOLDWKDQ06%DODNULVKQDQ.*6DQNDUNXPDU5HWDO6XUJLFDOWUHDWPHQWRIHQGRP\RFDUGLDOEURVLV$QQ7KRUDF
6XUJ
 0HWUDV ' &RXOLEDO\$2 2XDWWDUD . 7KH VXUJLFDO WUHDWPHQW RI HQGRP\RFDUGLDO EURVLV UHVXOWV LQ  SDWLHQWV
&LUFXODWLRQ
 6FKQHLGHU 8 -HQQL 5 7XULQD - HW DO /RQJ WHUP IROORZ XS RI SDWLHQWV ZLWK HQGRP\RFDUGLDO EURVLV HIIHFWV RI
VXUJHU\+HDUW
 Virchow R. La Cellularpathologie in ihrer Begrndung auf physiologische und pathologische Gewebelehre de
5XGROI9LUFKRZ
 &RKHQ$6 &DONLQV ( (OHFWURQ PLFURVFRSLF REVHUYDWLRQV RQ D EURXV FRPSRQHQW LQ DP\ORLG RI GLYHUVH RULJLQV
1DWXUH$SU
 &RKHQ$6$P\ORLGRVLV1(QJO-0HG
 Chew C, Ziady GM, Raphael ML et al. The functional defect in amyloid heart disease. The stiff heart syndrome. Am
-&DUGLRO
 )DON5+&RPHQ]R5/6NLQQHU07KHV\VWHPLFDP\ORLGRVHV1(QJO-0HG
 .\OH5$*HUW]0$3ULPDU\V\VWHPLFDP\ORLGRVLVFOLQLFDODQGODERUDWRU\IHDWXUHVLQFDVHV6HPLQ+HPDWRO

 *OHQQHU*$P\ORLGGHVSRVLWVDQGDP\ORLGRVLV1(QJO-0HG
 /LQNH539RLJW&6WRUNHO)6HWDO1WHUPLQDODPLQRDFLGVHTXHQFHDQDO\VLVLQGLFDWHVWKDWLVRODWHGDWULDODP\ORLGLV
GHULYHGIURPDWULDOQDWULXUHWLFSHSWLGH9LUFKRZV$UFK
 8OOLDQ0(+DPPRQG:6$OIUH\$&HWDO%PLFURJOREXOLQHPLDDVVRFLDWHGDP\ORLGRVLVLQFKURQLFKHPRGLDO\VLV
SDWLHQWVZLWKFDUSDOWXQQHOV\QGURPH0HGLFLQH
 .\OH 5$ *UHLSS 35 $P\ORLGRVLV $/  &OLQLFDO DQG ODERUDWRU\ IHDWXUHV LQ  FDVHV 0D\R &OLQ 3URF 2FW

 +RQJR0<DPDPRWR+.RKGD7HWDO&RPSDULVRQRIHOHFWURFDUGLRJUDSKLFQGLQJVLQSDWLHQWVZLWK$/ 3ULPDU\ 
DP\ORLGRVLVDQGLQIDPLOLDODP\ORLGSROLQHXURSDWK\DQGDQJLQDOSDLQDQGWKHLUUHODWLRQWRKLVWRSDWKRORJLFQGLQJV
$P-&DUGLRO
 .\OH5$%D\UG('$P\ORLGRVLV5HYLHZRIFDVHV0HGLFLQH %DOWLPRUH 
 +XQWHU$0%RUVH\'4&DPSEHOO,:HWDO3URWHLQORVLQJHQWHURSDWK\GXHWRJDVWURLQWHVWLQDODP\ORLGRVLV3RVWJUDG
0HG-
 Bernardi L, Passino C, Porta C et al. Widespread cardiovascular autonomic dysfunction in primary amyloidosis:
GRHVVSRQWDQHRXVK\SHUYHQWLODWLRPKDYHDFRPSHQVDWRU\UROHDJDLQVWSRVWXUDOK\SRWHQVLRQ+HDUW
 'XEUH\6:&KD.$QGHUVRQ-HWDO7KHFOLQLFDOIHDWXUHVRILPPXQRJOREXOLQOLJKWFKDLQ $/ DP\ORLGRVLVZLWK
KHDUWLQYROYHPHQW4-0
 Carroll JD, Gaasch WH, McAdam KP: Amyloid cardiomyopathy: characterization by a distinctive voltage/mass


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

UHODWLRQ$P-&DUGLRO
 0XUWDJK%+DPPLOO6&*HUW]0$HWDO(OHFWURFDUGLRJUDSKLFQGLQJVLQSULPDU\V\VWHPLFDP\ORLGRVLVDQGELRSV\
SURYHQFDUGLDFLQYROYHPHQW$P-&DUGLRO
 Angiero SM, Rossi L. Conduction system in cardiac amylodosis: two cases succumbed to cardiac arrest. Ital Heart
-
 *HUW]0$.\OH5$3ULPDU\V\VWHPLFDP\ORLGRVLV$GLDJQRVWLFSULPHU0D\R&OLQ3URF
 0RUQHU6+HOOPDQ86XKU2%HWDO$P\ORLGKHDUWGLVHDVHPLPLFNLQJK\SHUWURSKLFFDUGLRP\RSDWK\-,QWHUQ0HG

 3UHVWL &) :DOOHU %) $UPVWURQJ :) &DUGLDF DP\ORLGRVLV PLPLFNLQJ WKH HFKRFDUGLRJUDSKLF DSSHDUDQFH RI
REVWUXFWLYHK\SHUWURSKLFP\RSDWK\&KHVW
 %RUHU-+HQU\:(SVWHLQ6(FKRFDUGLRJUDSKLFREVHUYDWLRQVLQSDWLHQWVZLWKV\VWHPLFLQOWUDWLYHGLVHDVHLQYROYLQJ
WKHKHDUW$P-&DUGLRO
71. 6LTXHLUD)LOKR$&XQKD&/37DMLN$-HWDO0PRGHDQGWZRGLPHQVLRQDOHFKRFDUGLRJUSKLFIHDWXUHVLQFDUGLDF
DP\ORLGRVLV&LUFXODWLRQ
 6ZDQWRQ 5+ %URRNVE\ ,$ 'DYLHV 0- HW DO 6\VWROLF DQG GLDVWROLF YHQWULFXODU IXQFWLRQ LQ FDUGLDF DP\ORLGRVLV
6WXGLHVLQVL[FDVHVGLDJQRVHGZLWKHQGRP\RFDUGLDOELRSV\$P-&DUGLRO3URF
 Burroughs EI, Aronson AE, Duffy JR, et al. Speech disorders in systemic amyloidosis. Br J Disord Commun

 &XHWR*DUFtD/7DMLN$-.\OH5HWDO6HZDUG-6HULDOHFKRFDUGLRJUDSKLFREVHUYDWLRQVLQSDWLHQWVZLWKSULPDU\
V\VWHPLFDP\ORLGRVLVDQLQWURGXFWLRQWRWKHFRQFHSWRIHDUO\ DV\PSWRPDWLF DP\ORLGLQOWUDWLRQRIWKHKHDUW0D\R
&OLQ3URF
 &XHWR*DUFtD/5HHGHU*6.\OH5HWDO(FKRFDUGLRJUDSKLFQGLQJVLQV\VWHPLFDP\ORLGRVLV6SHFWUXPRIFDUGLDF
LQYROYHPHQWDQGUHODWLRQWRVXUYLYDO-$P&ROO&DUGLRO
 Klein AL, Hatle LK, Burstow DJ et al. Doppler characterization of left ventricular diastolic function in cardiac
DP\ORLGRVLV-$P&ROO&DUGLRO
77. Klein AL, Hatle LK, Taliercio C et al. Serial Doppler echocardiographic follow up of left ventricular diastolic
IXQFWLRQLQFDUGLDFDP\ORLGRVLV-$P&ROO&DUGLRO
 .OHLQ$/+DWOH/.7DOLHUFLR&HWDO3URJQRVWLFVLJQLFDQFHRI'RSSOHUPHDVXUHVRIGLDVWROLFIXQFWLRQLQFDUGLDF
DP\ORLGRVLV&LUFXODWLRQ
79. Cohen GL, Pietrolungo JF, Thomas JD et al. A practical guide to assessment of ventricular diastolic function using
'RSSOHUHFKRFDUGLRJUDSK\-$P&ROO&DUGLRO
 2NL7)XNXGD1,XFKL$HWDO$FDVHRIFDUGLDFDP\ORLGRVLVSUHVHQWLQJZLWKPLGWRODWHGLDVWROLFUHWURJUDGHRZ
IURPWKHOHIWDWULXPWRWKHSXOPRQDU\YHLQ(FKRFDUGLRJUDSK\
 'LQJOL'8W]-3*HUW]023XOPRQDU\K\SHUWHQVLRQLQSDWLHQWVZLWKDP\ORLGRVLV&KHVW
 Klein AL, Hatle LK, Burstow DJ et al. Doppler assessment of right ventricular diastolic function in cardiac
DP\ORLGRVLV-$P&ROO&DUGLRO
 7HL & 'XMDUGLQ .6 +RGJH '2 HW DO 'RSSOHU LQGH[ FRPELQLQJ V\VWROLF DQG GLDVWROLF P\RFDUGLDO SHUIRUPDQFH
FOLQLFDOYDOXHLQFDUGLDFDP\ORLGRVLV-$P&ROO&DUGLRO
 3DOND 3 /DQJH $ 'RQQHO\ ( HW DO 'RSSOHU WLVVXH HFKRFDUGLRJUDSKLF IHDWXUHV RI FDUGLDF DP\ORLGRVLV -$6(

 Koyama J, Ray-Sequin P, Davidoff R et al. Usefulness of pulsed tissue Doppler imaging for evaluating systolic and
GLDVWROLFOHIWYHQWULFXODUIXQFWLRQLQSDWLHQWVZLWK$/ SULPDU\ DP\ORLGRVLV$P-&DUGLRO
 .R\DPD - 5D\6HTXLQ 3 )DON 5+ 3URJQRVWLF VLJQLFDQFH RI XOWUDVRXQG P\RFDUGLDO WLVVXH FKDUDFWHUL]DWLRQ LQ
SDWLHQWVZLWKFDUGLDFDP\ORLGRVLV&LUFXODWLRQ
 %DOOR30RQGLOOR6=XSSLUROL$3URJQRVWLFVLJQLFDQFHRIVWUDLQLPDJLQJLQDP\ORLGRVLV3URJQRVWLFVLJQLFDQFH
RIVWUDLQLPDJLQJLQDP\ORLGRVLV-$P&ROO&DUGLRO,PJ
 Buss SJ, Emami M, Mereles D et al. Longitudinal Left Ventricular Function for Prediction of Survival in Systemic
/LJKW&KDLQ$P\ORLGRVLV,QFUHPHQWDO9DOXH&RPSDUHG:LWK&OLQLFDODQG%LRFKHPLFDO0DUNHUV-$P&ROO&DUGLRO
RQOLQH$XJXVW
 .ZRQJ5<)DON5+&DUGLRYDVFXODU0DJQHWLF5HVRQDQFHLQ&DUGLDF$P\ORLGRVLV&LUFXODWLRQ
 Vogelsberg H, Mahrholdt H, Deluigi CC et al. Cardiovascular magnetic resonance in clinically suspected cardiac
DP\ORLGRVLVQRQLQYDVLYHLPDJLQJFRPSDUHGWRHQGRP\RFDUGLDOELRSV\-$P&ROO&DUGLRO
91. 0DFHLUD$03UDVDG6+DZNLQV3HWDO&DUGLRYDVFXODUPDJQHWLFUHVRQDQFHDQGSURJQRVLVLQFDUGLDFDP\ORLGRVLV
-&DUGLRYDVF0DJQ5HVRQ
 6\HG ,0 *ORFNQHU -) )HQJ ' HW DO 5ROH RI &DUGLDF 0DJQHWLF 5HVRQDQFH ,PDJLQJ LQ WKH 'HWHFWLRQ RI &DUGLDF
$P\ORLGRVLV-$P&ROO&DUGLRO,PJ
 Austin BA, Tang WH, Rodriguez ER et al. Delayed Hyper-Enhancement Magnetic Resonance Imaging Provides
,QFUHPHQWDO'LDJQRVWLFDQG3URJQRVWLF8WLOLW\LQ6XVSHFWHG&DUGLDF$P\ORLGRVLV-$P&ROO&DUGLRO,PJ
-77.
 Al Suwaidi J, Velianou JL, Gertz MA et al. Systemic amyloidosis presenting with angina pectoris. Ann Intern Med


CAPTULO 7 Miocardiopata restrictiva


 Sarchorawala V, Wright DG, Seldin DC et al. An overview of the use of high dose melphalan with autologous stem
FHOOWUDQVSODQWDWLRQIRUWKHWUHDWPHQWRI$/DP\ORLGRVLV%RQH0DUURZ7UDQVSODQW
 .\OH5$*HUW]0$*UHLSS35HWDO/RQJWHUPVXUYLYDO \HDUVRUPRUH LQSDWLHQWVZLWKSULPDU\DP\ORLGRVLV
%ORRG
97. Grogan M, Gertz MA, Kyle RA et al. Five or more years of survival in patients with primary systemic amyloidosis
DQGELRSV\SURYHQFDUGLDFLQYROYHPHQW$P-&DUGLRO
 6HOGLQ '& &KRXMDQL (% 'HPNHU /0 HW DO 7DOLGRPLGD LQ OLJKW FKDLQ DVVRFLDWHG DP\ORLGRVLV &OLQ /\PSKRPD

99. $UEXVWLQL(*DYD]]L$0HUOLQL*3URWHLQLFKHEULOODQRODPLORLGRVL1XRYHVSHUDQ]HSHUXQDPDODWLDFKHLO
FDUGLRORJRGHEHFRQRVFHUH,WDO+HDUW-
'XEUH\6:%XUNH00.KDJKDQL$HWDO/RQJWHUPUHVXOWVRIKHDUWWUDQVSODQWDWLRQLQSDWLHQWVZLWKDP\ORLGKHDUW
GLVHDVH+HDUW
*HUW] 0$ )DON 5+ 6NLQQHU 0 HW DO:RUVHQLQJ RI FRQJHVWLYH KHDUW IDLOXUH LQ DP\ORG KHDUW GLVHDVH WUHDWHG E\
FDOFLXPFKDQQHOEORFNLQJDJHQWV$P-&DUGLRO
3HWVFK03XO\D.$QGHUV2$XJPHQWDWLRQRIOHIWYHQWULFXODURXWRZJUDGLHQWE\GLJLWDOLVJO\FRVLGHVLQDFDVHRI
FDUGLDF$/DP\ORLGRVLV'WVFK0HG:RFKHQVFK
4XDUWD&&)DON5+/RQJLWXGLQDO6WUDLQ,PDJLQJLQ/LJKW&KDLQ&DUGLDF$P\ORLGRVLV&DQLW+HOSWR5HQHWKH
$SSURDFKWR7UHDWPHQW"-$P&ROO&DUGLRORQOLQH$XJXVW
.DVWULWLV(:HFKDOHNDU$''LPRSRXORV0$HWDO%RUWH]RPLEZLWKRUZLWKRXWGH[DPHWKDVRQHLQSULPDU\V\VWHPLF
OLJKWFKDLQ DP\ORLGRVLV-&OLQ2QFRO
Oza VB, Smith C, Raman P et al. Synthesis, structure, and activity of diclofenac analogues as transthyretin amyloid
EULOIRUPDWLRQLQKLELWRUV-0HG&KHP
$OPHLGD05*DOHV/'DPDV$0HWDO6PDOOWUDQVWK\UHWLQ 775 OLJDQGVDVSRVVLEOHWKHUDSHXWLFDJHQWVLQ775
DP\ORLGRVHV&XUU'UXJ7DUJHWV&161HXURO'LVRUG
*LOOPRUH-'+DZNLQV31'UXJLQVLJKWHPHUJLQJWKHUDSLHVIRUDP\ORLGRVLV1DW&OLQ3UDFW1HSKURO

&RHOKR 7 0DLD 0 0DUWLQV GD 6LOYD$ HW DO$ ODQGPDUN FOLQLFDO WULDO RI D QRYHO VPDOO PROHFXOH WUDQVWK\UHWLQ
775  VWDELOL]HU )[$ LQ SDWLHQWV ZLWK775 DP\ORLG SRO\QHXURSDWK\ D SKDVH ,, ,,, UDQGRPL]HG GRXEOH
EOLQGSODFHERFRQWUROOHGVWXG\1HXURORJ\
Coelho T, Waddington-Cruz M, Plante-Bordeneuve V, et al: Correlation of clinical outcomes and disease burden in
SDWLHQWVZLWKWUDQVWK\UHWLQ 775 DP\ORLGSRO\QHXURSDWK\VWXG\)[DODQGPDUNFOLQLFDOWUDLORI)[$D
QRYHOVPDOOPROHFXOH775VWDELOL]HU-1HXURO
6HOGLQ'&&KRXIDQL(%'HPEHU/0HWDO7ROHUDELOLW\DQGHIFDF\RIWKDOLGRPLGHIRUWKHWUHDWPHQWRISDWLHQWV
ZLWKOLJKWFKDLQDVVRFLDWHG $/ DP\ORLGRVLV&OLQ/\PSKRPD
111. Palladini G, Lavatelli F, Russo P et al. Circulating amyloidogenic free light chains and serum N-terminal natriuretic
SHSWLGHW\SH%GHFUHDVHVLPXOWDQHRXVO\LQDVVRFLDWLRQZLWKLPSURYHPHQWRIVXUYLYDOLQ$/%ORRG
6HOYDQD\DJDP-%3KLOLS1+DZNLQV31HWDO(YDOXDWLRQDQG0DQDJHPHQWRIWKH&DUGLDF$P\ORLGRVLV-$P&ROO
&DUGLRO
6WDQJRX$-+DZNLQV31/LYHUWUDQVSODQWDWLRQLQWUDQVWK\UHWLQUHODWHGIDPLOLDODP\ORLGSRO\QHXURSDWK\&XUU2SLQ
1HXURO


&$3,78/2

INSUFICIENCIA MITRAL

AUGUSTO TORINO, PABLO ROURA

DEFINICIN +HDUW /XQJ DQG %ORRG ,QVWLWXWH 1+/%,  VREUH


FDVLLQGLYLGXRVGHWUHVHVWXGLRVHSLGHPLROy-
6H HQWLHQGHSRU LQVXFLHQFLDPLWUDO ,0  DOUHXMR gicos poblacionales cuyos resultados fueron compa-
de sangre desde el ventrculo izquierdo a la aurcula UDGRVFRQDTXHOORVREWHQLGRVGHLQGLYLGXRV
izquierda durante la sstole. de un estudio comunitario realizado en el condado
8QSXQWRGHSDUWLGDHVHQFLDOSDUDHODERUGDMHGH de Olmsted en Rochester, Minnesota, a cargo de la
esta entidad, radica en comprender que el aparato Clnica Mayo. Del anlisis de ambas series surgen
YDOYXODU PLWUDO HV XQD HVWUXFWXUD H[WUHPDGDPHQWH dos conceptos relevantes, primero, la prevalencia
FRPSOHMDWDQWRGHVGHHOSXQWRYLVWDHVWUXFWXUDOFRPR de las formas moderadas a severas de enfermedad
funcional. Se ven involucrados componentes estric- valvular aumenta con la edad, y segundo, stas tie-
tamente valvulares, como as tambin estructuras nen impacto pronstico en trminos de sobrevida.
VXEYDOYXODUHVGHOPLRFDUGLR\GHOWHMLGRFRQHFWLYR La IM es la valvulopata ms prevalente, y se estima
La afeccin de cualquiera de ellas, puede ser respon- TXHDIHFWDDDPLOORQHVGHLQGLYLGXRVHQ(V-
sable de la incompetencia valvular. tados Unidos de Norteamrica. Hallazgos similares
(OFRQRFLPLHQWRGHVXSDUWLFXODUVLRORJtDHVQH- VXUJHQGHO(XUR+HDUW6XUYH\VLQELHQpVWHUHJLVWUR
cesario para la comprensin de su patologa, lo cual slo contempla los casos que requieren hospitaliza-
D VX YH] LPSOLFD XQD JUDQ FRPSOHMLGDG HQ OD WRPD FLyQ\VHULHVTXLU~UJLFDV  
de decisin, dada la alteracin que produce en las La dramtica disminucin de la cardiopata reum-
condiciones de carga del ventrculo izquierdo y los WLFDHQORVSDtVHVLQGXVWULDOL]DGRVMXQWRFRQHODXPHQ-
diferentes mecanismos y etiologas que condicionan WRHQODH[SHFWDWLYDGHYLGDGHODSREODFLyQJHQHUDO
su evolucin. han hecho de las formas degenerativas, y aquellas aso-
ciadas a la enfermedad coronaria, las ms prevalentes.
EPIDEMIOLOGA Esto tiene, y tendr an ms en el futuro, un importan-
te impacto sobre el sistema sanitario.
Cuando intentamos analizar la prevalencia, y carga La situacin es diferente cuando analizamos otras
real de enfermedad atribuible a las enfermedades val- regiones del planeta. En el continente africano, por
vulares en general, nos encontramos invariablemente HMHPSORODVYDOYXORSDWtDVGHHWLRORJtDUHXPiWLFDVRQ
con falta de informacin y con una enorme dispari- ODIRUPDPiVIUHFXHQWHGHHQIHUPHGDGYDOYXODUDIHF-
dad de datos segn la metodologa diagnstica uti- WDQGR IXQGDPHQWDOPHQWH D QLxRV \ DGXOWRV MyYHQHV
OL]DGD\ODUHJLyQJHRJUiFDFRQVLGHUDGDOD,0QR /D2UJDQL]DFLyQ0XQGLDOGHOD6DOXGHVWLPDHQ
escapa a esta realidad. DPLOORQHVORVLQGLYLGXRVDIHFWDGRVSRUFDUGLR-
5HFLHQWHPHQWH 1NRPR \ FRODERUDGRUHV SX- SDWtDUHXPiWLFD PLOORQHVGHQLxRVHQWUH\
EOLFDURQXQHVWXGLR  (QHOTXHDQDOL]DQODLQIRU- DxRVGHHGDG ODPD\RUSDUWHGHHOORVHQSDtVHVHQ
macin recogida de la base de datos del National GHVDUUROOR  

111
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Tabla 8.1. Clasicacin de la insuciencia mitral segn el


ETIOLOGA mecanismo regurgitante

/DLGHQWLFDFLyQGHODHWLRORJtD\HOPHFDQLVPRUH- Orgnicas Funcionales


gurgitante, tiene particular relevancia para establecer Reumatica Isqumica
las pautas de seguimiento, el momento y la estrategia Mixomatosa Mioc dilatada
quirrgica.
Endocarditis Mioc hipertrca
Desde un punto de vista esquemtico y simple,
Congenita (cleft o Hipertensin
SXHGHGLYLGLUVHODHWLRORJtDGHODLQVXFLHQFLDPLWUDO
fenestracin)
HQFRQJpQLWD\DGTXLULGD\DVXYH]DHVWD~OWLPDHQ
formas reumticas y no reumticas. Marfan
+D\ XQD VHULH GH IDFWRUHV TXH KDQ PRGLFDGR HO Calcicacin anular
SHUOGHODVHQIHUPHGDGHVYDOYXODUHVDGTXLULGDV3UL- Colagenopatas (LES, AR)
mero, la marcada disminucin de cardiopata reumti-
FDHQORVSDtVHVGHVDUUROODGRVVLQTXHHVWRVLJQLTXH Sindrome carcinoide
olvidar que sigue siendo un grave problema sanitario Fibrosis endomiocardica
en pases en desarrollo. Segundo, el aumento progre-
Farmacolgica
sivo de la supervivencia de la poblacin general, con (fenuramina,
aumento de las formas degenerativas y aquellas aso- metisergida)
ciadas a enfermedad coronaria. Tercero, el creciente LES: lupus eritematoso sistmico; AR: artritis
UHFRQRFLPLHQWR\PHMRUHQWHQGLPLHQWRGHODVIRUPDV reumatoidea; Mioc: miocardiopata.
QRUHXPiWLFDVGH,0FRPROD,0LVTXpPLFDODDVR-
ciada a miocardiopata dilatada y la enfermedad de-
JHQHUDWLYDRPL[RPDWRVDGHODYiOYXODPLWUDOFRQVXV
diferentes formas de presentacin y evolucin. PRESENTACIN CLNICA

MECANISMO REGURGITANTE La gravedad de los sntomas en los pacientes con IM


est en relacin con: la severidad de la regurgitacin,
$FWXDOPHQWH VH WLHQGH D FODVLFDU D OD ,0 HQ GRV la antigedad de la lesin valvular y su tasa de pro-
grandes grupos en funcin del mecanismo que condi- gresin, el nivel de la presin arterial pulmonar, la
ciona la regurgitacin. Cuando el factor determinante aparicin de arritmias en el seguimiento y la presen-
de la IM es la afeccin primaria de la vlvula mitral cia de enfermedades coronaria, valvular, o miocrdi-
VHKDEODGH,0RUJiQLFD ,02 FX\RVHMHPSORVSD- ca asociadas.
UDGLJPiWLFRVVRQOD,0PL[RPDWRVD\ODUHXPiWLFD El curso evolutivo de esta enfermedad estar a su
En contraposicin a esta situacin, cuando las valvas YH]FRQGLFLRQDGRSRUODFDXVDHVSHFtFDGHODUHJXU-
mitrales no presentan afeccin orgnica, sino que la gitacin. As, en la IM isqumica depender de la se-
incompetencia valvular est vinculada a una altera- veridad de la enfermedad coronaria subyacente y de
cin de la geometra ventricular, ya sea global y/o ODIXQFLyQYHQWULFXODUHQODPLRFDUGLRSDWtDGLODWDGD
regional que lleva a la inadecuada coaptacin val- GHODIXQFLyQYHQWULFXODUHQOD,0UHXPiWLFDVHRE-
var, consideramos que se trata de una enfermedad VHUYDJUDQYDULDELOLGDGJHRJUiFDGHVGHHOSXQWRGH
esencialmente del msculo cardaco y se habla de YLVWDHYROXWLYR\HQODPL[RPDWRVDFRPRYHUHPRV
,0 IXQFLRQDO ,0)  /RV HMHPSORV FOiVLFRV GH HVWD PiVDGHODQWHH[LVWHKHWHURJHQHLGDGGHSUHVHQWDFLyQ
entidad son, por un lado, la IM asociada a enferme- y de curso evolutivo.
dad coronaria con trastornos de la motilidad parietal /RV SULPHURV VtQWRPDV TXH UHHUHQ DOJXQRV SD-
y desplazamiento de los msculos papilares, y por cientes son palpitaciones, relacionadas por lo general
otro lado, la que encontramos en la miocardiopata FRQDUULWPLDVVXSUDYHQWULFXODUHV EULODFLyQRDOHWHR 
dilatada, independientemente de su etiologa. Esta generadas por la sobrecarga auricular izquierda. La
diferenciacin de la IM segn el mecanismo de re- EULODFLyQDXULFXODUHVIUHFXHQWHHQHOSDFLHQWHFRQ
gurgitacin, reviste importancia ya que las variables IM, pero no incide tan dramticamente, desde el pun-
de seguimiento, sus implicancias y estrategias de in- to vista clnico, como en la estenosis mitral.
tervencin son diferentes. (QHOSURODSVRYDOYXODUPLWUDOH[LVWHXQDUHVSXHV-
/DV FDXVDV PiV IUHFXHQWHV GH ,0 FODVLFDGD ta incrementada al estmulo con catecolaminas, por
segn el mecanismo regurgitante, se resumen en la lo que las palpitaciones y el dolor torcico incaracte-
7DEOD rstico son frecuentes.


CAPTULO 8 ,QVXFLHQFLDPLWUDO

Indudablemente, el sntoma mas frecuente de la


IM es la disnea. No obstante, mientras la funcin
sistlica se encuentra conservada, la probabilidad
de que el paciente desarrolle este sntoma es escasa.
'LIHUHQWHVVLWXDFLRQHVFRPRXQDEULODFLyQDXULFXODU
SDUR[tVWLFDRWDTXLFDUGLDVLQXVDOSXHGHQSUHFLSLWDUOD
aparicin de disnea.
Los fenmenos emblicos no son tan frecuen-
WHVHQOD,0VHYHUDSRUTXHHOMHWGHUHJXUJLWDFLyQ
lava a la aurcula izquierda, lo cual evita la forma-
cin de trombos. En pacientes que tienen hiperten-
sin pulmonar asociada, se pueden observar signos
GHLQVXFLHQFLDFDUGtDFDGHUHFKDFRQGRORUUHIHULGR
al hipocondrio derecho por congestin heptica, ede- Figura 8.1. Ecocardiograma bidimensional para esternal en el
mas, ingurgitacin venosa central y regurgitacin eje largo, en el que se observan las cuerdas tendinosas y el
msculo papilar posterior.
tricuspdea. Por hiperbilirrubinemia secundaria a es-
tasis heptico puede observarse ictericia.

MTODOS DE DIAGNSTICO Y
SEGUIMIENTO

ECOCARDIOGRAFA BIDIMENSIONAL Y
DOPPLER COLOR
Es, sin ningn lugar a dudas, el principal instrumento
diagnstico y de seguimiento de los pacientes que pa-
decen esta patologa. La informacin que nos aporta
la ecocardiografa bidimensional y doppler color, se
UHHUHDODGHWHUPLQDFLyQGHODSUHVHQFLD\VHYHULGDG
GHODUHJXUJLWDFLyQFRPRVHHYLGHQFLDHQODVJXUDV
\DHVWDEOHFHUODHWLRORJtD\HOPHFDQLVPRUH-
gurgitante, a la valoracin de los dimetros y funcin
Figura 8.2. Ecocardiograma bidimensional para esternal en el
ventricular izquierda y derecha, a la estimacin de
eje corto, en el que se observan ambos msculos papilar.
la presin pulmonar y a la presencia o no de valvu-
lopatas asociadas. El anlisis integral de todas estas
variables sern consideradas en la toma de decisin,
ya que revisten importancia pronstica.
Como ya fue dicho, uno de los principales desafos
es establecer la etiologa y el mecanismo regurgitante.
Debemos diferenciar a las IM orgnicas, en las que la
afeccin primaria radica en la estructura de la vlvu-
la, de las funcionales, en las que est comprometido el
DQLOOR\RGHOPLRFDUGLRYHQWULFXODU )LJXUDVD 
En lo que respecta a precisar la gravedad de la IM,
GHVGH\DKDFHYDULRVDxRVHVWiDPSOLDPHQWHFRQVHQ-
VXDGR TXH VH GHEHQ H[WUHPDU ORV HVIXHU]RV SDUD VX-
SHUDUGHVFULSFLRQHVFXDOLWDWLYDVHLQWHQWDUGHQLUODHQ
trminos cuantitativos. En este sentido, la determina-
cin del volumen y fraccin regurgitante, y fundamen-
WDOPHQWHGHORULFLRUHJXUJLWDQWHHIHFWLYR 25( VRQ Figura 8.3. Ecocardiograma bidimensional apical en 4 cma-
ORVPpWRGRVTXHKDQJDQDGRPD\RUDFHSWDFLyQ )LJX- ras, en el que se observa engrosamiento y calcicacin de
ambas valvas (echas)
UD   5HFLHQWHPHQWH ODV 6RFLHGDGHV$PHULFDQDV \
Europeas de Cardiologa publicaron recomendaciones
FRQMXQWDV DERJDQGR SRU HO DQiOLVLV HFRFDUGLRJUiFR


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 8.7. Ecocardiograma transesofgico que muestra un jet


que se dirige lateralmente por la aurcula izquierda hasta el
abocamiento de las venas pulmonares, donde producirn un
ujo reverso como expresin de su magnitud.

Figura 8.4. Ecodoppler cardaco color en cuatro cmaras, en Siguiendo los criterios aceptados actualmente, el
que se observa una severa insuciencia mitral central que se
XMRGHDFHOHUDFLyQSUR[LPDO\ODPi[LPDYHORFLGDG
extiende a lo largo de toda la aurcula izquierda. A nivel val-
vular se objetiva el ujo de aceleracin proximal que permite SHUPLWHQFDOFXODUHO25(FRPRVHLOXVWUDHQODJX-
el calculo del ORE. UD8QYDORUHVXSHULRUDPPDSRUWDHOGDWR
de mayor severidad. No obstante en determinadas
FLUFXQVWDQFLDVODPDUFDGDH[FHQWULFLGDGSXHGHUHVXO-
WDUXQDOLPLWDFLyQHQODREMHWLYDFLyQGHODPDJQLWXG
FRPRVHREMHWLYDHQODVJXUDV\

ECO DOPPLER CON EJERCICIO


(EE) Y TEST DE EJERCICIO
CARDIOPULMONAR (TECP)

La utilidad potencial que tendra el ecocardiograma


GRSSOHUFRQHMHUFLFLRHQHVWDSDWRORJtDVHUHVWULQJHD
la evaluacin del paciente asintomtico. Consistira
en la deteccin de disfuncin ventricular izquierda
Figura 8.5. Ejemplo del clculo del oricio regurgitante efecti-
vo (ORE). Los elementos son el ujo de aceleracin proximal
ODWHQWH GHWHUPLQDQGRODUHVHUYDFRQWUiFWLO \ODREMH-
y la mxima velocidad. tivacin de la clase funcional real del paciente. Lee y
colaboradores sugieren que una falta de incremento
FRQHOHMHUFLFLRGHODIUDFFLyQGHH\HFFLyQGHOYHQ-
WUtFXORL]TXLHUGRPD\RURLJXDODUHVSHFWRGHOD
basal, sera un indicador de ausencia de reserva con-
WUiFWLO\SRGUtDD\XGDUDGHQLUHOPRPHQWRTXLU~UJL-
FRHQSDFLHQWHVDVLQWRPiWLFRV  (VWDFRQGXFWDQR
tiene consenso generalizado dentro de la comunidad
PpGLFD\DOJRVLPLODURFXUUHFRQHO7(&3  

HISTORIA NATURAL
Como ya se mencion, si bien la IM tiende a ser una
enfermedad progresiva, la naturaleza del patrn evo-
OXWLYRHVWitQWLPDPHQWHOLJDGDDODFDXVDHVSHFtFD
Figura 8.6. Severa insuciencia mitral excntrica cuya respon- que lleva a la incompetencia valvular.
sable es la valva mayor mitral. Analizaremos los aspectos pronsticos de las for-
PDVPiVSUHYDOHQWHVGH,0/DGHJHQHUDWLYDRPL[R-
FXDQWLWDWLYRGHODVYDOYXORSDWtDVUHJXUJLWDQWHV  6H matosa, como paradigma de la IM orgnica, y aque-
consideran criterios de severidad en la IM no isqumi- lla asociada a cardiopata isqumica o secundaria a
FDODSUHVHQFLDGHXQ25( PP\XQYROXPHQ distorsin de la geometra ventricular y/o deterioro
UHJXUJLWDQWH POODWLGRPLHQWUDVTXHHOSXQWRGH de la funcin sistlica ventricular izquierda, ambas
FRUWHSDUDOD,0IXQFLRQDOHVGHXQ25( PP\ HMHPSORVGH,0IXQFLRQDO
XQYROXPHQUHJXUJLWDQWH DPOODWLGR


CAPTULO 8 ,QVXFLHQFLDPLWUDO

PROLAPSO DE VLVULA MITRAL (PVM) Tabla 8.2. Diferencias entre la Enfermedad de Barlow y el
Dcit Fifroelstico
Se entiende por PVM al desplazamiento de una o
ambas valvas mitrales, frecuentemente engrosadas Enfermedad Dcit
y redundantes, hacia la aurcula izquierda durante la Barlow Fibroelstico
sstole y ha sido asociado a un variado abanico de Patologa Inltracin Dcit de
SRVLEOHVFRPSOLFDFLRQHV   mixoide produccin de
Las primeras descripciones del sndrome caracte- tejido conectivo
UL]DGRSRUFOLFNVPHVRVLVWyOLFRV\VRSORVWHOHVLVWyOL- Edad <50 aos > 60 aos
cos, hoy conocido como sndrome de Barlow, datan Enf Mitral Varios aos Meses
GHQHVGHO)XHUHFLpQDSULQFLSLRVGHODGpFD- conocida
GDGHHQTXH%DUORZ\FRODERUDGRUHVDVRFLD- Ecocardiografa Valvas gruesas, Valvas nas,
ron estos hallazgos semiolgicos con la presencia de redundantes, ruptura de
LQVXFLHQFLDPLWUDOGHPRVWUDGDSRUYHQWULFXORJUDItD prolapsantes, cuerda, prolapso
%DUORZ\3RFRFNLQWURGXMHURQHOWpUPLQRbillowing mltiples festones del festn
PLWUDOOHDHWVtQGURPHpara describir los hallazgos afectado, festn
nico
HFRFDUGLRJUiFRVGHSURODSVRYDOYDU\HVDSDUWLUGH
 FXDQGR FRPLHQ]DQ D DSDUHFHU HQ OD OLWHUDWXUD Lesiones Exceso tisular, Valvas nas,
quirrgicas valvas gruesas, prolapso de un
mdica referencias al sndrome de Barlow. Carpen-
cuerdas gruesas o nico festn,
tier y colaboradores describieron las lesiones quirr- nas, elongacin, ruptura cordal
gicas halladas, y fueron los primeros en diferenciar- calcicacin o
las de otra categora de prolapso de vlvula mitral, en fusin cordal,
la que no se encontraba ELOORZLQJRH[FHVRWLVXODU calcicacin
Utilizaron el trmino GpFLW EURHOiVWLFR para des- de msculos
papilares,
cribir a este tipo de proceso degenerativo que, gene-
dilatacin y
UDOPHQWH VH DVRFLDED D YDOYDV QDV UXSWXUD FRUGDO calcicacin de
FRQFRPSURPLVRPiVIUHFXHQWHDQLYHOGHOIHVWyQ3 anillo mitral
Anyanwu y colaboradores resaltan las diferencias Plstica Mitral Ms compleja Menos compleja
ms sobresalientes entre ambas entidades, las cuales
VHUHVXPHQHQOD7DEOD  
Lo referido previamente, nos da la pauta que nos sndrome de Marfan, sndrome de Ehlers-Danlos, os-
encontramos, en realidad, frente a un espectro de WHRJpQHVLVLPSHUIHFWD\SVHXGR[DQWRPDHOiVWLFR  
HQIHUPHGDGGHJHQHUDWLYDGHODYiOYXODPLWUDO con La diferente tasa de complicaciones reportada en
FDPELRV PRUIROyJLFRV GLVWLQWLYRV D QLYHO GHO WHMLGR la literatura est en relacin, fundamentalmente, con
conectivo. La distincin entre estas diferentes formas HODQiOLVLVGHSREODFLRQHVGLIHUHQWHV  /DEDMD
de proceso degenerativo reviste importancia, ya que tasa de complicaciones reportada por Freed y cola-
implica formas evolutivas particulares, y estrategias ERUDGRUHVHQHO)UDPLQJKDP+HDUW6WXG\  HVWX-
de seguimiento e intervencin diferentes. dio basado en la seleccin aleatoria de individuos de
La ecocardiografa ha sido, desde principios de la ODSREODFLyQJHQHUDOFRQWUDVWDFRQORVKDOOD]JRVGH
GpFDGDGHHOPpWRGRGLDJQyVWLFRXWLOL]DGRSDUD Avierinos y colaboradores reportados en un estudio
GHQLUHVWDSDWRORJtD/RVDYDQFHVWHFQROyJLFRV\ORV FRPXQLWDULR  
criterios diagnsticos han ido cambiando con el correr Independientemente de estos resultados discre-
GHORVDxRVORFXDOGHULYyHQUHVXOWDGRVGLVFUHSDQWHV SDQWHV DXQTXH QR OR VRQ WDQWR VL FRQVLGHUDPRV ODV
UHVSHFWRGHODSUHYDOHQFLDUHSRUWDGD  $SDUWLUGHO salvedades mencionadas respecto de las poblaciones
reconocimiento, y el anlisis detallado de la estructura analizadas, es conceptualmente importante abordar
tridimensional de la vlvula mitral, se han establecidos al PVM con dos premisas. Primero, es una patologa
ORV FULWHULRV GLDJQyVWLFRV HFRFDUGLRJUiFRV TXH VRQ heterognea en su forma de presentacin y evolu-
utilizados en la actualidad. Se considera prolapso de FLyQ 3UREDEOHPHQWH JUDQ SDUWH GH HVWD H[SOLFDFLyQ
YiOYXODPLWUDOFXDQGRpVWHHVPD\RURLJXDODPPSRU resida en las modalidades diferentes de afeccin
HQFLPDGHODQLOORPLWUDOHQHOHMHODUJRSDUDHVWHUQDO  GHO WHMLGR FRQHFWLYR TXH PHQFLRQDPRV SUHYLDPHQWH
 (QEDVHDpVWRVVHKDHVWLPDGRODSUHYDOHQFLD 7DEOD   6HJXQGR HV LPSRUWDQWH  UHFRQRFHU HO
GHO390HQWUH\   carcter evolutivo de la afeccin valvular. Avierinos
Tambin se ha reportado el PVM en asociacin y colaboradores recientemente documentaron la na-
D P~OWLSOHV DIHFFLRQHV GHO WHMLGR FRQHFWLYR FRPR HO WXUDOH]DHYROXWLYDGHO390HVWDQGRSDUWLFXODUPHQWH


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

propensos a desarrollar formas severas de enferme- FLHQFLDFDUGtDFDREULODFLyQDXULFXODUQXHYD HQHO


dad aquellos pacientes con mayor grado de regurgita- VHJXLPLHQWRDFLQFRDxRV   (VWRV KDOOD]JRVKDQ
cin valvular al momento del diagnstico. De hecho, contribuido instalar el debate respecto del planteo
cerca de la mitad de los pacientes con IM leve basal, de sugerir que este subgrupo de enfermos deberan
GHVDUUROODURQ IRUPDV PRGHUDGDV HQ HO VHJXLPLHQWR ser considerados para tratamiento quirrgico, an es-
mientras que ms de la mitad aquellos con IM mo- tando asintomticos y sin evidencias de disfuncin
derada basal, evolucionaron a formas severas. La ventricular. Como veremos ms adelante, generalizar
progresin de la IM se asoci a mayor remodelado esta conducta puede resultar riesgoso.
auricular y ventricular, y a peor evolucin clnica. (QODPLVPDOtQHDTXHLQWHQWDLGHQWLFDUSUHGLF-
Estos dos conceptos, heterogeneidad y evolutividad, WRUHV WHPSUDQRV GH HYROXFLyQ HQ ORV ~OWLPRV DxRV
son cruciales y deben ser siempre tenidos en cuenta y reconociendo su relacin con la condicin hemo-
para pautar el seguimiento de estos enfermos. dinmica y de stress parietal, ha surgido inters en
la incorporacin de los pptidos natriurticos en la
PREDICTORES DE EVOLUCIN HVWUDWLFDFLyQ GH HVWRV SDFLHQWHV 3L]DUUR \ FRO GH-
PRVWUDURQHQXQDERUGDMHLQWHJUDOTXHODGHWHUPLQD-
Aceptando que es una enfermedad que cuando al- FLyQGHSpSWLGRQDWULXUpWLFRWLSR% %13 WLHQHYDORU
canza grados severos de compromiso valvular, es pronstico independiente, y adicional a las variables
HVHQFLDOPHQWHGHUHVROXFLyQTXLU~UJLFDVLJXHVLHQGR HFRFDUGLRJUiFDV8QYDORUGH%13 SJPOSHU-
motivo de debate el momento ptimo para indicar la PLWLUtDLGHQWLFDUXQVXEJUXSRGHSDFLHQWHVFRQ,0
ciruga. Esto es particularmente cierto si considera- severa, asintomticos con FSVI conservada, con ma-
PRVTXHHOREMHWLYRHQHOPDQHMRGHHVWRVHQIHUPRV \RUULHVJR  
no es slo el alivio sintomtico, sino tambin asegu- No debemos olvidar que a la hora de analizar la
UDUOHV XQD HYROXFLyQ DOHMDGD ySWLPD HQ WpUPLQRV GH evolucin de los pacientes con IM severa, que re-
morbimortalidad. quieran ser intervenidos quirrgicamente, es funda-
(OGHVDUUROORSUHRSHUDWRULRGHVtQWRPDV   mental considerar el tipo de ciruga a llevar a cabo,
GH GLVIXQFLyQ YHQWULFXODU L]TXLHUGD H[SUHVDGD SRU ya que sta en s misma tiene impacto pronstico.
cada de la fraccin de eyeccin del ventrculo iz- Cuando comparamos los resultados de las dos tc-
TXLHUGRSRUGHEDMRGH  yDXPHQWRGHORV nicas quirrgicas empleadas en este tipo de patolo-
dimetros ventriculares, fundamentalmente el di- JtD UHVXOWDQ HYLGHQWHV ORV EHQHFLRV GH OD SOiVWLFD
metro sistlico del ventrculo izquierdo por encima HQ UHODFLyQ DO UHHPSOD]R YDOYXODU   (VWRV
GHPP  ODLQVWDODFLyQGHEULODFLyQDXULFXODU EHQHFLRV VH H[SUHVDQ HQ XQD PHQRU PRUWDOLGDG
 yHOGHVDUUROORGHKLSHUWHQVLyQSXOPRQDUSUR- RSHUDWRULD    SDUD OD SOiVWLFD YHUVXV  ! 
JUHVLYD  KDQVLGRLGHQWLFDGRVFRPRSUHGLFWRUHV SDUDHOUHHPSOD]RYDOYXODU HQXQDPHMRUSUHVHUYD-
de evolucin desfavorable luego de la ciruga. Los cin de la geometra y funcin ventricular al con-
pacientes sometidos a ciruga, en ausencia de estos servar el aparato subvalvular, en una menor tasa de
KDOOD]JRVSUHVHQWDEDQPHMRUHYROXFLyQDOHMDGD eventos tromboemblicos y sangrado, y menor in-
El sentido comn tambin nos dice que las for- cidencia de endocarditis. En base a esto, la plstica
mas ms graves de enfermedad tienen peor pronsti- mitral ha ganado amplia aceptacin en el mbito de
FRSHUPLWLpQGRQRVVXJHULUTXHODVHYHULGDGGHOD,0 la ciruga cardiovascular. A medida que se acumul
sera tambin un predictor de evolucin. En conso- H[SHULHQFLD FRQ OD WpFQLFD RSHUDWRULD VH KD YHQLGR
QDQFLDFRQHVWHFRQFHSWR\DHQ3L]DUUR\FROD- reportando una disminucin sostenida en la morta-
boradores demostraron una asociacin independiente lidad operatoria, un incremento en la factibilidad de
entre el ORE y su capacidad de prediccin de desa- OOHYDUOD D FDER HQ IRUPD H[LWRVD \ XQD PHQRU WDVD
rrollo de disfuncin ventricular izquierda y mala to- GH UHRSHUDFLyQ   'H KHFKR KD GHPRVWUDGR
OHUDQFLDDOHMHUFLFLRHQHOVHJXLPLHQWR  (OPLVPR ser un procedimiento durable en el tiempo cuando
grupo report las implicancias pronsticas del grado HVOOHYDGRDFDERSRUHTXLSRVTXLU~UJLFRVFRQH[SH-
GHODOHVLyQYDOYXODU\WDPDxRYHQWULFXODUL]TXLHUGR ULHQFLD\DSOLFDQGRODWpFQLFDTXLU~UJLFDDGHFXDGD
HQHVWDSREODFLyQ  0iVUHFLHQWHPHQWH(QULTXH] WDQWRHQODHQIHUPHGDGGH%DUORZFRPRHQHOGpFLW
Sarano y colaboradores reportaron que los pacientes EURHOiVWLFR )ODPHQJ \ FRODERUDGRUHV UHSRUWDURQ
FRQ,0RUJiQLFDDVLQWRPiWLFD\XQ25( PP HQEDVHDXQVHJXLPLHQWRHFRFDUGLRJUiFRVHULDGR
presentaban un incremento de la mortalidad global, XQDWDVDGHUHFXUUHQFLDDQXDOHQWUH\GH
de la mortalidad cardaca y de la tasa de eventos car- ,0PRGHUDGDFRQXQDVREUHYLGDDDxRVGH
GtDFRV PXHUWHGHFDXVDFDUGtDFDGHVDUUROORGHLQVX- \XQDOLEHUWDGGHUHRSHUDFLyQGH  


CAPTULO 8 ,QVXFLHQFLDPLWUDO

TRATAMIENTO QUIRURGICO otros del resto de planeta, la etiologa reumtica si-


gue ocupando un lugar preponderante como causa de
(OUHFRQRFLPLHQWRGHODPHMRUHYROXFLyQREVHUYDGD IM que requiere tratamiento quirrgico. En sta, la
en los pacientes operados en ausencia de los hallaz- factibilidad de plstica es claramente menor que en
JRVSUHRSHUDWRULRVGHPDOSURQyVWLFRPHQFLRQDGRV la etiologa degenerativa, con resultados subptimos
VXPDGRDODPHMRUtDHQORVUHVXOWDGRVTXLU~UJLFRV\OD y alta tasa de necesidad de reintervencin.
utilizacin cada vez ms frecuente de la plstica mi- Las ltimas recomendaciones para ciruga de
WUDOFRPRHVWUDWHJLDTXLU~UJLFD  KDOOHYDGRDTXH vlvula mitral en la IM no isqumica han sido re-
algunos grupos propongan el tratamiento quirrgico portadas recientemente por la Sociedad Europea de
de esta enfermedad, an estando el paciente asinto- &DUGLRORJtD\VHUHVXPHQHQOD7DEOD 
mtico y con funcin sistlica conservada. La clave En relacin a estas recomendaciones, vale la pena
para sostener esta conducta, sin duda se encuentra realizar un par de comentarios. An grupos quirrgi-
en que se trata de centros quirrgicos de derivacin, cos de referencia en sta patologa, como el del Dr
FRQ XQD JUDQ H[SHULHQFLD \ YROXPHQ RSHUDWRULR David Adams en The Mount Sinai Medical Center
y que son capaces de asegurar una factibilidad de
SOiVWLFDVXSHULRUDODFRQXQDPRUWDOLGDG
Tabla 8.3. Indicaciones quirrgicas de la insuciencia mitral
RSHUDWRULDPHQRUD\XQDEDMtVLPDQHFHVLGDGGH severa no isqumica
UHRSHUDFLyQHQHOVHJXLPLHQWR  /D
contrapartida de esta postura radica en que cuando Clase I
consideramos los resultados que surgen del anlisis
de un escenario ms acorde al mundo real, como 1. La plstica mitral es la tcnica quirrgica
recomendada siempre que se espere que sea
SXHGHQ VHU ORV UHJLVWURV (XUR +HDUW 6XUYH\   y durable (N Evid: C)
Base de Datos de la Sociedad Americana de Ciru- 2. La ciruga est indicada en el paciente sintomtico
JtD 7RUiFLFD ZZZVWVRUJ  QRV HQFRQWUDPRV FRQ con IM severa con FEVI > 30% y/o DSVI < 55 mm)
una serie de datos que no pueden ser minimizados (N Evid: B)
D OD KRUD GH GHQLU \ SURSRQHU HVWUDWHJLDV GH LQWHU- 3. La ciruga est indicada en el pacientes
YHQFLyQVLHPSUHWHQLHQGRSUHVHQWHTXHHVWDPRVFRQ- asintomticos con IM severa con FEVI d 60% y/o
siderando indicar ciruga a pacientes asintomticos DSVI t 45 mm). (N Evid: C)
con funcin sistlica conservada. En los registros se Clase IIa
UHSRUWDXQDPRUWDOLGDGKRVSLWDODULDGH\XQDXWL-
OL]DFLyQGHSOiVWLFDHQVyORHOGHORVFDVRV'H 1. La ciruga debe ser considerada en el paciente
asintomtico con FSVI conservada y FA de reciente
HVWDPDQHUDHVWDUtDPRVH[SRQLHQGRDOSDFLHQWHDVLQ- instalacin o PSAP en reposo > 50 mmHg. (N
tomtico y con buena funcin sistlica de VI, no solo Evid: C)
a una considerable mortalidad operatoria, sino tam- 2. La ciruga debe ser considerada en el paciente
bin a la morbilidad que acarrea una prtesis, muchas asintomtico con FSVI conservada, alta expectativa
YHFHVPHFiQLFD  3RURWURODGRQRGHEHPRV de plstica exitosa y durable, bajo riesgo
olvidar los efectos negativos que tiene el reemplazo quirrgico, vlvula ail y DSVI t 40 mm.
valvular mitral sobre la funcin ventricular, cuando 3. La ciruga debe ser considerada en pacientes con
FSVI con severo deterioro (FEVI < 30% y/o DSVI
se la compara con la plstica.
> 55 mm) refractarios al tratamiento mdico, con
6LELHQORVFHQWURVTXLU~UJLFRVFRQDOWDH[SHULHQ- alta factibilidad de plstica exitosa y durable y
FLDWLHQHQH[FHOHQWHVUHVXOWDGRVLQGHSHQGLHQWHPHQ- baja comorbilidad. (N Evid: C).
WH GHO WLSR GH FRPSURPLVR YDOYXODU   
Clase IIb
 HVUHFRQRFLGDODPD\RUIDFWLELOLGDGGH
plstica cuando la afectada es la valva posterior. La 1. La ciruga puede ser considerada en pacientes
UHSDUDFLyQYDOYXODUHVPHQRVIDFWLEOHFXDQGRH[LVWH con FSVI con severo deterioro (FEVI < 30% y/o
compromiso de la valva anterior, cuando ste es bi- DSVI > 55 mm) refractarios al tratamiento mdico,
con baja factibilidad de plstica exitosa y baja
valvar, cuando se observa profunda deformacin
comorbilidad. (N Evid: C).
valvular como en la enfermedad de Barlow. Por otro
2. La ciruga puede ser considerada en el paciente
lado estos centros reportan resultados quirrgicos en asintomtico con FSVI conservada, alta
XQDSREODFLyQFRQDIHFFLyQPL[RPDWRVDGHODYiO- factibilidad de plstica exitosa y durable, bajo
vula mitral, ya que la etiologa reumtica ha decli- riesgo quirrgico y, dilatacin auricular izquierda
nado dramticamente en estos pases. Es prudente (t60ml/m2 SC) y ritmo sinusal PSAP con el
tener presente que en nuestro pas, como en muchos ejercicio t 60 mmHg. (N Evid: C)

117
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

HQ 1XHYD<RUN  HQIDWL]DQ TXH HQ HO  HVFHQDULR GHO SDUDGHQLUHVWiQGDUHVGHFDOLGDGSDUDODUHDOL]DFLyQ


SDFLHQWHDVLQWRPiWLFRFRQ)69,FRQVHUYDGDVLH[LV- de plstica mitral. Entre ellos se destacan: el entrena-
WHQGXGDVUHVSHFWRGHODUHSDUDELOLGDGH[LWRVDGHOD miento quirrgico adecuado, el volumen quirrgico
YiOYXODPLWUDOODFLUXJtDQRVyORQRHVEHQHFLRVD GHOFLUXMDQR!FDVRVDxR\GHOFHQWURTXLU~UJLFR
sino que puede resultar potencialmente riesgosa y !FDVRVDxR ODDXGLWRULDGHUHVXOWDGRV PRUWD-
GHOHWpUHD  $OLJXDOTXHHQODV~OWLPDVUHFRPHQ- OLGDG TXLU~UJLFD   UHRSHUDFLyQ D  DxRV  
GDFLRQHVHPLWLGDVSRUHO$&&$+$HQ  VH UHSRUWHGHWDVDGH,0UHVLGXDO\UHFXUUHQWH FULWHULRV
LQFRUSRUD HO FRQFHSWR GH FHQWURV FRQ H[SHULHQFLD rigurosos y uniformes respecto del diagnstico por
en esta tcnica quirrgica. Se estimula la derivacin imgenes, ecocardiografa y variables cardiolgicas
a los mismos de los pacientes que requieran este tipo FRQVLGHUDGDV   $Vt HO FDUGLyORJR FOtQLFR GHEH
de ciruga, sobre todo a aquellos en los que se con- MXJDU XQ URO PX\ LPSRUWDQWH HQ HO PDQHMR GH HVWRV
sidera la opcin quirrgica, estando asintomticos y SDFLHQWHVGHEHGHQLUODVHYHULGDG\HOPHFDQLVPR
FRQ)69,FRQVHUYDGDFRQEULODFLyQDXULFXODU )$  tQWLPR GH OD HQIHUPHGDG GHEH GHWHUPLQDU HO PHMRU
de reciente instalacin o hipertensin pulmonar. Ro- momento para indicar la ciruga y debe elegir el equi-
VHQKHN \ FRODERUDGRUHV SXEOLFDURQ VX H[SHULHQFLD SRTXLU~UJLFRHQEDVHDODH[SHULHQFLDGHOPLVPRHQ
HQ HO PDQHMR GH SDFLHQWHV FRQ ,0 VHYHUD GHJHQH- WpFQLFDVGHUHSDUDFLyQYDOYXODU  
UDWLYD DVLQWRPiWLFRV \ FRQ EXHQD IXQFLyQ VLVWyOLFD
utilizando una estrategia de estrecho control clnico TRATAMIENTO MDICO
\ HFRFDUGLRJUiFR watchfull waiting  HQ EDVH D
los criterios de ciruga sugeridos por la AHA/ACC. Recientemente ha sido reportada cierta evidencia res-
La libertad en el desarrollo de alguna indicacin de SHFWRGHOHIHFWREHQHFLRVRGHOWUDWDPLHQWRFRQEHWD
FLUXJtD D  DxRV IXH GH FDVL HO  QR VH REVHUYy bloqueantes en los pacientes con IM orgnica mode-
mortalidad operatoria y presentaron buena evolucin rada a severa y funcin sistlica del VI conservada.
DOHMDGDHQ WpUPLQRV GH VREUHYLYD FODVH IXQFLRQDO\ (VWRV KDQ VLGR WUDEDMRV REVHUYDFLRQDOHV y HVWXGLRV
GH IXQFLyQ YHQWULFXODU SRVW RSHUDWRULD   /DV GL- piloto y probablemente debamos aguardar hasta que
ferencias desde el punto de visto evolutivo, con una VHOOHYHDFDERXQHVWXGLRUDQGRPL]DGRGLVHxDGRDWDO
alta tasa de eventos observada en la serie de la Cl- QSDUDJHQHUDOL]DUVXLQGLFDFLyQ  0LHQWUDV
QLFD0D\R  SUREDEOHPHQWHHVWpUHODFLRQDGDFRQ tanto, el uso de beta bloqueantes ha sido de utilidad
ODV FDUDFWHUtVWLFDV GH ODV SREODFLRQHV FRQVLGHUDGDV para la reduccin de sntomas como palpitaciones y
no enteramente iguales por cierto, an siendo ambas dolor torcico incaracterstico.
GH SDFLHQWHV FRQ ,0 PL[RPDWRVD DVLQWRPiWLFRV \ Respecto de la utilizacin de vasodilatadores con
con buena fraccin de eyeccin. Los pacientes re- HOREMHWLYRGHGLVPLQXLUODVHYHULGDGGHOD,0FUyQLFD
portados por Enriquez Sarano y colaboradores, eran y eventualmente impactar en las dimensiones ven-
PiVDxRVRVSUREDEOHPHQWHFRQXQDPD\RUSUHYDOHQ- WULFXODUHV\VWDWXVIXQFLRQDOORVUHVXOWDGRVKDQVLGR
FLDGHGpFLWEURHOiVWLFRGHVGHHOSXQWRYLVWDHWLR- en general desalentadores. Harris y colaboradores no
OyJLFR \ FRQ PD\RU SUHYDOHQFLD GH YiOYXODV DLO encontraron un efecto positivo luego del tratamiento
(OJUXSRGHSDFLHQWHVGH5RVHQKHNHQFDPELRHUDQ FRQUDPLSULOGXUDQWHPHVHV  +DOOD]JRVVLPLOD-
PiVMyYHQHVSUREDEOHPHQWHFRQPD\RUSUHYDOHQFLD res han sido reportados por otros autores, y de hecho
GH HQIHUPHGDG GH %DUORZ \ YiOYXODV DLO PHQRV no se sugiere su uso para la prevencin de disfuncin
SUHYDOHQWHV 1R H[LVWHQ UHSRUWHV TXH FRQVLGHUHQ OH- ventricular izquierda en pacientes con IM moderada
VLRQHV HVSHFtFDV \ SUREDEOHV HWLRORJtDV HQ OR TXH a severa y FSVI conservada. Por supuesto estarn in-
UHVSHFWDDODKLVWRULDQDWXUDOGHODHQIHUPHGDGSHUR GLFDGRVSDUDHOWUDWDPLHQWRGHODLQVXFLHQFLDFDUGtD-
los resultados dismiles de los dos estudios mencio- FDWHQJDRQR,0HOSDFLHQWH  
nados, resaltan la heterogeniedad de esta patologa y
la importancia de tomar decisiones en trminos del INSUFICIENCIA MITRAL
paciente individual. ISQUMICA
$ OD KRUD GH GHQLU FHQWURV FRQ H[SHULHQFLD
necesariamente debemos considerar resultados. As En este apartado nos referiremos esencialmente a la
vemos, que los centros con mayor volumen quirrgi- IM crnica que se desarrolla con posterioridad a un
co son los que mayor tasa de plstica mitral reportan, LQIDUWR DJXGR GH PLRFDUGLR ,$0  6H WUDWD EiVLFD-
\DVXYH]PHMRUHVUHVXOWDGRVWLHQHQHQWpUPLQRVGH mente de una de las formas de IM funcional, ya que
PRUWDOLGDG\SURFHGLPLHQWRH[LWRVR  (QODPLV- es secundaria a alteraciones en la geometra y fun-
ma lnea Bridgewater sugiere una serie de criterios FLyQYHQWULFXODUL]TXLHUGD\QRDXQGDxRSULPDULR


CAPTULO 8 ,QVXFLHQFLDPLWUDO

GH OD YiOYXOD PLWUDO (O HMHPSOR SDUDGLJPiWLFR GH YRHYHQWRLVTXpPLFR \ODSRVLELOLGDGGHSRQHUODGH
sta ltima, es la ruptura de un msculo papilar que PDQLHVWR \ FXDQWLFDUOD SRU HFRFDUGLRJUDItD GX-
SRUGHQLFLyQHVXQD,0RUJiQLFD\XQDXUJHQFLDTXL- UDQWHHOHMHUFLFLR$OJXQRVDXWRUHVKDQVXJHULGRHVWH
rrgica. PpWRGRSDUDLGHQWLFDUVXEJUXSRVSREODFLRQDOHVFRQ
Como se mencion previamente, el mecanismo mayor morbimortalidad, tanto en el corto como en el
de la IM isqumica asienta en una distorsin de la ODUJRSOD]R  
geometra ventricular, fundamentalmente local, con De lo referido previamente, se desprenden una
desplazamiento apical y posterior de uno o ambos serie de conceptos relevantes:
msculos papilares, fenmeno considerado critico en  La IM, posterior a un IAM, es una entidad fre-
HOLQLFLRGHOD,0LVTXpPLFD   cuente.
Esta entidad fue inicialmente atribuida a la dis-  Resulta de la distorsin en la geometra ventricu-
funcin del msculo papilar. Hoy sabemos que lar, fundamentalmente del desplazamiento apical
adems es necesario el compromiso funcional del y posterior de uno o ambos msculos papilares.
miocardio, subyacente al msculo papilar, para lle-  Su diagnstico muchas veces es elusivo por lo
var a la incompetencia valvular. El desplazamiento WDQWRGHEHPRVHVSHFtFDPHQWHSHQVDUHQHOOD
GH ORV P~VFXORV SDSLODUHV WUDH DSDUHMDGR XQ LQFUH-  Tiene naturaleza dinmica.
mento de las fuerzas de traccin sobre las valvas, y la  Tiene implicancias pronsticas.
consecuente prdida en la distribucin homognea de Por lo tanto, debemos plantearnos cuales son las
fuerzas sobre ellas. Esta situacin lleva a un aumento alternativas terapeticas con las que contamos en la
de la distancia entre el pice del msculo papilar y actualidad para enfrentar a esta patologa. Con un
el plano valvular mitral, con disminucin del tiempo pensamiento lineal y simplista, podramos decir que
\GHODVXSHUFLHGHFRDSWDFLyQHQWUHDPEDVYDOYDV si la IM es deletrea desde el punto de vista prons-
mitrales. El rea comprendida entre las valvas y el tico, eliminarla seguramente redundar en algn be-
plano anular mitral se conoce como el rea de ten- QHFLR&XDQGRFRQVLGHUDPRVODVRSFLRQHVSRVLEOHV
ting y es el principal determinante del ORE, y por sabemos de la utilidad del tratamiento mdico, con
ende de la severidad de la IM. A su vez, el princi- beta bloqueantes y vasodilatadores en los pacientes
pal condicionante del rea de tenting es el grado con enfermedad coronaria y disfuncin ventricular.
de desplazamiento de los msculos papilares. Este No deben escatimarse esfuerzos por optimizarlo.
GHVSOD]DPLHQWRH[SUHVLyQGHODGLVWRUVLyQORFDOGHOD Resta evaluar las opciones de tratamiento quirr-
JHRPHWUtDYHQWULFXODUWLHQHPHMRUFRUUHODFLyQFRQHO JLFRGLVSRQLEOHV\GHQLUDTXHSDFLHQWHVVHOHVRIUH-
iUHDGHWHQWLQJTXHYDULDEOHVTXHH[SUHVDQGLVWRU- cer. En primer lugar, las recomendaciones actuales
sin global de la geometra VI, como los dimetros del ACC/AHA consisten en indicar la intervencin
YHQWULFXODUHV   de la vlvula mitral al momento de la ciruga de re-
Si bien la prevalencia estimada de la IM isqu- vascularizacin coronaria, en aquellos pacientes con
mica es variable segn la bibliografa que conside- IM igual o mayor a moderadas, ya que la revasculari-
UHPRVH[LVWHXQDQLPLGDGHQFRQVLGHUDUODIUHFXHQWH ]DFLyQVRODGHMDUiXQQ~PHURLPSRUWDQWHGHSDFLHQWHV
Bursi y colaboradores reportaron en un estudio lleva- FRQ ,0 UHVLGXDO VLJQLFDWLYD   /DV UHFRPHQGD-
GRDFDERVREUHSDFLHQWHVSRVW,$0DORVFXDOHV FLRQHVGHOD6RFLHGDG(XURSHDGH&DUGLRORJtD (6& 
se les realiz un ecocardiograma doppler dentro de GHVHHQFXHQWUDQHQODPLVPDOtQHD &ODVH,SDUD
ORVGtDVSRVWHULRUHVDOHYHQWRFRURQDULRXQDSUH- la IM severa en pacientes con fraccin de eyeccin
YDOHQFLDJOREDOGHGHODV,0IXHURQOHYHV GHOYHQWUtFXORL]TXLHUGR!\TXHUHTXLHUDQFL-
\HOIRUPDVPRGHUDGDVDVHYHUDVGHHQIHUPHGDG ruga de revascularizacin coronaria y Clase IIa en
  DTXHOORVFRQ0,PRGHUDGD   
+DFH\DYDULRVDxRVTXHVDEHPRVTXHOD,0LV- Las dos estrategias a contemplar son, el reem-
qumica tiene implicancia pronstica. De hecho, es plazo valvular mitral y la anuloplastia mitral. No
un reconocido predictor independiente para el desa- H[LVWHQ WUDEDMRV UDQGRPL]DGRV TXH KD\DQ FRPSD-
UUROORGHLQVXFLHQFLDFDUGtDFD\PXHUWHHQORVVREUH- rado los resultados de ambas. Al analizar las series
YLYLHQWHVGHXQ,$0  &RPRVHFRPHQWySUH- quirrgicas retrospectivas que se ocuparon de esta
viamente, el punto de corte para considerar severa a patologa, podemos resaltar algunos datos. Primero,
OD,0LVTXpPLFDHVFXDQGRWLHQHXQ25(!PP la inmensa mayora de los pacientes recibieron re-
DGLIHUHQFLDGHORVPPFRQWHPSODGRVSDUDOD,0 vascularizacin miocrdica e intervencin valvular
RUJiQLFD   7DPELpQ HV UHFRQRFLGD OD QDWXUDOH]D PLWUDOHVPtQLPRHOQ~PHURGHHQIHUPRVDORVTXHVH
GLQiPLFDGHOD,0LVTXpPLFD HQDXVHQFLDGHXQQXH- les indic ciruga slo por la IM isqumica. Segun-

119
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

GRHQWpUPLQRVJHQHUDOHVQRSDUHFHKDEHUEHQHFLR individual y probablemente en el futuro, estrategias


de una tcnica versus la otra. Tercero, la anuloplas- GH DERUGDMH VXEDQXODU \R SHUFXWiQHDV GHPXHVWUHQ
WLDSDUHFHWHQHUPHMRUHVUHVXOWDGRVHQORVSDFLHQWHV ser de utilidad.
FRQMHWGHUHJXUJLWDFLyQPHQRVFRPSOHMRVFRQPH-
QRVWUDVWRUQRVGHPRWLOLGDGSDULHWDOFRQPHMRUFODVH INSUFICIENCIA MITRAL EN LA
funcional preoperatoria y menor necesidad de ciruga MIOCARDIOPATA DILATADA
GHXUJHQFLD&XDUWRORVEHQHFLRVGHODDQXORSODVWLD
parecen perderse al considerar a los pacientes con De manera similar con lo que ocurre en la IM isqu-
MHWVFRPSOHMRVFRQPD\RUHVWUDVWRUQRVGHPRWLOLGDG PLFDODLQFRPSHWHQFLDYDOYXODUPLWUDOHQODPLRFDU-
parietal y que se encuentran en peor situacin cl- diopata dilatada es funcional, y secundaria a la dis-
nica. En estos pacientes, en ocasiones es preferible torsin geomtrica del ventrculo izquierdo.
RSWDUSRUHOUHHPSOD]RYDOYXODU  5HVSHFWRGH Su documentacin en este grupo de pacientes,
la anuloplastia mitral, hemos aprendido que no slo tiene implicancias pronsticas. La presencia de IM
se dilata la porcin muscular del anillo mitral, sino PRGHUDGDDVHYHUDVHDFRPSDxDGHXQDPHQRUH[SHF-
TXHWDPELpQORKDFHODSRUFLyQEURVD  (VWRH[- WDWLYDGHYLGD  
plica, por lo menos en parte, la elevada tasa de IM El tratamiento mdico, con todo su actual arsenal
recurrente o residual cuando se utiliza la anuloplastia IDUPDFROyJLFRSHUPLWHXQPDQHMRFOtQLFRDFHSWDEOH
con pericardio o anillos incompletos como estrategia de muchos de estos pacientes.
quirrgica. Esto ha llevado a instalar el concepto de El tratamiento quirrgico, sumamente contro-
que es preferible utilizar anillos completos y reali- vertido por otro lado, debera quedar reservado para
zar una anuloplastia restrictiva. A pesar de este gesto aquellos pacientes que persisten en clase funcional
quirrgico, un nmero no despreciable de pacientes ,,,,9DSHVDUGHWUDWDPLHQWRPpGLFRySWLPRLQFOXVR
presentan recurrencia de la IM en el seguimiento, luego de haber valorado la opcin de terapia de res-
fundamentalmente aquellos con parmetros de gran incronizacin ventricular. De hecho, la anuloplastia
distorsin de la geometra ventricular preoperatoria, mitral es una recomendacin clase IIb en las ltimas
como demostr Gelsomino y colaboradores en un UHFRPHQGDFLRQHV GHO $&&$+$ GH  \ GH OD
HVWXGLR FRQ HVWUHFKR VHJXLPLHQWR HFRFDUGLRJUiFR (6&GHSDUDHVWHJUXSRGHSDFLHQWHV  
SRVWTXLU~UJLFR  $Vt TXHGD HQ HYLGHQFLD TXH HO 1RKD\WUDEDMRVUDQGRPL]DGRVTXHLGHQWLTXHQ
dilema de cmo abordar a este subgrupo de enfer- ODPHMRUHVWUDWHJLDGHWUDWDPLHQWRHQHVWHJUXSRSR-
mos an no est enteramente resuelto. Seguramente blacional.
se requiere de la consideracin de cada caso en forma


CAPTULO 8 ,QVXFLHQFLDPLWUDO

BIBLIOGRAFA
1. 1NRPR 97 *DUGLQ - 6NHOWRQ 71 HW DO %XUGHQ RI YDOYXODU KHDUW GLVHDVH D SRSXODWLRQEDVHG VWXG\ /DQFHW

 Iung B, Baron G, Butchart EG, et al. A prospective survey of patients with valvular heart disease in Europe: The Euro
+HDUW6XUYH\RQ9DOYXODU+HDUW'LVHDVH(XU+HDUW-
 1NRPR 97 (SLGHPLRORJ\ DQG SUHYHQWLRQ RI YDOYXODU KHDUW GLVHDVH DQG LQIHFWLYH HQGRFDUGLWLV LQ $IULFD +HDUW

 Zoghbi WA, Enriquez-Sarano M, Foster E, et al. Recommendations for evaluation of the severity of native valvular
UHJXUJLWDWLRQZLWKWZRGLPHQVLRQDODQG'RSSOHUHFKRFDUGLRJUDSK\-$P6RF(FKRFDUGLRJUDSK\
 /HH5+DOXVND%/HXQJ'<HWDO)XQFWLRQDODQGSURJQRVWLFLPSOLFDWLRQVRIOHIWYHQWULFXODUFRQWUDFWLOHUHVHUYHLQ
SDWLHQWVZLWKDV\PSWRPDWLFPLWUDOUHJXUJLWDWLRQ+HDUW
 0HVVLND=HLWRXQ ' -RKQVRQ %' 1NRPR9 HW DO &DUGLRSXOPRQDU\ H[HUFLVH WHVWLQJ GHWHUPLQDWLRQRI IXQFWLRQDO
FDSDFLW\LQPLWUDOUHJXUJLWDWLRQ3K\VLRORJLFDQGRXWFRPHLPSOLFDWLRQV-$P&ROO&DUGLRO
7. 'HYHUHX[ 5% .UDPHU)R[ 5 .OLJHOG 3 HW DO 0LWUDO YDOYH SURODSVH FDXVHV FOLQLFDO PDQLIHVWDWLRQV DQG
PDQDJHPHQW$QQ,QWHUQ0HG
 $Q\DQZX $& $GDPV '+ (WLRORJLF FODVVLFDWLRQ RI GHJHQHUDWLYH PLWUDO YDOYH JLVHDVH %DUORZV GLVHDVH DQG
EURHODVWLFGHFLHQF\6HPLQ7KRUDF&DUGLRYDVF6XUJ
9. /HYLQH5$:H\PDQ$(0LWUDOYDOYHSURODSVHDGLVHDVHLQVHDUFKRIRUFUHDWHGE\LWVGHQLWLRQ(FKRFDUGLRJUDSK\

 Levine RA, Triulzi MO, Harrigan P, et al. The relationship of mitral annular shape to the diagnosis of mitral valve
SURODSVH&LUFXODWLRQ
11. Levine RA, Stathogiannis E, Newell JB, et al. Reconsideration of echocardiographic standards for mitral valve
SURODSVHODFNRIDVVRFLDWLRQEHWZHHQOHDHWGLVSODFHPHQWLVRODWHGWRWKHDSLFDOIRXUFKDPEHUYLHZDQGLQGHSHQGHQW
HFKRFDUGLRJUDSKLFHYLGHQFHRIDEQRUPDOLW\-$P&ROO&DUGLRO
 )ODFN-0.YDVQLFND-+*DUGLQ-0HWDO$QWKURSRPHWULFDQGSK\VLRORJLFFRUUHODWHVRIPLWUDOYDOYHSURODSVHLQD
ELHWKQLFFRKRUWRI\RXQJDGXOWV&$5',$VWXG\$P+HDUW-
 Freed LA, Levy D, Levine RA , et al. Prevalence and clinical outcome of mitral-valve prolapse. N Engl J Med

 )UHHG /$ %HQMDPLQ (- /HY\ ' HW DO 0LWUDO YDOYH SURODSVH LQ WKH JHQHUDO SRSXODWLRQ WKH EHQLJQ QDWXUH RI
HFKRFDUGLRJUDSKLFIHDWXUHVLQWKH)UDPLQJKDP+HDUW6WXG\-$P&ROO&DUGLRO
 Avierinos JF, Gersh B, Phil ChB, et al. Natural history of asymptomatic mitral valve prolapse in the community.
&LUFXODWLRQ
 /HYLQH5$6ODXJHQKDXSW6$0ROHFXODUJHQHWLFVRIPLWUDOYDOYHSURODSVH&XUU2SLQ&DUGLRO
17. $YLHULQRV-)'HWDLQW'0HVVLND=HLWRXQ'HWDO5LVN'HWHUPLQDQWVDQGRXWFRPHLPSOLFDWLRQVRISURJUHVVLRQRI
PLWUDOUHJXUJLWDWLRQDIWHUGLDJQRVLVRIPLWUDOYDOYHSURODSVHLQDVLQJOHFRPPXQLW\$P-&DUGLRO
 /LQJ/+(QULTXH]6DUDQR06HZDUG-%HWDO&OLQLFDORXWFRPHRIPLWUDOUHJXUJLWDWLRQGXHWRDLOOHDHW1(QJ-
0HG
19. Tribouilloy CM, Enriquez-Sarano M, Schaff HV, et al. Impact of preoperative symptoms on survival after surgical
FRUUHFWLRQRIRUJDQLFPLWUDOUHJXUJLWDWLRQUDWLRQDOHIRURSWLPL]LQJVXUJLFDOLQGLFDWLRQV&LUFXODWLRQ

 (QULTXH]6DUDQR07DMLN$-6FKDII+9HWDO(FKRFDUGLRJUDSKLFSUHGLFWLRQRIVXUYLYDODIWHUVXUJLFDOFRUUHFWLRQRI
RUJDQLFPLWUDOUHJXUJLWDWLRQ&LUFXODWLRQ
 'XMDUGLQ .6 6HZDUG -% 2UV]XODN 7$ HW DO 2XWFRPH DIWHU VXUJHU\ IRU PLWUDO UHJXUJLWDWLRQ GHWHUPLQDQWV RI
SRVWRSHUDWLYHPRUELGLW\DQGPRUWDOLW\-+HDUW9DOYH'LV
 0DWVXPDUD72KWDNL(7DQDND.HWDO(FKRFDUGLRJUDSKLF3UHGLFWLRQRIOHIWYHQWULFXODUG\VIXQFWLRQDIWHUPLWUDO
valve repair for mitral regurgitation as an indicator to decide the optimal timing of repair. J Am Coll Cardiol

 *ULJLRQL)$YLHULQRV-)/LQJ/+HWDO$WULDOEULOODWLRQFRPSOLFDWLQJWKHFRXUVHRIGHJHQHUDWLYHPLWUDOUHJXUJLWDWLRQ
GHWHUPLQDQWVDQGORQJWHUPRXWFRPH-$P&ROO&DUGLRO
 (JXFKL.2KWDNL(0DWVXPDUD7HWDO3UHRSHUDWLYHDWULDOEULOODWLRQDVWKHNH\GHWHUPLQDQWRIRXWFRPHRIPLWUDO
YDOYHUHSDLUIRUGHJHQHUDWLYHPLWUDOUHJXUJLWDWLRQ(XU+HDUW-
 7DQDND.2KWDNL(0DWVXPDUD7HWDO,PSDFWRIDSUHRSHUDWLYHPLWUDOUHJXUJLWDWLRQVFRULQJV\VWHPRQRXWFRPHRI
VXUJLFDOUHSDLUIRUPLWUDOYDOYHSURODSVH$P-&DUGLRO
 Pizarro R, Oberti PF, Falconi M, et al. Prediccin de sntoma, empeoramiento de la tolerancia ergomtrica y disfuncin
YHQWULFXODUL]TXLHUGDHQSDFLHQWHVDVLQWRPiWLFRVFRQ,0FUyQLFDRUJiQLFD5HY$UJ&DUGLRO
 Krauss J, Pizarro R, Oberti P, et al. Prognostic implication of valvualr lesin and left ventricular size in asymptomatic
SDWLHQWVZLWKRUJDQLFPLWUDOUHJXUJLWDWLRQDQGQRUPDOOHIWYHQWULFXODUSHUIRUPDQFH$P+HDUW-H
 (QULTXH]6DUDQR0$YLHULQRV-)0HVVLND=HLWRXQ'HWDO4XDQWLWDWLYHGHWHUPLQDQWVRIWKHRXWFRPHRIDV\PSWRPDWLF


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

PLWUDOUHJXUJLWDWLRQ1(QJ-0HG
 Pizarro R, Bazzino O.O, Oberti PF, et al. Prospective validation of the prognostic usefulness of brain natriuretic
SHSWLGHLQDV\PSWRPDWLFSDWLHQWVZLWKFKURQLFVHYHUHPLWUDOUHJXUJLWDWLRQ-$P&ROO&DUGLRO
 (QULTXH]6DUDQR06FKDII+2U]XODN7HWDO9DOYHUHSDLULPSURYHVWKHRXWFRPHRIVXUJHU\IRUPLWUDOUHJXUJLWDWLRQ
&LUFXODWLRQ
 0RKW\'2V]XODN7$6FKDII+9HWDO9HU\ORQJWHUPVXUYLYDODQGGXUDELOLW\RIPLWUDOYDOYHUHSDLUIRUPLWUDOYDOYH
SURODSVH&LUFXODWLRQ,
 Shuhaiber J, Anderson RJ. Meta-analysis of clinical outcomes following surgical mitral valve repair or replacement.
(XU-&DUG7KRUDF6XUJ
 'HWDLQW' 6XQGW70 1NRPR97 HW DO 6XUJLFDOFRUUHFWLRQRI PLWUDO UHJXUJLWDWLRQLQ WKH HOGHUO\RXWFRPHVDQG
UHFHQWLPSURYHPHQWV&LUFXODWLRQ
 Kang DH, Kim JH, Rim JH, et al. Comparison of early surgery versus conventional treatment in asymptomatic mitral
UHJXUJLWDWLRQ&LUFXODWLRQ
 )ODPHQJ : 0HXULV % +HULMJHUV 3 HW DO 'XUDELOLW\ RI PLWUDO YDOYH UHSDLU LQ %DUORZ GLVHDVH YHUVXV EURHODVWLF
GHFLHQF\-7KRUDF&DUGLRYDVF6XUJ
 Ad N, Barnett SD, Speir AM, et al. Institutional and national trends in isolated mitral valve surgery over the past
GHFDGH&XUU2S&DUGLRO
 David T. Outcomes of mitral valve repair for mitral regurgitation due to degenerative disease. Semin Thorac
&DUGLRYDVF6XUJ
 Schaff HV, Suri RM, Enriquez-Sarano M. Indications for surgery in degenerative mitral valve disease. Semin Thorac
&DUGLRYDVF6XUJ
 Russo A, Grigioni F, Avierinos JF, et al. Thromboembolic complication after correction of mitral regurgitation.
,QFLGHQFHSUHGLFWRUVDQGFOLQLFDOLPSOLFDWLRQV-$P&ROO&DUGLRO
 2WWR&9DOYXODU+HDUW'LVHDVHQG(GLWLRQ6DXQGHUV6XUJLFDOLQWHUYHQWLRQIRUPLWUDOYDOYHUHJXUJLWDWLRQSJ

 %RQRZ 5 &DUDEHOOR %  )RFXVHG 8SGDWH ,QFRUSRUDWHG LQWR WKH $&&$+$ 3UDFWLFDO *XLGHOLQHV IRU WKH
0DQDJHPHQW RI SDWLHQWV ZLWK YDOYXODU KHDUW GLVHDVH ([HFXWLYH VXPPDU\$ 5HSRUW RI WKH$PHULFDQ  &ROOHJH RI
&DUGLRORJ\$PHULFDQ+HDUW$VVRFLDWLRQ7DVN)RUFHDQ3UDFWLFH*XLGHOLQHV-$P&ROO&DUGLROHH
 Adams DH, Anyanwu AC, Rahmanian PB, et al. Current concepts in mitral valve repair for degenerative disease.
+HDUW)DLO5HY
 *DPPLH-62%ULHQ60*ULIWK%3HWDO,QXHQFHRISURFHGXUDOYROXPHRQFDUHSURFHVVDQGPRUWDOLW\IRUSDWLHQWV
XQGHUJRLQJHOHFWLYHVXUJHU\IRUPLWUDOUHJXUJLWDWLRQ&LUFXODWLRQ
 %ULGJHZDWHU%+RRSHU70XQVFK&HWDO0LWUDOUHSDLUEHVWSUDFWLFHSURSRVHGVWDQGDUGV+HDUW
 Adams DH, Anyanwu AC. The cardiologists role in increasing the rate of mitral valve repair in degenerative disease.
&XUU2S&DUGLRO
 9DKDQLDQ$$OHUL2$QGUHRWWL)HWDO*XLGHOLQHVRQWKH0DQDJHPHQWRI9DOYXODU+HDUW'LVHDVH 9HUVLRQ 
7KH-RLQW7DVN)RUFHRQWKHPDQDJHPHQWRIYDOYXODUKHDUWGLVHDVHRIWKH(XURSHDQ6RFLHW\RI&DUGLRORJ\ (6& DQG
WKH(XURSHDQ$VVRFLDWLRQRI&DUGLR7KRUDFLF6XUJHU\ ($&76 ZZZHVFDUGLRRUJJXLGHOLQHV
 5RVHQKHN55DGHU).ODDU8HWDO2XWFRPHRIZDWFKIXOOZDLWLQJLQDV\PSWRPDWLFVHYHUHPLWUDOUHJXUJLWDWLRQ
&LUFXODWLRQ
 9DUDGDUDMDQ3-RVKL1'XYYXUL/HWDO(IIHFWRIEHWDEORFNHUWKHUDS\RQVXUYLYDOLQSDWLHQWVZLWKVHYHUHPLWUDO
UHJXUJLWDWLRQDQGQRUPDOOHIWYHQWULFXODUHMHFWLRQIUDFWLRQ$P-&DUGLRO
 6WHZDUW5$+5DIIHO2&.HUU$-HWDO3LORWVWXG\WRDVVHVVWKHLQXHQFHRIEHWDEORFNDGHRQPLWUDOUHJXUJLWDQW
YROXPHDQGOHIWYHQWULFXODUZRUNLQGHJHQHUDWLYHPLWUDOYDOYHGLVHDVH&LUFXODWLRQ
 Harris KM, Aeppli DM, Carey CF, et al. Effects of angiotensin-converting enzyme inhibition on mitral regurgitation
VHYHULW\OHIWYHQWULFXODUVL]HDQGIXQFWLRQDOFDSDFLW\$P+HDUW-HH
 &DUDEHOOR%7KHFXUUHQWWKHUDS\IRUPLWUDOUHJXUJLWDWLRQ-$P&ROO&DUGLRO
 2WVXML< +DQGVFKXPDFKHU 0' 6FKZDPPHQWDO ( HW DO ,QVLJKWV IURP WKUHHGLPHQVLRQDO HFKRFDUGLRJUDSK\ LQWR
WKHPHFKDQLVPRIIXQFWLRQDOPLWUDOUHJXUJLWDWLRQGLUHFWLQYLYRGHPRQVWUDWLRQRIDOWHUHGOHDHWWHWKHULQJJHRPHWU\
&LUFXODWLRQ
 <LX6)(QULTXH]6DUDQR07ULERXLOOR\&HWDO'HWHUPLQDQWVRIWKHGHJUHHRIIXQFWLRQDOPLWUDOUHJXUJLWDWLRQLQ
SDWLHQWVZLWKV\VWROLFG\VIXQFWLRQDTXDQWLWDWLYHFOLQLFDOVWXG\&LUFXODWLRQ
 .XPDQRKRVR7 2WVXML<<RVKLIXNX 6 HW DO 0HFKDQLVP RI KLJKHU LQFLGHQFH RI LVFKHPLF PLWUDO UHJXUJLWDWLRQ LQ
SDWLHQWVZLWKLQIHULRUP\RFDUGLDOLQIDUFWLRQTXDQWLWDWLYHDQDO\VLVRIOHIWYHQWULFXODUDQGPLWUDOYDOYHJHRPHWU\LQ
SDWLHQWVZLWKSULRUP\RFDUGLDOLQIDUFWLRQ-7KRUDF&DUGLRYDVF6XUJ
 :DWDQDEH12JDVDZDUD<<DPDXUD<HWDO*HRPHWULFGHIRUPLW\RIWKHPLWUDODQQXOXVLQSDWLHQWVZLWKLVFKHPLF
PLWUDOUHJXUJLWDWLRQDUHDOWKUHHGLPHQVLRQDOHFKRFDUGLRJUDSKLFVWXG\-+HDUW9DOYH'LV
 /HYLQH 5$ 6FKZDPPHQWKDO ( ,VFKHPLF PLWUDO UHJXUJLWDWLRQ RQ WKH WKUHVKROG RI D VROXWLRQ )URP SDUDGR[HV WR
XQLI\LQJFRQFHSWV&LUFXODWLRQ
 %XUVL)(QULTXH6DUDQR01NRPR9HWDO+HDUWIDLOXUHDQGGHDWKDIWHUP\RFDUGLDOLQIDUFWLRQLQWKHFRPPXQLW\


CAPTULO 8 ,QVXFLHQFLDPLWUDO

7KHHPHUJLQJUROHRIPLWUDOUHJXUJLWDWLRQ&LUFXODWLRQ
 /DPDV *$ 0LWFKHOO *) )ODFNHU *& HW DO )RU WKH VXUYLYDO DQG YHQWULFXODU HQODUJHPHQW LQYHVWLJDWRUV &OLQLFDO
VLJQLFDQFHRIPLWUDOUHJXUJLWDWLRQDIWHUDFXWHP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
 Grigioni F, Enriquez-Sarano M, Zehr KJ, et al. Ischemic mitral regurgitation: long-term outcome and prognostic
LPSOLFDWLRQVZLWKTXDWLWDWLYH'RSSOHUDVVHVVPHQW&LUFXODWLRQ
 Levine RA, Hung J. Ischemic mitral regurgitation, the dynamic lesion: clues to the cure. J Am Coll Cardiol

 /DQFHOORWWL37URLVIRQWDLQHV37RXVVDLQW$&HWDO3URJQRVWLFLPSRUWDQFHRIH[HUFLVHLQGXFHGFKDQJHVLQPLWUDO
UHJXUJLWDWLRQLQSDWLHQWVZLWKFKURQLFLVFKHPLFOHIWYHQWULFXODUG\VIXQFWLRQ&LUFXODWLRQ
 Lancellotti P, Gerard PL, Pierard LA, et al. Long-term aoutcome of patients with heart failure and dynamic functional
PLWUDOUHJXUJLWDWLRQ(XU+-RXUQDO
 *LOOLQRY$0:LHUXS31%ODFNVWRQH(+HWDO,VUHSDLUSUHIHUDEOHWRUHSODFHPHQWIRULVFKHPLFPLWUDOUHJXUJLWDWLRQ"
-7KRUDF&DUGLRYDVF6XUJ
 Grossi EA, Goldberg JD, La Pietra A, et al. Ischemic mitral valve reconstruction and replacement: Comparision of
ORQJWHUPVXUYLYDODQGFRPSOLFDWLRQV-7KRUDF&DUGLRYDVF6XUJ
 0LOOHU'&,VFKHPLFPLWUDOUHJXUJLWDWLRQUHGX[7RUHSDLURUWRUHSODFH-7KRUDF&DUGLRYDVF6XUJ

 *RUPDQ-+UG*RUPDQ5&-DFNVRQ%0HWDO$QQXORSODVW\ULQJVHOHFWLRQIRUFKURQLFLVFKHPLFPLWUDOUHJXUJLWDWLRQ
OHVVRQVIURPWKHRYLQHPRGHO$QQ7KRUDF6XUJ
 Gelsomino S, Lorusso R, De Cicco G, et al. Five-year echocardiographic results of combined undersized mitral
ring annuloplasty and coronary artery bypass grafting for chronic ischemic mitral regurgitation. Eur H Journal

 7ULFKRQ%+)HONHU06KDZ/.HWDO5HODWLRQRIIUHTXHQF\DQGVHYHULW\RIPLWUDOUHJXUJLWDWLRQWRVXUYLYDODPRQJ
SDWLHQWVZLWKOHIWYHQWULFXODUV\VWROLFG\VIXQFWLRQDQGKHDUWIDLOXUH$P-&DUGLRO
 .ROOHLQJ7'$DURQVRQ.'&RG\5-HWDO3URJQRVWLFVLJQLFDQFHRIPLWUDOUHJXUJLWDWLRQDQGWULFXVSLGUHJXUJLWDWLRQ
LQSDWLHQWVZLWKOHIWYHQWULFXODUV\VWROLFG\VIXQFWLRQ+HDUW


CAPITULO 9

ESTENOSIS ARTICA

AUGUSTO TORINO, MARTN PEREA

INTRODUCCIN solamente debemos abocarnos a la correcta cuanti-


FDFLyQVLQRDODREMHWLYDFLyQGHODGLVIXQFLyQYHQ-
En los pases desarrollados la etiologa de la esteno- tricular subclnica.
sis artica comprende en la inmensa mayora de los Dado que la nica teraputica efectiva para el
casos a la estenosis artica congnita secundaria, a tratamiento de la estenosis artica es el remplazo
vlvula artica bicspide y fundamentalmente, a la valvular, es importante remarcar que la decisin mas
HVFOHURGHJHQHUDWLYDFRQFDOFLFDFLyQGHOJHURQWH(Q LPSRUWDQWHHQHOPDQHMRGHHVWDSDWRORJtDFRQVLVWHHQ
QXHVWURPHGLRWRGDYtDH[LVWHQFDVRVFRPRVHFXHODGH la eleccin del momento quirrgico.
HEUH UHXPiWLFD JHQHUDOPHQWH DVRFLDGR D FRPSUR- Por lo tanto podramos dividir a la historia natural
miso de la vlvula mitral. de la estenosis artica en:
/DVRVSHFKDLQLFLDOGHODSDWRORJtDVXUJHGHOH[D-  Periodo asintomtico donde la patologa es evi-
men semiolgico, donde la auscultacin del soplo denciable por la semiologa y la Ecocardiogra-
VLVWyOLFRH\HFWLYRHQODEDVHVHFXQGDULRDOXMRWXU- fa. En este perodo lo mas importante es realizar
bulento provocado por el compromiso valvular es el un reconocimiento precoz de los sntomas y/o el
hallazgo fundamental. Dicho signo indica, de algn deterioro subclnico de la funcin ventricular.
modo, restriccin a la eyeccin ventricular. Cuando Los problemas ms importantes de esta etapa
adopta las caractersticas de un soplo con forma rom- son la muerte sbita y la posibilidad de rpida
boidal, con acm tardo, segundo ruido disminuido HYROXFLyQGHVtQWRPDV HQPHVHV TXHLPSLGDQ
de intensidad o ausente, asociado a signos de hiper- que el paciente alcance la ciruga.
WURDYHQWULFXODUL]TXLHUGD\DOWtSLFRDVFHQVROHQWR  Periodo sintomtico sin deterioro de la fun-
GHOSXOVRFDURWtGHRVHH[SUHVDODVHYHULGDGGHODHQ- cin ventricular. Corresponde, a este periodo,
fermedad. la indicacin mas clara para el remplazo valvular
Dicho hallazgo se da en dos escenarios clnicos DQGHGLVPLQXLUPRUWDOLGDG  
diferentes: el sintomtico caracterizado por ngor,  Periodo sintomtico con deterioro de la fun-
disnea y/o sncope y el asintomtico. Estas dos for- cin ventricular. Es importante en este grupo
mas de presentacin tienen diferentes implicancias HYDOXDUODHFXDFLyQULHVJREHQHFLRGHODLQWHU-
en la conducta. La decisin de intervenir un pacien- vencin en relacin al cambio de pronstico cau-
te o de realizar seguimiento mdico se basa, des- sado por el remplazo valvular.
GHORVSULPHURVWUDEDMRVGH%UDXQZDOG\5RVV  
HQ OD SUHVHQFLD GH HVWHQRVLV DyUWLFD VLJQLFDWLYD \ CONSIDERACIONES
la aparicin de sntomas, despus de los cuales la DIAGNSTICAS
tasa de mortalidad aumenta en forma marcada. El
PDQHMRGHORVSDFLHQWHVDVLQWRPiWLFRVSUHVHQWDXQ La Ecocardiografa es el mtodo complementario
verdadero desafo de la clnica cardiolgica pues no GHHOHFFLyQHQODREMHWLYDFLyQ\FXDQWLFDFLyQGHOD


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Los criterios de severidad surgen de las guas So-


ciedad Americana de Cardiologa que consideran los
siguientes puntos de corte obtenidos rutinariamente
SRUPHGLRGHODHFRFDUGLRJUDItD  
 UHDYDOYXODUPHQRUDFP
 9HORFLGDGSLFRGHOMHW!PVHJ
 *UDGLHQWHPHGLR!PP+J
El rea valvular artica actualmente constituye el
GDWR REMHWLYR GH PD\RU LPSRUWDQFLD (Q ODV ~OWLPDV
GpFDGDV HO SXQWR GH FRUWH SDUD GHQLU OD VHYHULGDG
independientemente de que este valor haya sido ob-
tenido por ecocardiografa o hemodinamia, se estable-
Figura 9.1. Modo M de la vlvula artica esclerocalcicada
con limitacin de su apertura. FLyHQFP6LELHQVHREWLHQHXQQ~PHURFRQFUHWR
con ambos mtodos, el rea valvular artica medida
por ecocardiografa representa el rea valvular efec-
WLYDFDOFXODGDSRUODHFXDFLyQGHFRQWLQXLGDG )LJXUD
 PLHQWUDVTXHHOYDORUREWHQLGRSRUKHPRGLQDPLD
a travs de la frmula de Gorlin, no se obtiene de la
misma forma, y no necesariamente debe coincidir.
Es importante destacar que el valor obtenido es
altamente dependiente del volumen minuto o dicho
GHRWUDIRUPDGHOXMRWUDQVYDOYXODUDyUWLFRHQHOSUH-
ciso momento de la medicin. En trminos generales
se podra establecer que si uno evala a un paciente
HQXQPRPHQWRHQHOTXHHOXMRDyUWLFRHVEDMR GHV-
KLGUDWDFLyQEDMRJDVWRGHWHULRURGHODIXQFLyQVLVWy-
OLFDGHYHQWUtFXORL]TXLHUGRHWF HOiUHDPHGLGDSRU
Figura 9.2. Eco bidimensional en eje longitudinal donde se
objetiva la vlvula artica calcicada asociada a calcicacin ecuacin de continuidad tiende a subestimarse. Un
parietal artica. Se efecto la medicin del tracto de salida del WUDEDMR H[SHULPHQWDO GRQGH VH XWLOL]y XQ VLPXODGRU
ventrculo izquierdo. de gasto cardaco pulstil, al que se le adosaba un ori-
FLRDyUWLFRFRQRFLGRGHDQWHPDQR\VHORVRPHWtD
D GLVWLQWDV FRQGLFLRQHV GH XMR SHUPLWLy GHPRVWUDU
la variabilidad del rea calculada con respecto a la
HFXDFLyQGHFRQWLQXLGDG8QRULFLRDQDWyPLFRFR-
QRFLGR GH  FP VRPHWLGR D XQ XMR GH  POV
corresponda a un rea medida por ecuacin de con-
WLQXLGDGGHFP\DPOVVHLQFUHPHQWDEDD
 FP OR TXH DUURMD XQD GLIHUHQFLD GH DOUHGHGRU
GHO  
Podramos concluir que el rea valvular calculada
por ecuacin de continuidad es un nmero que eng-
OREDODLQWHUDFFLyQGHORULFLRYDOYXODUDQDWyPLFROD
IXQFLyQYHQWULFXODUL]TXLHUGD\HOXMRWUDQVYDOYXODU
artico. Por lo tanto el rea anatmica no es igual
Figura 9.3. Ecodoppler pulsado que registra la velocidad del al rea efectiva. Considerando que si la fraccin de
tracto de salida del ventrculo izquierdo, que se utiliza en la
H\HFFLyQ\RHOXMRYDOYXODUDyUWLFRGLVPLQX\HQVH
frmula de la continuidad.
tender a subestimar el rea valvular artica. Esta va-
riabilidad probablemente sea uno de los motivos por
ORVFXDOHVHOSXQWRGHFRUWHGHFPGHiUHDYDOYXODU
PDJQLWXGGHODHQIHUPHGDG )LJXUDV\ TXH QR VH FRUUHODFLRQD H[DFWDPHQWH FRQ OD DSDULFLyQ GH
ha desplazado a la evaluacin cruenta hemodinmica, los sntomas.
quedando ella relegada a la evaluacin prequirrgica El segundo punto a considerar se relaciona con
para descartar la enfermedad coronaria asociada. los gradientes. En ecocardiografa los gradientes de


CAPTULO 9 Estenosis artica

DXPHQWDGRVFRPRSDUiPHWURSDUDGHQLUHOPRPHQWR
quirrgico.
Otto estableci el riesgo de desarrollar sntomas
en pacientes previamente asintomticos en funcin
GHODYHORFLGDGGHOMHWHQWUHPVPVRPD\RU
DPVSUHVHQWDQGRXQDSUREDELOLGDGGH\
UHVSHFWLYDPHQWH  
3HOOLNDHQXQWUDEDMRGHVHJXLPLHQWRGHSDFLHQ-
tes asintomticos, observ una peor evolucin en los
SDFLHQWHV FRQ YHORFLGDGHV Pi[LPDV PD\RUHV D 
m/s con un riesgo relativo de eventos cardacos de
 PXHUWH UHTXHULPLHQWR GH FLUXJtD R GHVDUUROOR
GHVtQWRPDV  
Figura 9.4. Ecodoppler continuo que evidencia el acm meso
sistlico y el registro de los gradientes pico y medio (117 mm Monin desarroll un score para predecir muerte o
Hg y 77 mm Hg respectivamente) el requerimiento de ciruga donde los tres predictores
PD\RUHVIXHURQHOVH[RIHPHQLQRYHORFLGDGDyUWLFD
Pi[LPD\HOQLYHOGH%13  
SUHVLyQ VH H[WUDSRODQ SRU OD HFXDFLyQ GH %HUQRXOOL 5RVHQKHNHVWDEOHFLyTXHORVSDFLHQWHVDVLQWRPi-
VLPSOLFDGD GH ODV YHORFLGDGHV $VLPLVPR HO JUD- WLFRVFRQYHORFLGDGHVPi[LPDVPD\RUHVDPVWLH-
GLHQWHPHGLRVHH[WUDSRODPHGLDQWHODVLJXLHQWHIyU- nen la posibilidad de desarrollar sntomas de rpida
PXODDSDUWLUGHODPHGLFLyQGHODYHORFLGDGPi[LPD evolucin en cuanto a severidad pudiendo causar la
DyUWLFD )LJXUD muerte previamente al reemplazo valvular. Con ve-
*UDGLHQWH PHGLR  *UDGLHQWH 0i[LPR   locidades menores disminuye el riesgo de evolucin
2.2 mm Hg. trpida. Basado en esto sugiere que estos pacientes
La frmula establece una relacin lineal y directa deberan ser intervenidos a pesar de la aparente falta
HQWUHJUDGLHQWHPi[LPRPHGLR\YHORFLGDGPi[LPD GH VtQWRPDV   3RU RWUD SDUWH H[LVWH XQ JUXSR GH-
artica. Por lo tanto, desde un punto de vista prctico, QRPLQDGRHVWHQRVLVDyUWLFDPX\VHYHUD DVLQWRPiWL-
los gradientes no aportan informacin adicional. FRVSHURFRQJUDGLHQWHVPHGLRVPD\RUHVDPP+J
\ iUHDV PHQRUHV GH  FP  TXH VH EHQHFLDUtDQ
SNTOMAS FRQHOUHPSOD]RYDOYXODUDyUWLFR (YLGHQFLD,,%GHOD
$PHULFDQ+HDUW$VVRFLDWLRQ 
A simple vista impresiona que la secuencia: soplo,
FRQUPDFLyQHFRFDUGLRJUiFDGHHVWHQRVLVDyUWLFDVH- CALCIFICACIN VALVULAR
vera, sntomas y ciruga resulta sencilla y segura para ARTICA
UHGXFLUDOPi[LPRODPRUWDOLGDGTXHFRQOOHYDHVWDSD-
tologa. Sin embargo en numerosos estudios se obser- 'DGRTXHGHORVSDFLHQWHVPD\RUHVGHDxRV
YDXQDLPSRUWDQWHGLFXOWDGHQHYDOXDU\DGMXGLFDUORV de edad presenta signos compatibles con esclerosis
sntomas a la patologa artica. A medida que la edad DyUWLFD  \TXHGHFDGDGHHVWRVSDFLHQWHVDYDQ-
se incrementa tambin lo hace la posibilidad de desa- ]DQ D HVWHQRVLV DyUWLFD KHPRGLQiPLFDPHQWHVLJQL-
UUROODUFRPRUELOLGDGHVTXHDFRPSDxHQDODHVWHQRVLV cativa, una de las lneas de investigacin para pre-
DyUWLFDGLFXOWDQGRODGHFLVLyQGHOUHPSOD]RYDOYXODU decir qu pacientes se encuentran en riesgo es la de
HYDOXDUHOJUDGRGHFDOFLFDFLyQYDOYXODU
EL PACIENTE CON ESTENOSIS El tiempo medio que transcurre entre la esclerosis
ARTICA SEVERA ASINTOMTICA artica y el desarrollo de estenosis moderada es de
O CON SNTOMAS DE DIFCIL DSUR[LPDGDPHQWHDDxRV  
INTERPRETACIN 3RU Vt PLVPD OD FDOFLFDFLyQ YDOYXODU DyUWLFD
independientemente de los parmetros hemodinmi-
La mayora de la investigacin actual intenta iden- FRVFRQVWLWX\HXQLPSRUWDQWHIDFWRUGHULHVJR )LJX-
WLFDUDOJUXSRGHSDFLHQWHVTXHVHEHQHFLDUtDFRQ UD (QXQHVWXGLRUHFLHQWHVHREVHUYyTXHHOJUDGR
un procedimiento quirrgico precoz a pesar de la su- GHFDOFLFDFLyQHYDOXDGRPHGLDQWHWRPRJUDItDD[LDO
puesta ausencia de sntomas. FRPSXWDGDSUHVHQWDEDXQ55GH D&,
Diversos autores se han focalizado en la presen-   SRU FDGD  8$JDWVWRQ GH LQFUHPHQWR SDUD
FLDGHYHORFLGDGHVDyUWLFDV \SRUORWDQWRJUDGLHQWHV  predecir la aparicin de disnea, ngor, sncope, in-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

corporal. La hiptesis se relaciona con el hecho de


TXHH[LVWHQSDFLHQWHVFRQYHQWUtFXORVFRQYRO~PHQHV
GH Q GH GLiVWROH SHTXHxRV TXH VH YDFtDQ PiV GH
XQSHURTXHVRORJHQHUDQSHTXHxRVYRO~PHQHV
eyectados. Dado que los gradientes son directamente
SURSRUFLRQDOHVDODFDQWLGDGH[SXOVDGDSRUHOYHQWUt-
FXORL]TXLHUGRODUHVXOWDQWHVHUtDXQEDMRJUDGLHQWH
Pi[LPR \ PHGLR (Q HVWH HVWXGLR UHWURVSHFWLYR VH
postul que estos pacientes reciben el remplazo val-
vular en forma tarda, presentan mas comorbilidades,
FRQXQSHRUSURQyVWLFRDODUJRSOD]R(OEDMRXMR
HQFDYLGDGHVSHTXHxDV H[SOLFDSRUTXHODIUDFFLyQ
Figura 9.5. Severa calcicacin valvular artica con marcada GH H\HFFLyQ SRU VL PLVPD QR UHVXHOYH OD SDUDGRMD
hipertroa del ventrculo izquierdo en un eco cardiograma GHOEDMRJUDGLHQWHHQHVWHQRVLVDyUWLFDVVHYHUDV&DEH
bidimensional en eje longitudinal.
PHQFLRQDUTXHWUDEDMRVFRPRHOGH-DQGHU\0LQHUV
que realizaron un subanlisis del estudio SEAS, no-
WDURQTXHQRWRGRVORVSDFLHQWHVFRQEDMRXMREDMR
VXFLHQFLDFDUGtDFDRHOUHTXHULPLHQWRGHUHPSOD]R gradiente y fraccin de eyeccin conservada se com-
YDOYXODU   SRUWDQFRPRHVWHQRVLVVHYHUDV  
Entidad que se caracteriza por una marcada remo-
MUERTE SBITA EN EL PACIENTE GHODFLyQFRQFpQWULFDFDYLGDGSHTXHxD\VLRORJtDUHV-
ASINTOMTICO trictiva que limita el llenado del ventrculo izquierdo y
TXHDSHVDUGHXQDIUDFFLyQGHH\HFFLyQGHOWLHQHQ
Solo dos estudios en pacientes asintomticos han parmetros miocrdicos de funcin comprometidos.
reportado la incidencia de este fenmeno. El ya re- ([LVWHXQDOWRQ~PHURGHSDFLHQWHVHQHVWHJUXSR
ferido, efectuado en la Clnica Mayo, consisti en que en realidad presentan estenosis moderadas y que
ODHYDOXDFLyQGHSDFLHQWHVVHJXLGRVGXUDQWH esto se debera inicialmente a errores del clculo del
DxRV GRQGH VH REVHUYy XQD LQFLGHQFLD GH    iUHDYDOYXODU\VXSHUFLHFRUSRUDOSHTXHxD3RURWUD
(QRWURWUDEDMR5RVHQKHN  FRQXQVHJXLPLHQWR SDUWH HQIDWL]DQ TXH HO FRQFHSWR GH EDMR XMR EDMR
DPHVHVHQSDFLHQWHVREVHUYyXQGH gradiente no conlleva a una mayor mortalidad.
PXHUWHV~ELWD  0DURQHYDOXyDDWOHWDVTXH Recientemente Clavel y Dusmenil en Canad han
fallecieron por muerte sbita durante actividad de- SXEOLFDGRXQWUDEDMRFRPSDUDWLYRGRQGHVHYXHOYHD
SRUWLYD  FRPSUREy HQ  GH HOORV   HVWHQRVLV observar un peor pronstico en mortalidad cuando se
DyUWLFD VHYHUD   3RU OR WDQWR VH SRGUtD FRQFOXLU FRPSDUDHVWHQRVLVDyUWLFDVHYHUDFRQEDMRJUDGLHQWH\
que la muerte sbita es infrecuente en individuos fraccin de eyeccin conservada. Entidad que se ca-
asintomticos, no obstante se deberan evitar los racteriza por una marcada remodelacin concntrica,
HMHUFLFLRVH[WHQXDQWHV SHTXHxDFDYLGDG\VLRORJtDUHVWULFWLYDTXHLPSLGHHO
adecuado llenado del V.I y que a pesar de una fraccin
ESTENOSIS ARTICA CON GHH\HFFLyQGHOWLHQHIXQFLyQPLRFiUGLFDDOWHUD-
BAJO FLUJO, BAJO GRADENTE da, con su contraparte con gradiente medio elevado
Y FRACCIN DE EYECCIN !PP+J \HVWHQRVLVDyUWLFDPRGHUDGD  
CONSERVADA Por otra parte en las guas europeas y norteameri-
canas de valvulopatas se ha integrado el concepto de
'DGRTXHORVVtQWRPDVVRQXQWHPDVXEMHWLYR\VXMHWR EDMRXMR\EDMRJUDGLHQWHFRPRXQDKHUUDPLHQWD~WLO
a interpretacin por parte del mdico y del paciente para decidir el momento quirrgico.
ha surgido especial inters en el grupo de pacientes
FRQ IUDFFLyQ GH H\HFFLyQ FRQVHUYDGD !  EDMR HIPERTROFIA VENTRICULAR
JUDGLHQWHPHGLR PP+J \iUHDYDOYXODUPHQRU IZQUIERDA
DFP
(QHOJUXSRGH+DFKLFKD  LQWURGXMRHO 0DUNNX .XSDUL UHDOL]D XQD FUtWLFD DO SDUDGLJPD GH
FRQFHSWRGHXMRHQWHQGLGRSRUODFDQWLGDGGHVDQ- TXH OD KLSHUWURD YHQWULFXODU L]TXLHUGD FRQVWLWX\H
gre que pasa por cada latido a travs del tracto de sa- una respuesta adaptativa en todos los casos. En su
OLGDGHOYHQWUtFXORL]TXLHUGRLQGH[DGRDODVXSHUFLH WUDEDMR GRQGH VH HYDOXDURQ  SDFLHQWHV SUHYLRV


CAPTULO 9 Estenosis artica

al remplazo valvular se observ que el grado de hi- ventrculo izquierdo. La presencia de una respuesta
SHUWURDHYLGHQFLDGRSRUODPDVDYHQWULFXODUIXHHO DQRUPDOGHODSUHVLyQDUWHULDO IDOWDGHLQFUHPHQWRR
PD\RUSUHGLFWRUGHOJUDGRGHLQVXFLHQFLDFDUGtDFD GLVPLQXFLyQGHHVWDGXUDQWHHOHVIXHU]R HOLQIUDGHV-
independientemente del gradiente y del rea valvular. QLYHOGHO67RDUULWPLDYHQWULFXODUFRPSOHMDKDVLGR
Como en el clculo de la masa interviene el volumen DVRFLDGDDXQDPD\RUWDVDGHPXHUWHV~ELWD  \D
miocrdico, se tiene en cuenta no solamente el es- la aparicin de sntomas  
SHVRUVLQRWDPELpQHOWDPDxRGHODFDYLGDG )LJXUD Dentro de los parmetros que implican una mayor
 (QWUHHO\HOGHORVSDFLHQWHVFRQHV- probabilidad de desarrollar sntomas y requerir ciru-
WHQRVLVQRWLHQHKLSHUWURDYHQWULFXODUL]TXLHUGD6H JtDVHHQFXHQWUDQ*UDGLHQWHPHGLR!PP+JHQ
KDUHSRUWDGRTXHHOGHORVYDURQHV\HOGH UHSRVRFRQDXPHQWRGXUDQWHHOHMHUFLFLR!PP+J
ODVPXMHUHVSXHGHQQRSUHVHQWDUKLSHUWURD(VWXGLRV y la falta de aumento de la fraccin de eyeccin.
H[SHULPHQWDOHVGHPXHVWUDQTXHHOHVSHVRUUHODWLYRHV /DQFHOORWWL  FRQVLGHUDTXHHODXPHQWRGHJUDGLHQ-
LJXDOHQSUHVHQFLDRHQDXVHQFLDGHKLSHUWURDYHQ- WHPHGLR!PP+JGXUDQWHXQDSUXHEDGHHVIXHU]R
tricular izquierda. En el primer caso por aumento del SUHGLFHSHRUHYROXFLyQ DSDULFLyQGHVtQWRPDV\UHTXH-
espesor parietal y en el segundo por disminucin del ULPLHQWRGHFLUXJtD GDGRTXHH[SUHVDXQDGLVPLQXFLyQ
WDPDxRGHODFDYLGDG   GHODFRPSOLDQFHYHQWULFXODU(QVXWUDEDMRVXJLHUHTXHVL
Otra lnea de investigacin consiste en el hecho ODVFDUDFWHUtVWLFDV HOiUHDHQUHSRVRPHQRUDFP
GHPRVWUDGRGHODPRGXODFLyQGHOWLSRGHKLSHUWURD HOHVWUpVDQRUPDOSRULQIUDGHVQLYHOGHO67PD\RUDPP
HQHOFRQWH[WRGHUHVLVWHQFLDDODLQVXOLQD/XQGHQ \DXPHQWRGHOJUDGLHQWHPHGLR!PP+J HVWiQSUH-
$OHPDQLD  GHVFULELyHOHIHFWRGHODREHVLGDGVR- sentes en una prueba de esfuerzo, independientemente
bre la masa ventricular y la funcin sistlica en pa- de los sntomas, se debera indicar el reemplazo valvular
cientes con estenosis artica severa asintomtica re- artico. La evidencia parece indicar que el eco estrs y
marcando la relacin entre el ndice de masa corporal algunos parmetros ergomtricos tienen un valor aditivo
y el grado de remodelamiento concntrico. VREUHHOHFRFDUGLRJUDPDEDVDO\HOH[DPHQFOtQLFR
El estudio ASTRONOMER llevado a cabo en
4XpEHFLQFRUSRUySDFLHQWHVGHORVFXDOHV PPTIDO NATRIURTICO (BNP)
WHQtDQKLSHUWHQVLyQDUWHULDO\FRQVtQGURPHPH-
tablico. Estos ltimos presentaron mayor espesor 7DOZDU  GHPRVWUyXQDUHODFLyQGLUHFWDHQWUHKL-
SDULHWDOHKLSHUWURDFRQFpQWULFD   SHUWURD YHQWULFXODU L]TXLHUGD HO JUDGLHQWH SLFR
transvalvular y los niveles de proBNP y Cariotropina
ECO ESTRS EN PACIENTES CT-1. Ellos proponen, dada la relacin lineal entre
ASINTOMTICOS CT-1 BNP y gradiente, el control bioqumico adems
del hemodinmico para elegir el tiempo ptimo de la
(OSULQFLSDOREMHWLYRHVGHVHQPDVFDUDUORVVtQWRPDV FLUXJtD(QLJXDOVHQWLGR%HUJHU.OHLQ  HYDOXDQ-
a travs de un esfuerzo controlado. La prueba con- GRSDFLHQWHVFRQYHUGDGHUDHVWHQRVLV\SDFLHQ-
UPDODVHYHULGDGGHODHVWHQRVLV\VXLPSDFWRHQHO WHV FRQ SVHXGRHVWHQRVLV FRQVWDWy TXH HO %13 !
pg/ml represent un marcador de pobre evolucin en

Figura 9.6. Ventrculo izquierdo en cuatro cmaras apical con doppler tisular en distole y sstole que resalta la marcada hi-
pertroa ventricular izquierda.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Tabla 9.1. Criterios diagnsticos para diferenciar la estenosis


ambos grupos. No obstante Blase Carabello en un aortica (EAO) con reserva inotrpica, sin reserva inotrpica y
interesante editorial revela que no est plenamente pseudoestenosis, en funcin del rea valvular, el gradiente y
la fraccin de eyeccin del ventrculo izquierdo (FEYVI)
convencido que el aumento del BNP sea un marca-
dor adecuado para el pronstico, el seguimiento y el
UHVXOWDGRGHODFLUXJtD  EAO con EAO sin Pseudo
reserva reserva EAO
CIRUGA DE REMPLAZO Area = = 
VALVULAR EN EL PACIENTE
ASINTOMTICO Gradiente  =

FEYVI  = 
Las guas europeas recomiendan ciruga precoz en
SDFLHQWHVDVLQWRPiWLFRVFRQiUHDFPRFP
PUHVSXHVWDDQRUPDODOHMHUFLFLRPRGHUDGDDVHYH-
UDFDOFLFDFLyQ\SURJUHVLyQGHODYHORFLGDGPi[LPD MANEJO DE LOS PACIENTES CON
DRUWLFD!PVSRUDxR\GHWHULRURGHODIXQFLyQ DETERIORO DE LA FUNCIN
YHQWULFXODU   VENTRICULAR

ECO TRIDIMENSIONAL (E3D), El test de Dobutamina es el mtodo actual, de mayor


TOMOGRAFA COMPUTADA (TAC) XWLOLGDGSDUDGHQLUUHVHUYDFRQWUiFWLO\GLOXFLGDUVL
Y RESONANCIA MAGNTICA (RMN) un paciente con deterioro severo de la funcin ven-
tricular presenta una estenosis verdadera o pseudoes-
([LVWH DFWXDOPHQWH OD SRVLELOLGDG GH PHGLU HO iUHD tenosis. La Tabla 9.1 muestra los criterios diagns-
DQDWyPLFDSRUSODQLPHWUtDPHGLDQWHHO('OD7$& ticos aportados por la prueba de dobutamina para di-
FRQRPiVFRUWHV\OD501  (VWDWHFQRORJtD ferenciar la estenosis aortica con reserva, sin reserva
podra resultar particularmente til en los pacientes R SVHXGRHVWHQRVLV REMHWLYDQGR FRPR VH PRGLFD HO
con mala ventana ultrasnica. De los mtodos diag- rea valvular, el gradiente y la fraccin de eyeccin
QyVWLFRVDQWHVFLWDGRVOD501SHUPLWHPHGLUXMRV del ventrculo izquierdo.
por lo que se podra utilizar en remplazo de la ecocar- /DREMHWLYDFLyQGHODUHVHUYDFRQWUiFWLOHVWDHQUH-
GLRJUDItD(O('UHVXOWDGHJUDQXWLOLGDGFXDQGRVH lacin con el aumento del gradiente y la fraccin de
producen estenosis en tanden como la supravalvular eyeccin sin cambios en el rea. En la pseudoesteno-
y la subartica. Pero es prudente recalcar que tiene sis adems del aumento de la fraccin de eyeccin lo
OLPLWDFLRQHV HQ ODV YiOYXODV PX\ FDOFLFDGDV   PDVVLJQLFDWLYRHVHODXPHQWRGHOiUHD1LVKLPXUD
)LJXUD \ FRO GHVFULEHQ  FDVRV SDUDGLJPiWLFRV   (Q HO
primero, como consecuencia del aumento de la des-

Figura 9.7. Eco tridimensional que objetiva una estenosis aortica bicspide con calcicacin localizada.


CAPTULO 9 Estenosis artica

carga sistlica se genera un aumento del gradiente YLGDPD\RUDXQDxR\FRQWUDLQGLFDFLyQDODFLUXJtD


PHGLRGHPPGH+JDPPGH+JVLQYDULD- de reemplazo habitual.
FLyQHQHOiUHDGHFPORTXHFRQVWLWX\HXQDHV- (QODH[SHULHQFLDGH5RVHQKHN\DPHQFLRQDGDHO
tenosis artica severa. En el segundo hay un mnimo alto riesgo quirrgico estuvo en relacin con la alta
DXPHQWRGHOJUDGLHQWHGHDPPGH+J\HVWH FDOFLFDFLyQ OD UiSLGD SURJUHVLyQ KHPRGLQiPLFD
paciente presentaba una estenosis artica moderada WHVW GH HMHUFLFLR SRVLWLYR LQGXFFLyQ GH VtQWRPDV  \
en la ciruga, mientras que en el tercero se observ HO%13HOHYDGR  
XQDGLVPLQXFLyQGHOJUDGLHQWHGHDPPGH+J
\VHDFRPSDxyGHKLSRWHQVLyQ(VWHSDFLHQWHIDOOHFLy HIPERTENSIN PULMONAR
HQHOSRVRSHUDWRULRSRULQVXFLHQFLDFDUGtDFD
En referencia a la reserva contrctil y su impli- El hallazgo de hipertensin pulmonar con valores por
FDQFLDHVWDVHGHQHFRPRXQLQFUHPHQWR!HQ 'RSSOHU HQWUH  PP+J \ GHWHULRUR YHQWULFXODU
ODIUDFFLyQGHH\HFFLyQGXUDQWHODGRVLVPi[LPDGH HQ FRQWH[WR GH ($2 VRPHWLGRV D 59$2 SUHVHQWDQ
'REXWDPLQDDFRPSDxDGRGHXQDXPHQWRQRPD\RUD XQDPRUWDOLGDGGHOYHUVXVHQORVWUDWDGRV
FP PtQLPR RVLQYDULDQWHVHQHOiUHDYDOYXODU mdicamente. Estos pacientes presentan disfuncin
DyUWLFD FDOFXODGD   (VWR FRQOOHYD XQ PHMRU SUR- sistlica y diastlica que genera aumento de la pre-
nostico posoperatorio. VLyQGHQGHGLiVWROHYHQWULFXODU(QHOJUXSRGH5R-
/D IDOWD GH UHVHUYD FRQWUiFWLO VH H[SUHVD SRU XQ chester estudiados por P PelliKa que ya referimos los
EDMRDXPHQWRGHODIUDFFLyQGHH\HFFLyQ  HQ pacientes presentaban disfuncin sistlica marcada,
HO Pi[LPR HVIXHU]R R ELHQ HVWD SHUPDQHFH LQYDULD- por lo tanto padecieron una mortalidad elevada en el
ble. Si estos pacientes son operados presentan mayor seguimiento.
mortalidad, pero los que sobreviven al procedimiento +D\ RWUDV H[SHULHQFLDV TXH FDWDORJDQ OD PDJQL-
SUHVHQWDQXQDHYROXFLyQPHMRUTXHORVTXHUHFLEHQ WXGGH+73HQOHYH PP+J 0RGHUDGD 
tratamiento mdico, siendo estos ltimos los que su- PP+J \VHYHUD !PP+J $PHGLGDTXHDXPHQ-
fren el peor pronstico. WDOD+73DXPHQWDODPRUWDOLGDGTXLU~UJLFD  (V
La deteccin de la pseudoestenosis radica en la interesante destacar que luego de operados los gru-
SUHVHQFLDGHXQiUHDYDOYXODUPHQRUDFPHQUH- pos con hipertensin pulmonar moderada y severa
SRVRGRQGHVHREVHUYDEDMRXMRFRPRH[SUHVLyQGH WXYLHURQPHQRUVREUHYLGDD\DxRV
un ventrculo deteriorado. Al realizar la infusin de
'REXWDPLQDVHLQFUHPHQWDODFRQWUDFWLOLGDGPHMRUD REEMPLAZO VALVULAR ARTICO
HOXMR\FRPRUHVXOWDQWHHOiUHDYDOYXODUVHLQFUH- EN PACIENTES CON DETERIORO
menta a veces al rango de estenosis moderada. La SEVERO DE LA FUNCIN
ausencia de un incremento en el rea valvular puede VENTRICULAR
indicar dos cosas: Una estenosis artica realmente
VHYHUDRODLPSRVLELOLGDGDXQEDMR'REXWDPLQDGH 3RZHOO HQ OD XQLYHUVLGDG GH 1HZ<RUN   UHVDOWD
LQFUHPHQWDUHOXMRHQXQDHVWHQRVLVDyUWLFDGHFXDO- el concepto del origen de la disfuncin ventricular.
quier magnitud. La disminucin de la contractilidad secundaria a un
infarto previo presenta caractersticas distintas a los
ESTENOSIS ARTICA Y CIRUGA que tienen cada de la fraccin de eyeccin por mis-
match. En el grupo con ventrculo izquierdo severo
(OULHVJRTXLU~UJLFRHVGHHQSDFLHQWHVPHQRUHV y IAM previo la mortalidad perioperatoria result de
DDxRV\GHHQPD\RUHVGHHVDHGDGDEDU- PLHQWUDVTXHHQHOJUXSRFRQPDOYHQWUtFXORSRU
FDQGRLQFOXVRSDFLHQWHVGHDxRV/RVSUHGLFWRUHV PLVPDWFKUHVXOWRGHO6LQHPEDUJRHQODH[-
cardacos de mala evolucin son clase funcional III- SHULHQFLDGH6KDURQ\  VREUHSDFLHQWHVFRQ
IV, ciruga de emergencia, disfuncin sistlica en au- IUDFFLyQGHH\HFFLyQVHREMHWLYyXQDPRUWDOL-
sencia de reserva contrctil, hipertensin pulmonar, GDGKRVSLWDODULDGHO\ORVSUHGLFWRUHVLQGHSHQ-
HQIHUPHGDG FRURQDULD EULODFLyQ DXULFXODU FLUXJtD GLHQWHVIXHURQODHGDGODLQVXFLHQFLDUHQDOSHURQR
FDUGLDFD SUHYLD DQFLDQRV  PXMHUHV /DV FRPRUELOL- HO,$0SUHYLR<HVGHGHVWDFDUTXHHQHOSRVRSHUD-
dades que pueden ensombrecer el pronstico son: en- torio presentaron un mayor riesgo de ACV.
IHUPHGDGSXOPRQDUREVWUXFWLYDFUyQLFDLQVXFLHQFLD (QODH[SHULHQFLDGH+DONRVHQ$WODQWD  VH
renal crnica, vasculopata perifrica. En estos casos resalt entre los predictores de la mortalidad a largo
puede considerarse el reemplazo valvular artico SOD]RODVFRPRUELOLGDGHV LQVXFLHQFLDUHQDODJXGD
SHUF~WDQHRHQDTXHOORVSDFLHQWHVFRQH[SHFWDWLYDGH en hemodilisis, accidente cerebro vascular previo,


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

(QODH[SHULHQFLDGH4XpUp\0RQLQ  WDPELpQ
se observ que en los pacientes sin reserva contrctil
EDMRHOWHVWGH'REXWDPLQDVHSURGXFHXQDXPHQWR
GH OD PRUWDOLGDG RSHUDWRULD  GH PRUWDOLGDG FRQ
UHVHUYD HQ FRQWUD GH  VLQ UHVHUYD  )LJXUD  
 6LQHPEDUJRODDXVHQFLDGHODUHFXSHUDFLyQ
de la fraccin de eyeccin en aquellos pacientes que
sobreviven a la ciruga no depende de aludida falta
de reserva contrctil. La capacidad de recuperacin
de la fraccin de eyeccin fue directamente propor-
FLRQDODOVH[RODSUHVHQFLDGHVtQFRSHODDXVHQFLDGH
HTA y el gradiente medio e inversamente relaciona-
Figura 9.8. Grupo I: con reserva contractil. Grupo II: sin re- do con al rea y la enfermedad coronaria.
serva contrctil. Se observa claramente que los mejores re- Como ya mencionamos la importancia de medir
sultados se obtienen al efectuar el reemplazo valvular a los
pacientes con reserva contrctil, que muestran una sobrevida
HO%13HQXQOtPLWHGHFRUWHGHSJPOSHUPLWLUtD
superior al 80% en un seguimiento de 80 meses. Los pacien- predecir la sobrevida y poder diferenciar EAO verda-
tes sin reserva contrctil que son operados son los de peor dera de pseudoestenosis. Adems se correlaciona con
prnstico (modicado de Monin et al. Ref 36). la severidad de la Estenosis artica, los sntomas y la
disfuncin del ventrculo izquierdo.
(Q OD H[SHULHQFLD GH7ULERXLOOR\   VH REVHUYy
(QIHUPHGDGYDVFXODUSHULIpULFD HOGHWHULRURVHYH- TXHORVSDFLHQWHVFRQiUHDFPIUDFFLyQGHH\HF-
ro del ventrculo izquierdo y la ciruga combinada FLyQ\*WHPHGLRPP+JVLQUHVHUYDFRQ-
con by pass. Pero ni la fraccin de eyeccin ni la trctil en Eco Dobutamina presentan una sobrevida a
ciruga de revascularizacin coronaria asociada se DxRVGHOHQFDVRGHVHURSHUDGRVPLHQWUDVTXH
relacionaron con un aumento de la mortalidad hos- ORVQRRSHUDGRVWLHQHQXQDVREUHYLGDGHO/DPRU-
pitalaria. WDOLGDGRSHUDWRULDIXHGHOHVWDQGRHQUHODFLyQFRQ
(QODH[SHULHQFLDGHOD)XQGDFLyQ)DYDORUR   JUDGLHQWWHPHGLRPP+JKLVWRULDGH,$0SUHYLR
VREUHSDFLHQWHVFRQIUDFFLyQGHH\HFFLyQ GDxR PLRFiUGLFR LUUHYHUVLEOH (VWR LQGLFDUtD TXH HQ
VLQ HQIHUPHGDG FRURQDULD VLJQLFDWLYD HO SUHGLFWRU ORV TXH PHMRUD OD IUDFFLyQ GH H\HFFLyQ HO SULQFLSDO
independiente de la sobrevida resultaron ser los gra- mecanismo de la disfuncin es el mismatch que por
dientes de presin preoperatorio. La mortalidad hos- otra parte es prudente que no supere los seis meses.
SLWDODULDIXHGHO
6HJ~Q5DKLPWRROD  HQSDFLHQWHVFRQYHQWUt- REEMPLAZO VALVULAR
FXORL]TXLHUGRVHYHUR\EDMRJUDGLHQWHHOGLDJQyVWLFR PERCUTNEO
suele hacerse en forma tarda debido a otras comor-
ELOLGDGHVTXHGLFXOWDQODSUHFLVLyQGLDJQyVWLFDGHO Desde el primer remplazo percutneo realizado por
H[DPHQVHPLROyJLFR+HFKRHOGLDJQyVWLFRGHHVWH-
nosis artica severa con funcin sistlica de ventr- Cribier et al.  XQDHQRUPHFDQWLGDGGHUHFXUVRV
culo izquierdo deprimida el RVAO se debera llevar KDVLGRGHVWLQDGDDOPHMRUDPLHQWRGHOGLVHxRGHODV
DFDERHQXQSOD]RQRVXSHULRUDPHVHV vlvulas percutneas.
Es importante tener en cuenta que los predictores 'DGRTXHORVHVWiQGDUHVTXLU~UJLFRVKDQPHMRUDGR
de mortalidad operatoria son la falta de reserva con- en trminos de mortalidad, en la actualidad la posibili-
WUiFWLO\HOJUDGLHQWHPHGLRPP+J&RQQRO\   GDGGHPHMRUDUHOSURQyVWLFRFRQXQDHVWUDWHJLDQXHYD
VH UHHUH D OD H[SHULHQFLD HQ OD &OtQLFD 0D\R   requiere de un grupo de pacientes en los que la estrate-
VREUHSDFLHQWHVFRQIUDFFLyQGHH\HFFLyQ\ gia convencional no tenga resultados adecuados.
FRQJUDGLHQWHPHGLRPP+JGRQGHREVHUYyTXH Es por esto que actualmente el implante percu-
ODPRUWDOLGDGDGtDVIXHGHO tneo valvular artico o trans aortic valve implan-
La mortalidad intraoperatoria tambin est rela- WDWLRQ 7$9, HVWiUHVHUYDGRDORVSDFLHQWHVFRQXQ
FLRQDGD FRQ HO WDPDxR GH OD SUyWHVLV SRU OR TXH VH (XURVFRUH !  /DV FRQWUDLQGLFDFLRQHV UHODWLYDV
sugiere evaluar con precisin el anillo que en caso FRQVLVWHQHQVHYHUDFDOFLFDFLyQYDOYXODU\HQIHUPH-
GH VHU GH PHQRV GH  PP HV SUXGHQWH DJUDQGDUOR dad vascular perifrica severa.
durante la ciruga para poner una prtesis de mayor El procedimiento consiste en la insercin de una
Q~PHUR(OJUXSRSUHVHQWDEDH[FHVLYDKLSHUWURD vlvula biolgica, suturada a un stent, y montada en


CAPTULO 9 Estenosis artica

XQDH[WUDRUGLQDULDUHVLVWHQFLDDODGHIRUPDFLyQ
Las vlvulas disponibles son:
 &ULELHU(GZDUGV9DOYH6DSLHQV (GZDUGV/LIHV-
FLHQFHV,UYLQH&$ 6WHQWGHDFHURLQR[LGDEOH
o cromo cobalto y vlvula biolgica de pericar-
GLRHTXLQRH[SDQGLEOHFRQEDOyQ )LJXUD
 &RUH9DOYH &RUH9DOYH,QF,UYLQH&$ 6WHQW
DXWRH[SDQGLEOHGH1LWLQROFRQSUyWHVLVELROyJLFD
GHSHULFDUGLRSRUFLQR )LJXUD

Las diferentes tcnicas de insercin pueden ser


Figura 9.9. Vlvula Cribier-Edwards, expandible con baln. D  UHWUyJUDGD WUDQVIHPRUDO E  UHWUyJUDGD WUDQVXE-
FODYLDF DQWHUyJUDGDDWUDYpVGHSXQFLyQWUDQVHS-
WDORG WUDQVDSLFDO/DYtDDQWHUyJUDGDDWUDYpVGH
puncin venosa y posterior puncin transeptal, fue
HO DERUGDMH XWLOL]DGR LQLFLDOPHQWH SRU &ULELHU 6LQ
HPEDUJRUHVXOWDFRPSOHMDSRUORTXHDFWXDOPHQWHVH
ha abandonado debido a la posibilidad de lesionar
la valva anterior mitral. La va retrograda es actual-
mente la ms utilizada y puede realizarse a travs
de la arteria femoral o la arteria subclavia. Requiere
ciertas caractersticas anatmicas vasculares para el
Figura 9.10. CoreValve, autoexpandible. A la izquierda se ob- SDVDMHGHOLQVWUXPHQWDO(VWRSXHGHUHVXOWDUHQDO-
serva la vlvula y a la derecha ya implantada en el anillo artico JXQRVFDVRVFRPSOHMRVVLH[LVWHHQIHUPHGDGVHYHUD
aorto-ilaca.
La va transapical est actualmente en desarrollo
una camisa que engloba todo el sistema de insercin para poder superar los casos en que la anatoma vas-
HQ XQ FDWpWHU GH  )UHQFK SUHYLDPHQWH ORV GLVSR- FXODULPSLGHODYtDUHWUyJUDGD )LJXUD 
VLWLYRVHUDQGHD)UHQFK 8QRGHORVDYDQFHV (Q HO FDVR GHO EDOyQ H[SDQGLEOH OD YiOYXOD HVWi
ms importantes adems de la reduccin del dime- montada alrededor de l, y cuando se dilata el mismo,
tro de los catteres utilizados es la utilizacin del Ni- la prtesis queda implantada en el anillo artico. En
WLQRO 1LNHO7LWDQLXP HQDOJXQDVSUyWHVLV(VWHHVXQ el segundo caso, se remueve una camisa que rodea
material que tiene la particularidad de mantener una DODSUyWHVLV\HOODVHH[SDQGHDXWRPiWLFDPHQWHXQD
memoria de forma sensible a la temperatura. Dicho YH]SRVLFLRQDGD/D)LJXUDPXHVWUDXQ(FRFDU-
de otro modo, el material se vuelve maleable a tem- diograma transesofgico en el que se observa una
SHUDWXUDVEDMDV\VHH[SDQGHDXQDIRUPDSUHHVWDEOH- vlvula Core Valve, que es la ms utilizada en nues-
FLGDDWHPSHUDWXUDVPiVDOWDV D PDQWHQLHQGR tro medio, ya posicionada.

Figura 9.11. Tcnica transapical. La vlvula se implanta por la punta del ventrculo izquierdo a travs de una puncin intercostal.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

En la rama B se compar TAVI contra tratamien-


to mdico en pacientes inoperables por su alto riesgo.
Este estudio se realiz utilizando el modelo SAPIEN
de Edwards Lifesciences. Hasta la fecha ha sido de-
mostrado que TAVI es superior al tratamiento mdico
en la rama B del estudio PARTNER con un seguimien-
WRDDxRV6HUHPDUFDHQHVWHHVWXGLRTXHODVFRPRU-
ELOLGDGHVSUHYLDVDOLPSODQWHMXHJDQXQSDSHOIXQGD-
PHQWDOHQHOWLHPSRGHVREUHYLGDGHORVSDFLHQWHV  
En nuestro pas la prtesis que se utiliza en cen-
tros seleccionados es la CoreValve de Medtronic.
Actualmente se estn reclutando pacientes para un
Figura 9.12. Eco transesofgico donde se objetiva a nivel ar-
tico una Core Valve ya posicionada. HVWXGLRTXHLQYROXFUDUiDOUHGHGRUGHSDFLHQWHV

LIMITACIONES

RESULTADOS DE LOS ESTUDIOS $ SHVDU GH TXH H[LVWH XQ HQRUPH HQWXVLDVPR HQ HO
CLNICOS SOBRE REEMPLAZO remplazo valvular percutneo este tipo de tecnologa
VALVULAR ARTICO PERCUTNEO todava presenta algunos puntos a resolver:
 Migracin del dispositivo, compresin del tron-
La mayora de la evidencia surgi inicialmente de re- co de coronaria izquierda, laceracin mitral, in-
porte de casos y series retrospectivas. Actualmente el VXFLHQFLDSDUDYDOYXODU\WURPERHPEROLVPR
HVWXGLRPiVLPSRUWDQWHHVHO3$571(5  (OGL-  Optimizacin de los accesos, reduccin del ta-
VHxRGHOHVWXGLRFRPSUHQGHUDPDV(QODUDPD$VH PDxRGHORVGLVSRVLWLYRVSRVLELOLGDGGHUHSRVL-
compar TAVI contra reemplazo valvular quirrgico cionar o retirar la prtesis en caso de mal posi-
en pacientes de alto riesgo. En esta rama del estudio, cionamiento inicial.
FRQXQVHJXLPLHQWRDDxRVVHREVHUYDURQUHVXOWDGRV  Estandarizacin de los mtodos de imgenes
similares cuando se compara remplazo quirrgico para la correcta seleccin de pacientes, seleccin
contra percutneo en trminos de mortalidad, me- GHO WDPDxR GH ODV SUyWHVLV VHJXLPLHQWR SRVWH-
MRUtDGHVtQWRPDV\PHMRUtDYDOYXODUKHPRGLQiPLFD ULRUFXDQWLFDQGRHOJUDGRGHLQVXFLHQFLDSDUD
Sin embargo se observ un incremento de eventos valvular.
HQORVSDFLHQWHVTXHSUHVHQWDEDQLQVXFLHQFLDSDUD- La impresin es que la mayora de estos puntos
valvular en el TAVI. La presencia de este fenmeno, sern resueltos con el tiempo mediante el entrena-
LQFOXVLYH VLHQGR OHYH LQX\H VREUH OD PRUWDOLGDG D miento del hemodinamista, la investigacin continua
ODUJRSOD]R  \ODPHMRUDHQHOGLVHxRGHODVSUyWHVLV


CAPTULO 9 Estenosis artica

BIBLIOGRAFA
1. 5RVV--U%UDXQZDOG($RUWLFVWHQRVLV&LUFXODWLRQ-XO VXSSO 
 2WWR&09DOYXODUDRUWLFVWHQRVLVGLVHDVHVHYHULW\DQGWLPLQJRILQWHUYHQWLRQ-$P&ROO&DUGLRO
 %RQRZ52&DUDEHOOR%$&KDWHUMHH.HWDOIRFXVHGXSGDWHLQFRUSRUDWHGLQWRWKH$&&$+$JXLGHOLQHV
for the management of patients with valvular heart disease: a report of the American College of Cardiology/American
+HDUW$VVRFLDWLRQ 7DVN )RUFH RQ SUDFWLFH *XLGHOLQHV :ULWLQJ &RPPLWWHH WR UHYLVH WKH  JXLGHOLQHV IRU WKH
PDQDJHPHQWRISDWLHQWVZLWKYDOYXODUKHDUWGLVHDVH (QGRUVHGE\WKH6RFLHW\RI&DUGLRYDVFXODU$QHVWKHVLRORJLVW
Society for Cardiovascular Angiography and Interventions, and Society of Thoracic Surgeons. J Am Coll Cardiol
6HS  H
 9RHONHU:5HXO+1LHQKDXV*HWDO&RPSDULVRQRIYDOYXODUUHVLVWDQFHVWURNHZRUNORVVDQG*RUOLQYDOYDDUHDIRU
TXDQWLFDWLRQRIDRUWLFDVWHQRVLV$QLQYLWURVWXG\LQDSXOVDWLOHDRUWLFRZPRGHO&LUFXODWLRQ
 9DKDQLDQ$2WWR&05LVNVWUDWLFDWLRQRISDWLHQVZLWKDRUWLFVWHQRVLV(XU+HDUW-
 3HOOLND3(6DUDQR01LVKLPXUD5$HWDO2XWFRPHRIDGXOWVZLWKDV\PSWRPDWLFKHPRGLQDPLFDOO\VLJQLFDQW
DRUWLFVWHQRVLVGXULQJSURORQJHGIROORZXS&LUFXODWLRQ
7. 0RQLQ-//DQFHOORWWL30RQFKL0HWDO5LVNVFRUHIRUSUHGLFWLQJRXWFRPHLQSDWLHQWVZLWKDV\PSWRPDWLFDRUWLF
VWHQRVLV&LUFXODWLRQ
 5RVHQKHN5=LOEHUV]DF56KHPSHU0HWDO1DWXUDOKLVWRU\RIYHU\VHYHUHDRUWLFVWHQRVLV&LUFXODWLRQ

9. 6WHZDUW%)6LVFRYLFN'/LQN%.HWDO&OLQLFDOIDFWRUVDVVRFLDWHGZLWKFDOFLFDRUWLFYDOYHGLVHDVH&DULRYDVFXODU
+HDOWK6WXG\-$P&ROO&DUGLRO
 &RVPL-(.RUW67XQLN3$HWDO7KHULVNRIWKHGHYHORSPHQWRIDRUWLFVWHQRVLVLQSDWLHQWVZLWKEHQLJQDRUWLFYDOYH
WKLFNHQLQJ$UFK,QWHUQ0HG
11. 0HVVLND=HLWXQ'$XEU\0&'HWDLQW'HWDO(YDOXDWLRQDQGFOLQLFDOLPSOLFDWLRQVRIDRUWLFYDOYHFDOFLFDWLRQ
PHDVXUHGE\HOHFWURQEHDPFRPSXWHGWRPRJUDSK\&LUFXODWLRQ-XO
 5RVHQKHN5%LQGHU73RUHQWD*HWDO3UHGLFWRUVRIRXWFRPHLQVHYHUHDV\PSWRPDWLFDRUWLFVWHQRVLV1(QJO-0HG

 0DURQ%-6XGGHQWGHDWKLQ\RXQJDWKOHWHV1(QJO-0HG
 +DFKLFKD='XVPHQLO-%RJDW\3HWDO(MHFWLRQIUDFWLRQLVDVVRFLDWHGZLWKKLJKHUDIWHUORDGDQGUHGXFHGVXUYLYDO
LQSDUDGR[LFDOORZRZORZJUDGLHQWVHYHUHDRUWLFVWHQRVLVGHVSLWHSUHVHUYHGHMHFWLRQIUDFWLRQ&LUFXODWLRQ

 -DQGHU10LQQHUV-+ROPH,2XWFRPHRISDWLHQWVZLWKORZJUDGLHQWVHYHUHDRUWLFVWHQRVLVDQGSUHVHUYHGHMHFWLRQ
IUDFWLRQ&LUFXODWLRQ
 &ODYHO0$'XVPHQLO-*&SRXODGH5HWDO2XWFRPHRISDWLHQWVZLWKDRUWLFVWHQRVLVVPDOOYDOYHDUHDDQGORZRZ
ORZJUDGLHQWGHVSLWHSUHVHUYHGOHIWYHQWULFXODUHMHFWLRQIUDFWLRQ-$P&ROO&DUGLRO  
17. Kupari M, Turto H, Lommi J. Left ventricular hypertrophy in aortic stenosis: preventive or promotive of systolic
GLVIXQFWLRQDQGKHDUWIDLOXUH"(XU+HDUW-6HS
 /XQG%*RKONH%DUZROI&+&UDPDULXF'HWDO(IIHFWRIREHVLW\RQOHIWYHQWULFXODUPDVVDQGV\VWROLFIXQFWLRQLQ
SDWLHQWVZLWKDV\PSWRPDWLFDRUWLFVWHQRVLV6HDVVXEVWXG\$P-&DUGLRO
19. Page A, Dusmenil J, Clavel A et al. Metabolic syndrome is associated with more pronunced impairment of left
YHQWULFXODUJHRPHWU\DQGIXQFWLRQLQSDWLHQWVZLWKFDOFLFDRUWLFVWHQRVLV-$P&ROO&DUGLRO$SU
 $PDWR0&0RIID3-:HUQHU.(HWDO7UHDWPHQWGHFLVLRQLQDV\PSWRPDWLFDRUWLFYDOYHVWHQRVLVUROHRIH[HUFLVH
WHVWLQJ+HDUW
 /DQFHOORWWL3/HERLV)6LPRQ0HWDO3URJQRVWLFLPSRUWDQFHRITXDQWLWDWLYHH[FHUVLVHGRSSOHUHFKRFDUGLRJUDSK\LQ
DV\PSWRPDWLFYDOYXODUDRUWLFVWHQRVLV&LUFXODWLRQ VXSS, ,
 Talwar S, Downie PF, Squire IB et al. Plasma N-Terminal pro BNP and cardiotrophine-1 are elevated in aortic
VWHQRVLV-RXUQDORI+HDUW)DLOXUH
 Berger-Klein J, Mundigler G, Pibarot P et al. B-type natriuretic peptide: relationship haemodynamics and clinical
RXWFRPHUHVXOWVIURPWKH0XOWLFHQWHU7UXO\RU3VHXGR6HYHUHDRUWLFVWHQRVLV 723$6 VWXG\&LUFXODWLRQ

 &DUDEHOOR%ODVH$RUWLFVWHQRVLVWZRVWHSVIRUZDUGRQHVWHSEDFN&LUFXODWLRQ
 0LQQHUV-$OHUL0*RKHNH%HWDO,QFRQVLVWHQWJUDGLQJRIDRUWLFYDOYHVWHQRVLVE\FXUUHQWJXLGHOLQHV+HDUW

 5RSHUV'5RSHUV80DUZDQ0HWDO&RPSDULVRQRIGXDOVRXUFHFRPSXWHGWRPRJUDSK\IRUWKHTXDQWLFDWLRQRI
aortic valve area in patients with aortic stenosis versus transthoracic echocardiography and invasive haemodynamic
DVVHVVPHQW$P-&DUGLRO
 Mallavarapu RK, Nannda K. Three-Dimensional transthoracic echocardiography assessment of aortic stenosis. .
&DUGLRO&OLQ
 Nishimura R, Grantham A, Connolly H et al. Low-output, low-gradient aortic stenosis in patients with depressed


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

left ventricular systolic function. The clinical utility of the dobutamine challenge in the catheterization laboratory.
&LUFXODWLRQ
 Zuppiroli A, Mori F, Olivatto I et al. Therapeutic implications of contractile reserve elicited by dobutamine
HFKRFDUGLRJUDSK\LQV\PSWRPDWLFORZJUDGLHQWDRUWLFVWHQRVLV,WDO+HDUW-
 0DORXI-)(QULTXH]6DUDQR03HOOLND3HWDO6HYHUHSXOPRQDU\K\SHUWHQVLRQLQSDWLHQWVZLWKVHYHUHDRUWLFYDOYH
VWHQRVLVFOLQLFDOSUROHDQGSURJQRVWLFLPSOLFDWLRQV-$P&ROO&DUGLRO
 3RZHO'(7XQLN3$5RVHQ]ZHLJ3HWDO$RUWLFYDOYHUHSODFHPHQWLQSDWLHQWVZLWKDRUWLFVWHQRVLVDQGVHYHUHOHIW
YHQWULFXODUGLVIXQFWLRQ$UFK,QWHUQ0HG
 Sharony R, Grossi E.A, Sanders P et al. Aortic valve replacement in patients with impaired ventricular function. Ann.
7KRUDF6XUJ
 +DONRV0(&KHQ(36DULQ(/HWDO$RUWLFYDOYHUHSODFHPHQWIRUDRUWLFVWHQRVLVLQSDWLHQWVZLWKOHIWYHQWULFXODU
GLVIXQFWLRQ$QQ7KRUDF6XUJ
 Casab H, Stutbach P, Guevara E et al. Outcome of aortic valve replacement in patients with severe aortic stenosis
ZLWKRXW VLJQLFDQW FRURQDU\ DUWHU\ GLVHDVH DQG VHYHUHO\ GHSUHVVHG OHIW YHQWULFXODUIXQFWLRQ$EVWUDFW $&&
DQQXDO6FLHQWLF6HVVLRQ$QDKHLP&DOLIRUQLD
 5DKLPWRROD66HYHUHDRUWLFVWHQRVLVZLWKORZV\VWROLFJUDGLHQWWKHJRRGDQGEDGQHZV&LUFXODWLRQ

 Monin J, Monchi M, Gest V, et al. Aortic Stenosis With Severe Left Ventricular Dysfunction and Low Transvalvular
SUHVVXUH *UDGLHQWV 5LVN 6WUDWLFDWLRQ E\ /RZ'RVH 'REXWDPLQH (FKRFDUGLRJUDSK\ - $P &ROO &DUGLRO

 Connoly HM, Oh J, Shaft HV et al. Severe aortic stenosis with low transvalvular gradient and severe left ventricular
GLVIXQFWLRQUHVXOWVRIDRUWLFYDOYHUHSODFHPHQWLQSDWLHQWV&LUFXODWLRQ
 0RQLQ-/4XpUp-30RQFKL0HWDO/RZJUDGLHQWDRUWLFVWHQRVLVRSHUDWLYHULVNVWUDWLFDWLRQDQGSUHGLFWRUVIRUORQJ
WHUPRXWFRPHDPXOWLFHQWHUVWXG\XVLQJ'REXWDPLQHVWUHVVKHPRG\QDPLFV&LUFXODWLRQ
 7ULERXLOOH\&/HY\)5XVLQDUX'HWDO2XWFRPHDIWHUDRUWLFYDOYHUHSODFHPHQWIRUORZRZORZJUDGLHQWDRUWLF
VWHQRVLVZLWKRXWFRQWUDFWLOHUHVHUYHRQGREXWDPLQHVWUHVVHFKRFDUGLRJUDSK\-$P&ROO&DUGLRO
 Cribier A, Eltchaminoff H, Bash A et all Percoutaneous transcatheter implantation of an aortic valve prothesis for
FDOFLFDRUWLFVWHQRVLVUVWKXPDQFDVHGHVFULSWLRQ&LUFXODWLRQ
 Kodali S, Williams M, Smith C. Two-year outcomes after transcatheter or surgical aortic valve replacement. N Engl
-0HG
 Tuczu EM. PARTNER cohort B three year: clinical and echocardiographic outcomes from a prospective, randomized
WULDORIWUDQVFDWKHWHUDRUWLFYDOYHUHSODFHPHQWLQLQRSHUDEOHSDWLHQWV7&72FWREHU0LDPL)/


&$3,78/2

ANGINA DE PECHO EN LA MUJER

CINZIA ZUCHI, ISABELLA TRITTO, GIUSEPPE AMBROSIO

([LVWHFLHUWRFRQYHQFLPLHQWRGHTXHODHQIHUPHGDG CARACTERSTICAS DE LAS


FRURQDULD (& DIHFWDSULQFLSDOPHQWHDORVYDURQHV MUJERES CON ENFERMEDAD
Sin embargo, contrariamente a esta percepcin co- CORONARIA
P~QPiVPXMHUHVTXHKRPEUHVPXHUHQDFDXVDGH
(&HQORVSDtVHVRFFLGHQWDOHV>@3RURWUDSDUWH /DV PXMHUHV TXH VXIUHQ GH DQJLQD GH SHFKR GLHUHQ
adems de ser una causa importante de muerte, la sustancialmente de los hombres con la misma enferme-
EC es tambin una causa importante de morbilidad GDG/DVPXMHUHVFRQ(&VRQPD\RUHVWLHQGHQDWHQHU
HQDPERVVH[RV'HKHFKRODDQJLQDHVWDEOHHVXQD una mayor carga de comorbilidades, as como mayor
condicin muy comn, con una prevalencia de al- LQFDSDFLGDGIXQFLRQDOTXHORVKRPEUHV>@/D(&HV
UHGHGRUGHOGHODSREODFLyQJHQHUDO>@ORTXH PHQRVIUHFXHQWHHQODVPXMHUHVSUHPHQRSiXVLFDV\VX
DIHFWDODFDOLGDGGHYLGD\FDSDFLGDGGHWUDEDMR\ DSDULFLyQVHSURGXFHDDxRVGHVSXpVTXHORVKRP-
con importantes consecuencias econmicas. En un EUHVKDVWDDSUR[LPDGDPHQWHHOVpSWLPDGpFDGDGHYLGD
reciente meta-anlisis de estudios transversales y 'HVGHHOSXQWRGHYLVWDVLRSDWROyJLFRDSUR[LPD-
SURVSHFWLYRV GH  SDtVHV HQ WRGR HO PXQGR TXH GDPHQWHHOGHWRGDVODVPXMHUHVTXHVHGHULYDQ
DEDUFDQFDVLSDFLHQWHVFRQDQJLQDGHXQRX a angiografa coronaria electiva a causa de angina de
RWURVH[RVHKDGHPRVWUDGRXQH[FHVRVLJQLFDWLYR pecho, en realidad no muestran evidencia de estenosis
GHGHPXMHUHVSRUVREUHORVYDURQHVGHPDQHUD VLJQLFDWLYDGHODVDUWHULDVFRURQDULDV>@ )LJXUD
FRQVWDQWH>@  (QXQDFRKRUWHPX\DPSOLDGHPDVGH
SDFLHQWHVUHPLWLGRVSDUDHYDOXDFLyQDQJLRJUiFDGHOD
DQJLQDHVWDEOHHQKRVSLWDOHVGH(VWDGRV8QLGRV
RGGV ULVN  DMXVWDGR SDUD OD SUHVHQFLD GH HVWHQRVLV
FRURQDULDVVLJQLFDWLYDVIXHVyORGHSDUDODVPX-
MHUHVHQFRPSDUDFLyQFRQORVKRPEUHV 3 >
@(VDEDMDSUHYDOHQFLDGHHQIHUPHGDGREVWUXFWLYDGH
ODVDUWHULDVFRURQDULDVHQPXMHUHVFRQDQJLQDRFXUUHHQ
WRGRVORVJUXSRVGHHGDG>@6LQHPEDUJRVHYXHOYH
DVRPEURVDPHQWHEDMDDHGDGHVUHODWLYDPHQWHMyYHQHV
\DTXHFDVLHOGHODVPXMHUHVPHQRUHVGHDxRV
con angina estable, remitidas a angiografa coronaria
SDUDGLDJQyVWLFRHOHFWLYRQRWHQtDHVWHQRVLVVLJQLFD-
Figura 10.1. Hallazgos angiogrcos en 168.180 mujeres y
207.706 varones a los que se les efectu angiografa corona- WLYDVGHODVDUWHULDVFRURQDULDV>@ )LJXUD 
ria electiva por dolor anginoso. Datos del American College Uno de los problemas para el diagnstico y el ma-
of Cardiology-National Cardiovascular Data Registry. Los QHMRFRUUHFWRGHOD(&HQPXMHUHVHVGHELGRDOKHFKR
datos fueron tomados y modicados de Barey-Merz y col[4] de que los mdicos tienden a hacer de la angina de
y Shaw LJ y col[8].


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

pecho un equivalente de estenosis coronarias signi- YHUVDVWpFQLFDV>@HQSDFLHQWHV SULQFLSDOPHQWH


FDWLYDV 6LQ HPEDUJR WDPELpQ SXHGHQ RFXUULU HQ PXMHUHV  FRQ DUWHULDV FRURQDULDV DQJLRJUiFDPHQWH
otras condiciones sntomas precordiales sugestivos QRUPDOHV\DQJLQDPLFURYDVFXODU>@SURSRUFLR-
de isquemia de miocardio. nando as evidencia adicional de disfuncin micro-
/DVPXMHUHVPXHVWUDQGLIHUHQFLDVHVWUXFWXUDOHV\ vascular coronaria en pacientes sin lesiones corona-
IXQFLRQDOHVHQODFLUFXODFLyQFRURQDULD>@ ULDVDQJLRJUiFDPHQWHVLJQLFDWLYDV
(QHIHFWRODVDUWHULDVFRURQDULDVHQODVPXMHUHV (VWRV SHFXOLDUHV KDOOD]JRV GHPRJUiFRV \ DQ-
VRQ PiV SHTXHxDV TXH ORV KRPEUHV LQGHSHQGLHQWH JLRJUiFRV SXHGHQ LQXHQFLDU OD SUHVHQWDFLyQ FOt-
GHOWDPDxRFRUSRUDO>@(VWRSRGUtDVHUGHDOJXQD nica y el diagnstico de cardiopata isqumica en la
importancia, ya que se ha demostrado que, incluso en PXMHU(VWDVGLIHUHQFLDVSXHGHQFRQGXFLUUHDOPHQWH
ausencia de estenosis de la luz del vaso por ateros- DOVXEGLDJQyVWLFRGHOD(&HQPXMHUHVGHELGRDORV
FOHURVLVSXHGHH[LVWLUXQDXPHQWRGHODUHVLVWHQFLD siguientes factores.
YDVFXODUOLPLWDQGRHOXMRDOPLRFDUGLR>@
De mayor relevancia es el hallazgo de que la an- PERCEPCIN INADECUADA DEL RIESGO
JLQDGHSHFKRHQODVPXMHUHVHVPHQRVSUREDEOHTXH CARDIOVASCULAR
est asociada a estenosis arterial coronaria angiogr- Hay una generalizada subvaloracin del riesgo cardio-
FDPHQWH VLJQLFDWLYD TXH HQ ORV KRPEUHV /D HQ- YDVFXODUGHODPXMHUQRVRODPHQWHHQWUHODSREODFLyQ
fermedad microvascular de las arterias coronarias es comn sino tambin entre los mdicos. En el Euro
PiVFRPXQHQPXMHUHVTXHHQYDURQHV   +HDUW6XUYH\GHDQJLQDHVWDEOHODVPXMHUHVFRQGR-
&RPR\DVHKDPHQFLRQDGRH[LVWHXQDFDQWLGDG lor anginoso tenan menos probabilidades de someter-
sustancial de datos observacionales y registros indi- se a un electrocardiograma de esfuerzo, y menos pro-
cando que la mayora de lasPXMHUHV HQWUHHO babilidades an de ser referidos para angiografa coro-
DO TXHVHGHULYDQDXQFDWHWHULVPRGLDJQyVWLFR QDULD>@&XULRVDPHQWHKD\UD]RQHVSDUDHVWHHUURU
para la evaluacin de la angina, en realidad no tiene que en parte se derivan de la utilizacin de algoritmos
XQDHVWHQRVLVVLJQLFDWLYDGHODVDUWHULDVFRURQDULDV de riesgo derivados originalmente de poblaciones pre-
>@ dominantemente masculinas. En efecto, segn este en-
3RURWUDSDUWHH[LVWHHYLGHQFLDFUHFLHQWHTXHVX- IRTXHLQFOXVRKDVWDORVDxRVWUHVFXDUWDVSDUWHVGH
giere que la disfuncin microvascular coronaria pue- ODVPXMHUHVWHQGUtDQXQDSXQWXDFLyQSRUHOHVFRUHGH
de ser un factor etiolgico de isquemia miocrdica ULHVJRGH)UDPLQJKDPLQIHULRUDOGHSDGHFHUXQ
\FRQIUHFXHQFLDH[SOLFDODSUHVHQFLDGHGRORUHQHO HYHQWRFRURQDULRDDxRV>@6LQHPEDUJRODHYD-
pecho, en ausencia de obstrucciones coronarias sig- luacin puede cambiar si se utiliza una estrategia ms
QLFDWLYDV FRQJXUDQGR OD OODPDGD DQJLQD PLFUR- UHQDGD8QDQXHYDSXQWXDFLyQGHULHVJRGLVHxDGRHV-
YDVFXODURVtQGURPH;FDUGtDFR>@ SHFtFDPHQWHIXHSUREDGRHQPXMHUHVTXHSDU-
$HVWHUHVSHFWRORVHVWXGLRVTXHH[DPLQDQHV- WLFLSDURQHQHO(VWXGLRGH6DOXGGHOD0XMHU>@(VWH
SHFtFDPHQWHSDFLHQWHVFRQDQJLQDPLFURYDVFXODU nuevo algoritmo es la Escala de riesgo de Reynolds,
HQFXHQWUDQ XQ JUDQ H[FHVR GH PXMHUHV YDULDQGR que incluye edad, presin arterial sistlica, hemoglo-
HQWUH HO   DO   GH ORV FDVRV >  bina ac1 en los diabticos, tabaquismo, colesterol total
  @ 8QD UHFLHQWH UHYLVLyQ VLVWHPiWLFD \+'/SURWHuQD&UHDFWLYDXOWUDVHQVLEOH KV&53 \
VREUH HVWH WHPD >@ GH  HVWXGLRV VREUH DQJLQD antecedentes familiares de infarto de miocardio an-
PLFURYDVFXODU LQFOX\HQGR  SDFLHQWHV  HQ- WHVGHORVDxRV/DDSOLFDFLyQGHHVWDSXQWXDFLyQ
FRQWUy XQD SURSRUFLyQ VLJQLFDWLYDPHQWH PD\RU UHFODVLFyDOGHODVPXMHUHVDWULEXLGDVDULHVJR
GHPXMHUHVFRQXQDIUHFXHQFLDUHODWLYDGHO intermedio de acuerdo con los criterios del ATP III, a
Una cuestin importante es si el dolor de pecho ODFDWHJRUtDGHDOWRULHVJR>@(QWUHORVQXHYRVIDF-
en pacientes con angina microvascular es, sin duda WRUHVGHULHVJRH[DPLQDGRVHQORVSXQWDMHVGHULHVJR
debido a una verdadera isquemia miocrdica. Las GH5H\QROGVODKV&53 XQPDUFDGRUGHLQDPDFLyQ 
PXMHUHV FRQ DQJLQD WuSLFD \ DXVHQFLD GH HVWHQRVLV parece ser de importancia particular. De hecho, entre
VLJQLFDWLYDVGHODVDUWHULDVFRURQDULDVSXHGHQPRV- ODVPXMHUHVSRVPHQRSiXVLFDVKLSHUWHQVDVXQUHFXHQWR
trar deterioro del metabolismo energtico cardaco DOWRGHQHXWUyORVHQODVDQJUHSHULIpULFDKDVLGRUH-
demostrado por espectroscopia de resonancia mag- FLHQWHPHQWHVHxDODGRFRPRXQSUHGLFWRULQGHSHQGLHQ-
ntica nuclear, documentando de manera inequvoca WHGHHYHQWRVFDUGLRYDVFXODUHV>@GHVWDFDQGRTXHOD
OD H[LVWHQFLD GH LVTXHPLD LQGXFLGD SRU HO HMHUFLFLR LQDPDFLyQ SXHGH VHU GH LPSRUWDQFLD HQ OD LGHQWL-
>@$GHPiVVHKDGHPRVWUDGROLPLWDFLyQGHOD FDFLyQ GH PXMHUHV FRQ PD\RU ULHVJR GH HQIHUPHGDG
reserva vasodilatadora coronaria por medio de di- cardiovascular.


CAPTULO 10 Angina de pecho en la mujer

EVALUACIN INADECUADA DE LOS SNTOMAS GHPXMHUHVTXHUHHUHQVtQWRPDVDWtSLFRVFRQUHV-


/DGHQLFLyQGHORTXHFRQVWLWX\HVtQWRPDVWtSLFRV pecto a los hombres. En una poblacin caucsica
de angina de pecho se deriva en gran parte de las ob-  PXMHUHV \ KRPEUHV   =DPDQ \ FRO HQ-
servaciones realizadas en poblaciones predominante- FRQWUDURQ XQD GLIHUHQFLD VLJQLFDWLYD HQWUH VH[RV
mente masculinas, por lo que podra ser un problema HQ ORV VtQWRPDV UHIHULGRV \D TXH HO  GH ODV
HQ FXDQWR D VL ORV VtQWRPDV HQ ODV PXMHUHV WDPELpQ PXMHUHVUHULHURQGRORUWRUiFLFRDWtSLFR>@(VWR
GHEHQVHUMX]JDGRVSRUORVPLVPRVFULWHULRVXWLOL]D- puede tener importantes consecuencias prcticas, ya
dos para el diagnstico de cardiopata isqumica es- TXHFRPRVHPHQFLRQyODVHVWHQRVLVVLJQLFDWLYDV
table en los hombres. de las arterias coronarias estn a menudo ausentes
En este sentido, las guas del National Institute HQODVPXMHUHV
IRU&OLQLFDO([FHOOHQFH 1,&( VREUHDQJLQDHVWDEOH Con respecto a las circunstancias desencadenan-
recientemente publicadas establecen que las diferen- WHVODVPXMHUHVVHTXHMDQFRQPiVIUHFXHQFLDTXHORV
cias en la presentacin sintomtica entre hombres y hombres de factores relacionados con estrs emo-
PXMHUHV VRQ SHTXHxDV \ HV OD SUREDELOLGDG SUHWHVW FLRQDO > @ DVt FRPR WDPELpQ GH HSLVRGLRV QR
GHDWHURVFOHURVLVFRURQDULDODTXHGHELHUDLQXLUHQ claramente relacionados con el esfuerzo fsico. Las
HO PDQHMR \ QR VyOR HO JpQHUR >@ (VWD UHFRPHQ- PXMHUHVFRQDQJLQDFUzQLFDHVWDEOH\ODHQIHUPHGDG
dacin est en consonancia con la actual compren- arterial coronaria documentada son ms propensas
VLyQ VLRSDWRORJLFD \ WUDWDPLHQWR GH OD FDUGLRSDWtD que los hombres a reportar dolor en el pecho durante
isqumica, que generalmente se basa en el enfoque HOUHSRVRHOVXHxRRFRQHSLVRGLRVGHHVWUpVPHQWDO
GHODHVWHQRVLVVLJQLFDWLYD\VLQGXGDHVDSURSLD- >@ \ GH KHFKR HO VH[R IHPHQLQR VH KD DVRFLDGR
GRSDUDXQJUDQQ~PHURGHPXMHUHVFRQDQJLQDHVWD- FRQXQVLJQLFDWLYRH[FHVRGHULHVJRSDUDODDQJLQD
ble debido a EC. A pesar de ello, es de inters con- GXUDQWH HO HVWUpV PHQWDO 55   \ OD DQJLQD HQ
siderar que las posibles diferencias de gnero en los UHSRVR 55 \RWUDVVLWXDFLRQHVQRUHODFLRQDGDV
VtQWRPDVGHSUHVHQWDFLyQWRGDYtDSXHGHQH[LVWLUFRQ FRQHOHMHUFLFLRItVLFR>@
respecto a las caractersticas, la frecuencia, y la cali- 'HOPLVPRPRGRHQSDFLHQWHVFRQ(&GR-
dad de los sntomas observados durante un episodio FXPHQWDGD6KHSV\FROHQFRQWUDURQTXHODVPXMHUHV
DQJLQRVR >@ TXH D YHFHV SXHGH KDFHU TXH VHD UHHUHQHSLVRGLRVGHDQJLQDGXUDQWHHOHVWUpVPHQWDO
difcil de evaluar apropiadamente el dolor de pecho FRQPiVIUHFXHQFLDTXHORVKRPEUHV YV
HQODVPXMHUHV(VWDVGLIHUHQFLDVUDGLFDQSRUXQODGR S >@(VWDPELpQGLJQRGHPHQFLyQTXHOD
en la descripcin de los sntomas que pueden estar angina microvascular es mucho ms comn en las
LQXHQFLDGRVSRUODVFDUDFWHUtVWLFDVGHODSREODFLyQ PXMHUHV >    @ YpDVH PiV
investigada. Por otro lado el desencadenamiento de DGHODQWH  \ SXHGHQ WHQHU FDUDFWHUtVWLFDV DWtSLFDV
ORVVtQWRPDVDYHFHVSXHGHGLIHULUHQWUHORVVH[RV tales como dolor en reposo, duracin prolongada de
Con respecto a las caractersticas clnicas, si los ataques y mala respuesta a los nitratos sublin-
uno considera los pacientes con estenosis arterial JXDOHV>@
coronaria documentada, como se analiza en las di- (Q FRQMXQWR HVWRV KDOOD]JRV VXJLHUHQ TXH YDULRV
UHFWULFHV 1,&( >@ OD DQJLQD GH HVIXHU]R WtSLFD mecanismos pueden estar implicados en la angina de
es de hecho el principal sntoma referido por las PXMHUHVFRQLVTXHPLDPLRFiUGLFDGLIHUHQWHVDOFOiVL-
PXMHUHV\ORVKRPEUHV FRGHVHTXLOLEULRHQWUHODGHPDQGD\ODRIHUWDGHXMR
3HSLQH \ FRO HVWXGLDURQ  SDFLHQWHV DPEX- debido a la estenosis de un vaso coronario grande. Los
latorios con angina crnica estable y enfermedad HSLVRGLRVGHGRORUGHSHFKRGHODVPXMHUHVSXHGHQQR
DUWHULDO FRURQDULD GRFXPHQWDGD DQJLRJUjFDPHQWH HVWDUFODUDPHQWHUHODFLRQDGRVFRQHOHMHUFLFLR\DGH-
HUDQPXMHUHV /DDQJLQDFRQODDFWLYLGDGIt- ms pueden referir sntomas durante el esfuerzo que
VLFDHVWXYRSUHVHQWHHQHOGHHVWRVSDFLHQWHV no sean angina tpica. Por otra parte es menos probable
VLQGLIHUHQFLDVVLJQLFDWLYDVHQWUHKRPEUHV\PXMH- TXHVHDFRPSDxHQGHHVWHQRVLVVLJQLFDWLYDVGHODVDU-
UHV>@(QRWUDFRKRUWHGHSDFLHQWHVFRQHVWHQRVLV terias coronarias. Todas estas circunstancias diferen-
DUWHULDOFRURQDULD.LPEOH\FRO>@LQIRUPDURQOL- FLDOHVTXHSUHVHQWDQODVPXMHUHVHQFRPSDUDFLyQFRQ
mitacin fsica similar relacionada con la angina de los varones, no deberan inducir al mdico a descartar
SHFKRHQODVPXMHUHV\HQORVKRPEUHVSRU6HDWWOH por completo la isquemia miocrdica.
$QJLQD 4XHVWLRQQDLUH 6$4  3RU RWUR ODGR VLQ &RPR VH UHVXPH HQ ODV JXtDV 1,&(  VREUH
embargo, si se tiene en cuenta a todos los pacientes GRORU HQ HO SHFKR >@ HQ UHIHUHQFLD D ODV SRVLEOHV
TXHVHTXHMDQGHVtQWRPDVGHDQJLQD LQGHSHQGLHQ- diferencias de gnero en los sntomas: los factores
WHPHQWHGHODDQDWRPtDFRURQDULD KD\XQDPD\RUtD de riesgo cardiovascular son al menos tan importan-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

WHVHQODVPXMHUHVFRPRHQORVKRPEUHVVLQRPiV Un Consenso de la American Heart Assoccia-


>HV GHFLU HQ FRPSDUDFLyQ FRQ ORV VtQWRPDV@ HQ OD tion indica que la precisin diagnstica y pronstica
GHWHUPLQDFLyQGHODSUREDELOLGDGGHTXHODVPXMHUHV GHODSUXHEDGHHVIXHU]R(&*HQPXMHUHVVLQWRPiWLFDV
sufran eventos coronarios. con sospecha de cardiopata isquemica se puede me-
MRUDUPHGLDQWHODLQFOXVLyQGHSDUiPHWURVDGLFLRQDOHV
EVALUACIN INAPROPIADA SRUHMHPSORODFDSDFLGDGIXQFLRQDORODVSXQWXDFLR-
Segn el teorema de Bayes, el valor predictivo de QHVGHULHVJRHUJRPpWULFR SDUDODLQWHUSUHWDFLyQGHOD
una prueba diagnstica depende de la prevalencia de UHVSXHVWDGHOVHJPHQWR67DOHMHUFLFLR>@
la enfermedad en la poblacin analizada, y de la sen-
VLELOLGDG\HVSHFLFLGDGGHODSUXHEDHQVt/RVPp- EL TRATAMIENTO DE LA ANGINA DE PECHO
todos no invasivos utilizados actualmente para diag- ESTABLE EN LAS MUJERES
nosticar la EC, es decir la prueba de esfuerzo clsica, /DPD\RUFRPSOHMLGDGTXHSUHVHQWDODVLRSDWRORJtD
las imgenes de perfusin con radioistopos o el eco GHODDQJLQDGHSHFKRHQODVPXMHUHVWDPELpQSXHGH
estrs, se basan en la posibilidad de inducir y detectar conducir a una menor respuesta al tratamiento. La an-
isquemia regional. Mientras que este enfoque es til gina de pecho es tambin considerablemente sub tra-
con el propsito de revelar estenosis arteriales signi- WDGDHQODVPXMHUHV>@(QHO(XUR+HDUW6XUYH\
FDWLYDV ORFDOL]DGDV TXH OLPLWDQ HO XMR SXHGH VHU de angina estable, las terapias con antiagregantes
poco adecuado para detectar isquemia en ausencia plaquetarios y estatinas se usaron con una frecuencia
GHXQDHVWHQRVLVVLJQLFDWLYD3RUORWDQWRODPHQRU VLJQLFDWLYDPHQWHPHQRUHQODVPXMHUHVTXHHQORV
prevalencia de enfermedad coronaria obstructiva en hombres, aun cuando haba documentacin directa
ODVPXMHUHVKDFHTXHODVSUXHEDVGHGLDJQyVWLFRGLVH- GHODHQIHUPHGDGDUWHULDOFRURQDULD>@ /DVPXMHUHV
xDGDVSDUDGHWHFWDUODViUHDVIRFDOHVGHKLSRSHUIXVLyQ FRQ HQIHUPHGDG FRURQDULD FRQUPDGD HUDQ PHQRV
UHODWLYD VHDQ PHQRV VHQVLEOHV \ HVSHFtFDV HQ HVWD propensas a ser revascularizadas que los hombres, y
SREODFLyQ>@ tenan el doble de probabilidades de sufrir muerte o
Del mismo modo, la interpretacin de los resul- infarto de miocardio no fatal durante el seguimiento,
tados de una prueba de esfuerzo ECG como falso LQFOXVRGHVSXpVGHODMXVWHPXOWLYDULDGRSDUDODHGDG
SRVLWLYR FXDQGR QR KD\ HYLGHQFLD DQJLRJUiFD GH la funcin ventricular anormal, la severidad de la en-
($& VLJQLFDWLYD VH GHEH KDFHU FRQ SUHFDXFLyQ HQ IHUPHGDGDUWHULDOFRURQDULD\ODGLDEHWHV>@
PXMHUHV\DTXHSXHGHGHULYDUVHGHDOWHUDFLRQHVPL- 8QXVRPiVH[WHQVRGHSURFHGLPLHQWRVGHUHYDV-
crovasculares. cularizacin, sin embargo, puede reducir la carga de
$GHPiV OD VHQVLELOLGDG \ HVSHFLFLGDG GH OD ORV VtQWRPDV LVTXpPLFRV HQ ODV PXMHUHV VyOR KDVWD
SUXHEDGHHVIXHU]RQRHVWiQDIDYRUGHODVPXMHUHV FLHUWRSXQWR\DTXHD ODDQJLRSODVWLDFRURQDULDROD
De hecho, en un meta-anlisis de la prueba de esfuer- ciruga de revascularizacin miocrdica no erradican
]RHQODVPXMHUHVODVHQVLELOLGDG\ODHVSHFLFLGDG los sntomas en muchas de estas pacientes, ya que un
GHODGHSUHVLyQGHOVHJPHQWR67HQODVPXMHUHVVLQWR- Q~PHUR FRQVLGHUDEOH GH PXMHUHV SHUPDQHFHQ VLQWR-
PiWLFDVGHULHVJRLQWHUPHGLRHUDQVyOR\ PiWLFDVDSHVDUGHODUHYDVFXODUL]DFLyQH[LWRVD>
UHVSHFWLYDPHQWH>@ @E FRPR\DVHKDVHxDODGRODDQJLQDHQDXVHQFLD
/RV FDPELRV HOHFWURFDUGLRJUiFRV GXUDQWH HO GHHVWHQRVLVVLJQLFDWLYDVGHODVDUWHULDVFRURQDULDV
HMHUFLFLRHQODVPXMHUHVWLHQHQPHQRVSUHFLVLyQGLDJ- QDWLYDV HVGHFLUODGLVIXQFLyQPLFURYDVFXODU HVSDU-
nstica como consecuencia de las frecuentes altera- WLFXODUPHQWHIUHFXHQWHHQPXMHUHV 
ciones que presentan en el segmento ST-T de su ECG  \ODVPXMHUHVGHHVWH~OWLPRJUXSR
EDVDOHOPHQRUYROWDMHGHORVFRPSOHMRVHOHFWURFDU- con bastante frecuencia continan teniendo sntomas
GLRJUiFRV\IDFWRUHVKRUPRQDOHVWDOHVFRPRORVHV- a pesar del tratamiento con frmacos antianginosos
WUyJHQRV HQGyJHQRV HQ PXMHUHV SUHPHQRSiXVLFDV \ FOiVLFRV > @ \ F  ORV IiUPDFRV GLVSRQLEOHV DF-
WHUDSLDGHUHHPSOD]RKRUPRQDOHQPXMHUHVSRVWPH- WXDOPHQWHWLHQGHQDVHUPHQRVHFDFHVHQODVPXMH-
QRSiXVLFDV >@ +DQGEHUJ \ FRO DO DQDOL]DU ORV UHV GHELGR D OD VLRSDWRORJtD HVSHFtFD TXH SXHGH
GDWRVGHPXMHUHVSDUWLFLSDQWHVGHOHVWXGLR:R- no favorecer el tratamiento de la angina de pecho si-
PHQ DQG ,VFKHPLF 6\QGURPH (YDOXDWLRQ :,6(  guiendo el tradicional enfoque aporte vs. demanda
patrocinado por el Instituto Nacional del Corazn, >@(QHIHFWRGHDFXHUGRFRQODLGHDGHTXHODVPX-
3XOPyQ\6DQJUH 1+/%, GHORV((88PRVWUDURQ MHUHV FRQ DQJLQD GH SHFKR WLHQGHQ D WHQHU VtQWRPDV
TXHODVPXMHUHVFRQUHGXFFLyQGHODUHVHUYDGHXMR menos vinculados con el grado de actividad fsica
coronario tenan ms probabilidades de sufrir reduc- >@ODSUXHEDGHHVIXHU]RHQODPXMHUHVXQLQ-
FLzQGHVXFDSDFLGDGIXQFLRQDO>@ GLFDGRUPHQRVVHQVLEOHGHODHFDFLDGHOWUDWDPLHQWR


CAPTULO 10 Angina de pecho en la mujer

de la angina que la frecuencia de episodios anginosas &XULRVDPHQWHVHKDREVHUYDGRPHMRUtDGHGLYHU-


RHOFRQVXPRGHQLWURJOLFHULQD>@ VRVSDUiPHWURVGHODWROHUDQFLDDOHMHUFLFLRHQSDFLHQ-
La respuesta al tratamiento mdico puede ser di- tes con angina microvascular a travs de un enfoque
IHUHQWHHQODVPXMHUHVHQFRPSDUDFLyQFRQORVKRP- VXVWDQFLDOPHQWHGLIHUHQWHDVDEHUWUDWDUGHLQXLUHQ
EUHV SRUTXH SXHGH KDEHU GLIHUHQFLDV VLRSDWRORJL- la funcin de la microcirculacin, ya sea a travs de la
FDVHVSHFtFDVGHJpQHUR>@\GLIHUHQFLDVHQOD SRWHQFLDFLyQGHODDGHQRVLQDHQGyJHQDSRUDPLQROL-
actividad de las enzimas que metabolizan las drogas QD>@RVHFXQGDULDDXQDXPHQWRHQODDFWLYLGDG
>@3RUHMHPSORVHGHPRVWUyXQHIHFWRWHUDSpXWLFR GHy[LGRQtWULFRFRQLQKLELGRUHVGHODHQ]LPDFRQYHU-
VLJQLFDWLYDPHQWHPHQRUHQHOWUDWDPLHQWRGHODDQ- WLGRUDGHODDQJLRWHQVLQD ,(&$ >@RHVWDWLQDV
JLQDGHSHFKRLQGXFLGDSRUHOHVWUpVHQPXMHUHVFRQ >@6LQHPEDUJRQLQJXQRGHHVWRVHVWXGLRVIXH
enfermedad arterial coronaria tratadas con metopro- ms all de la etapa de comprobacin de la hipte-
OROHQFRPSDUDFLyQFRQORVKRPEUHV>@DSHVDUGHO VLVFRQVyORXQSXxDGRGHPXMHUHVWUDWDGDVGXUDQWH
hecho de que se consiguieron mayores concentracio- unas semanas. Recientemente, en las Guas del NICE
QHVSODVPiWLFDVGHGLFKDGURJDHQODVPXMHUHV>@ sobre angina estable se revisaron los estudios de inter-
YHQFLyQVREUHHOVtQGURPH;FDUGtDFR>@
FRMACOS ANTIANGINOSOS CLSICOS $UPDQTXHVyORVHGLVSRQHGHUHVXOWDGRVOLPL-
Una importante limitacin para la interpretacin de tados en perodos cortos de tiempo y la evidencia no
ORVHIHFWRVGHODVGURJDVDQWLDQJLQRVDVHQODVPXMHUHV apoya el uso de frmacos antianginosos convencio-
HVVXHVFDVDUHSUHVHQWDFLyQWDQWRHQSHTXHxRVHVWX- QDOHVSDUDHOEHQHFLRDODUJRSOD]R>@\FRQFOX\HQ
dios como los grandes ensayos clnicos randomizados que el tratamiento farmacolgico de la angina estable
VREUHDQJLQDGHSHFKRHVWDEOH>@SRUORTXHORV en pacientes que ya reciben tratamiento se debe con-
datos sobre las diferencias de gnero sobre el efecto WLQXDUVyORVLVHSHUFLEHPHMRUtDGHORVVtQWRPDV>@
GH ODV GURJDV DQWLLVTXpPLFDV VRQ LQVXFLHQWHV 8Q
PHWDDQiOLVLVGHHVWXGLRVVREUHHOWUDWDPLHQWRGH FRMACOS ANTIANGINOSOS MS NOVEDOSOS
la angina de pecho estable, con medicamentos anti- La ranolazina es una nueva molcula aprobado en
DQJLQRVRV FOiVLFRV EHWDEORTXHDQWHV DQWDJRQLVWDV los EE.UU. y Europa para el tratamiento de la angina
GHOFDOFLR\QLWUDWRV PXHVWUDTXHPHQRVGHOGH HVWDEOH>@$GLIHUHQFLDGHFOiVLFRVIiUPDFRVDQWL-
ORVSDFLHQWHVUHFOXWDGRVHUDQPXMHUHV>@(OSDQR- anginosos, muestra efectos anti isqumicos a concen-
rama se vuelve an ms confuso cuando la isquemia, traciones que tienen un efecto despreciable sobre la
aunque documentada por dolor en el pecho y depre- frecuencia cardaca, la presin arterial, o el consumo
sin del segmento ST durante la prueba de esfuerzo, GH2>@'XUDQWHODLVTXHPLDKD\XQDHOHYDFLyQ
QRVHDFRPSDxDGHHYLGHQFLDGHHQIHUPHGDGFRURQD- de la concentracin intracelular de Na en los mioci-
ria obstructiva en la angiografa. WRV>@VHFXQGDULDDXQDXPHQWRGHODFRUULHQWH
Lamentablemente, los estudios de intervencin WDUGtD GH HQWUDGD GH VRGLR > @ (VWD FRQGLFLyQ
con frmacos antianginosos en pacientes afectados induce una sobrecarga intracelular de Ca >@ OR
SRU DQJLQD PLFURYDVFXODU TXH VH UHVXPHQ HQ OD TXHDVXYH]DXPHQWDODLQWHUDFFLyQGHORVODPHQWRV
7DEOD   WLHQGHQ D VHU SHTXHxRV \ GHPDVLDGR de actina / miosina interaccin y la tensin diastlica
EUHYHV SDUD HVWDEOHFHU UPHPHQWH VL HO EHQHFLR >@&RPRFRQVHFXHQFLDSRUXQODGRKD\XQDXPHQ-
observado permanece estable en el tiempo. En- WRDQRUPDOHQHOWUDEDMRFRQWUiFWLO\HQHOFRQVXPRGH
tre los clsicos frmacos antianginosos, slo los 2\SRUHORWURODGRGHFRPSUHVLyQGHODYDVFXODWX-
EORTXHDQWHVVHKDQPRVWUDGRGHIRUPDFRQVLVWHQ- ra, ambos llevando a isquemia adicional. Mediante la
WHSDUDUHGXFLUHFD]PHQWHORVHSLVRGLRVGHGRORU inhibicin de los canales de Na, ranolazina reducira
torcico durante la vida cotidiana en esta condicin la sobrecarga de Ca dependiente del Na, inducida
>@/RVDQWDJRQLVWDVGHOFDOFLRSDUHFHQWHQHU por la isquemia. De acuerdo con este mecanismo, en
poco efecto para prevenir el dolor de pecho en pa- pacientes con isquemia cardaca ranolazina provoca
FLHQWHVFRQDQJLRJUDPDVQRUPDOHV>@\ XQGHVSOD]DPLHQWRKDFLDDEDMRGHODUHODFLyQSUHVLyQ
QRORJUDQPHMRUDUODGLVPLQXFLyQGHODUHVHUYDGH volumen del ventrculo izquierdo, aumenta la tasa
XMR FRURQDULR GH VDQJUH GH HVWRV SDFLHQWHV >@ SLFRGHOOHQDGR\PHMRUDHODODUJDPLHQWRGHODVEUDV
([LVWH LQIRUPDFLyQ DQHFGyWLFD DFHUFD GH OD XWLOL- musculares parietales en las regiones isqumicas del
dad de los nitratos en algunos pacientes, pero no YHQWUtFXORL]TXLHUGR>@
HQRWURV>@+D\PX\HVFDVRVHQVD\RVUDQGRPL- 5HFLHQWHPHQWHVHOOHYyDFDERXQSHTXHxRHVWXGLR
]DGRVFRQWURODGRVFRQSODFHERVREUHODHFDFLDGH PHFDQLFLVWD GH UDQROD]LQD HQ PXMHUHV FRQ DQJLQD PL-
los nitratos. crovascular, sin enfermedad coronaria obstructiva pero


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Tabla 10.1. Estudios clnicos sobre el tratamiento de la angina microvascular.


N = nmero, M = mujeres; C= Hipercolesterolemia; IM= infarto de miocardio previo; ND= no diabtico; RFC= reserva de
ujo coronario; FC= ujo coronario; DMF= dilatacin mediada por ujo; SAQ= Seattle Angina Questionnaire.

Autor Ao N M Droga Diseo del estudio Duracin Efectos


Atenolol 100
mg/da
Cruzado, 4 semanas
Amlodipina 10 episodios de angina solo
Lanza GA[71] 1999 10 6 doble ciego, cada
mg/da con atenolol
randomizado tratamiento
MNIS 50 mg/
da
episodios de angina,
Simple ciego,
prevencin de isquemia
randomizado,
Atenolol 100 inducida por el ejercicio,
Fragasso G[72] 1997 22 16 cruzado, 10 das
mg/da mejora de los ndices
controlado contra
de llenado ventricular
placebo
derivados del Doppler
Verapamilo 40- Randomizado,
160 mg x4/da doble ciego,
Cannon episodios de angina y
1985 26 15 o Nifedipina controlado 1 mes
RO[107] duracin del ejercicio
10-30 mg x4/ contra placebo,
da ambulatorio
Diltiazem 10 Estudio
Sutsch G[73] 1995 16 7 Caso-control No efecto en el FC
mg iv agudo
Agudo: FC, desnivel
ST durante la prueba
de esfuerzo, de la
Nifedipina 10
Doble ciego, concentracin plasmtica
[108] mg sl Agudo y 4
Montorsi P 1990 18 12 controlado contra de norepinefrina.
Nifedipina 10 a semanas
placebo Luego de 4 semanas:
20 mg x4/da
mayor en el desnivel
del segmento ST en el
esfuerzo
Doble ciego, de la duracin del
Cannon Lidoazina 240 randomizado, ejercicio y del angor
1990 22 12 7 semanas
RO[109] o 360 mg/da controlado contra durante la prueba de
placebo esfuerzo, FC
Verapamilo 320 Doble ciego,
episodios isqumicos
Bugiardini mg/da randomizado, 7 das cada
1989 16 en el ECG Holter con
R170] Propranolol controlado contra tratamiento
Propranolol
120-160 mg/da placebo, cruzado
duracin del esfuerzo
[110] Estudio y no prevencin de la
Lanza GA 1994 51 22 MNIS 5 mg sl Caso-control
agudo angina durante la prueba
de esfuerzo
Nitroglycerina
3 pruebas tiempo al umbral de
[111] 0.3 mg sl
Radice M 1996 20 19 Randomizado de isquemia y angina solo
Aminolina
esfuerzo con aminolina
400 mg vo
Simple ciego, del umbral isqumico
Aminolina 6 Estudio
Yoshio[75] 1995 12 10 controlado contra y de la duracin del
mg/kg iv agudo
placebo ejercicio
Doble ciego,
Aminolina tiempo a la angina
randomizado,
Elliot PM[76] 1997 13 11 350 o 225 mg 3 semanas durante la prueba de
controlado contra
x2/da esfuerzo
placebo, cruzado

Contina en pgina siguiente


CAPTULO 10 Angina de pecho en la mujer

Doble ciego,
duracin del esfuerzo y
Enalapril 10 randomizado,
Kaski JC[78] 1994 10 7 2 semanas isquemia inducida por el
mg/da controlado contra
esfuerzo
placebo, cruzado
Doble ciego, duracin del esfuerzo,
Enalapril 20 mg randomizado, FC, vWF plasmtica,
Chen[79] 2002 20 5 8 semanas
x2/da controlado contra ADMA, NOx, relacin
placebo L-arginina/ADMA
Doble ciego,
duracin del esfuerzo y
Cilazapril 5 mg randomizado,
Nalbantgil I[80] 1998 18 15 3 semanas ST desnivel del ST durante
/da controlado contra
el esfuerzo
placebo, cruzado
Doble ciego,
No efecto sobre la
Irbesartan 150 randomizado,
[112] duracin del ejercicio y
Russel SJ 2007 28 25 mg diario 300 controlado 1 semana
los episodios de isquemia
mg/dia contra placebo, 2
en el ECG Holter
perodos de cruce
Ramipril 10
Randomizado, niveles de SOD levels,
mg/da y
Pizzi C[77] 2004 45 40 controlado contra 6 meses duracin del esfuerzo y
Atorvastatina
placebo mejora del SAQ
40 mg/da

Randomizado,
40 Simvastatina 20 12 isquemia inducida por el
Fabian E[81] 2004 15 controlado contra
C mg/da semanas esfuerzo
placebo

Simple ciego, Mejora de DMF,


[82] Pravastatina 40 randomizado, duracin del ejercicio y
Kayikcioglu 2003 40 22 3 meses
mg/dia controlado contra del tiempo a 1mm- de
placebo desnivel del ST
17-beta-
estradiol
Doble ciego, episodio de dolor
Rosano 25 parches
1996 25 controlado contra 8 semanas precordial, no efecto en la
GM[113] IM percutaneos
placebo, cruzado duracin del esfuerzo
100
micrograms/dia
Doble ciego,
L-arginine 3g randomizado, sntomas, FC,
Lerman[114] 1998 26 13 6 meses
x3/dia controlado contra endotelina
placebo
No efecto en la angina,
Doble ciego,
[115] Doxazosina 1- 10 duracin del esfuerzo o
Botker HE 1998 16 14 controlado contra
4 mg/da semanas isquemia inducida por el
placebo, cruzado
esfuerzo
Mejora en la funcin
microvascular endotelio-
Doble ciego,
dependiente en el
[30] 33 Metformina randomizado,
Jadhav S 2006 33 8 semanas antebrazo, mximo
ND 500 mg x2/da controlado contra
desnivel del segmento
placebo
ST, escore de Duke e
incidencia de angina


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

con evidencia de isquemia demostrada por anormalida- PHQWDGDLYDEUDGLQDPRVWUyXQDUHGXFFLyQVLJQLFDWLYD


des de perfusin en imgenes cardiacas con resonancia HQODIUHFXHQFLDFDUGtDFDFRPRVHHVSHUDED\XQDPHMR-
PDJQpWLFD\HVWUpVIDUPDFROyJLFRFRQDGHQRVLQD   UtDHQODSUXHEDGHHVIXHU]R>@(OPHGLFDPHQWR
(Q FRPSDUDFLyQ FRQ SODFHER ODV PXMHUHV HQ OD UDPD UHVXOWy QR LQIHULRU DO$WHQRORO \ FRQULy XQ EHQHFLR
UDQROD]LQDPRVWUDURQXQPHMRUtQGLFHHQHO6HDWWOH$Q- DGLFLRQDOFXDQGRVHDxDGLyDORVEHWDEORTXHDQWHV>
JLQD4XHVWLRQDLUHODFDSDFLGDGIXQFLRQDO S   @$GHPiVLYDEUDGLQDPRVWUyXQDHFDFLDFRPSDUD-
ODHVWDELOLGDGFOtQLFDGHODDQJLQDGHSHFKR S   EOHD$PORGLSLQDHQODPHMRUDGHODWROHUDQFLDDOHMHUFLFLR
\ODFDOLGDGGHYLGD S  &XULRVDPHQWHHQODV con un efecto superior en la reduccin del doble producto
PXMHUHVFRQPHQRUFRHFLHQWHGHSHUIXVLyQPLFURYDV- IUHFXHQFLDFDUGtDFDSUHVLyQVLVWyOLFD XQPDUFDGRUVXUUR-
FXODUUDQROD]LQDPHMRURVLJQLFDWLYDPHQWHHOuQGLFHGH JDQWHGHOFRQVXPRGHR[tJHQRGHOPLRFDUGLR >@/D-
la reserva de perfusin miocrdica. Ranolazina se ha PHQWDEOHPHQWHODSUHVHQFLDGHODVPXMHUHVHQHVWRVHQ-
SUREDGRHQXQWRWDOGHSDFLHQWHVFRQDQJLQDHVWD- VD\RVIXHEDMD  >@\QRVHOOHYyDFDER
EOHHQURODGRVHQHQVD\RVFOtQLFRVDOHDWRULRV 0$5,- un sub anlisis de subgrupos por gnero. Un gran estudio
6$&$5,6$(5,&$\5$1 >@PRVWUDQGR SURVSHFWLYR REVHUYDFLRQDO PRVWUy FODUD HFDFLD FRQ HO
HFDFLDHQODDFWLYLGDGGHODDQJLQD.DVV:HQJHU\FRO tratamiento de la angina de pecho con ivabradina en una
realizaron recientemente una comparacin entre ambos poblacin de pacientes no tratados con beta-bloqueantes
JpQHURVGHODHFDFLD\ODVHJXULGDGGHUDQROD]LQDHQ GHELGRDFRQWUDLQGLFDFLRQHVRLQWROHUDQFLD>@'HORV
SDFLHQWHVFRQDQJLQDHVWDEOH$PERVVH[RVWHQtDQXQD HOHUDQPXMHUHV\SRUORWDQWRORVUHVXOWDGRV
similar distribucin en el tratamiento concomitante con SRGUtDQVHUWUDVODGDGRVDXQDSREODFLyQIHPHQLQD>@
,(&$\EORTXHDQWHV\HVWDWLQDV(QHVWHHVWXGLRVH 6LQHPEDUJRGHELGRDVXGLVHxRDELHUWR\ODDXVHQFLDGH
REVHUYyTXHUDQROD]LQDSURYRFyPHQRUPHMRUtDHQODV un grupo controlado con placebo, estos datos no pueden
PXMHUHVTXHHQORVYDURQHVUHVSHFWRDODWROHUDQFLDDO VHUGHQLWLYRV
HMHUFLFLR SHUR XQD VLPLODU UHGXFFLyQ GH OD IUHFXHQFLD
de la angina y el consumo de nitroglicerina en ambos CONCLUSIONES
VH[RV  /RVSDFLHQWHVTXHFRPSOHWDURQORVHQVD\RV La cardiopata isquemica es la principal causa de
0$5,6$R&$5,6$IXHURQLQFOXLGRVHQODH[SHULHQ- PXHUWHHQPXMHUHV\HQJUDQPHGLGDHOODQRHVUH-
FLD5DQROD]LQH2SHQ/DEHO([SHULHQFH 52/( >@ FRQRFLGD\WUDWDGD([LVWHQHYLGHQFLDVDFHUFDGHGL-
en la que se evalu la seguridad de ranolazina. En el IHUHQFLDVHQODSUHVHQWDFLyQ\ODVLRSDWRORJtDGHOD
HQVD\R0(5/,17,0,VHLQYHVWLJyODHFDFLD\OD DQJLQDGHSHFKRHQODVPXMHUHV(VQHFHVDULRGLVHxDU
seguridad de la ranolazina en el tratamiento prolongado estrategias teraputicas adecuadas y apropiadamen-
de pacientes con sndrome coronario agudo sin eleva- te evaluadas, ya que se carece de datos slidos para
FLyQ GHO VHJPHQWR 67 >@ /DV PXMHUHV HVWDEDQ PiV HVWDEOHFHUODHFDFLDGHORVIiUPDFRVDQWLDQJLQRVRV
representados que en otros estudios, constituyendo el comparativamente entre los gneros. De igual o ma-
GHODSREODFLyQGHHVWXGLR Q  >@8QD \RULPSRUWDQFLDHOPDQHMRGHODHQIHUPHGDGFDUGtDFD
YH]PiVODVPXMHUHVHUDQPHQRVSURSHQVDVDWHQHUHQ- LVTXpPLFDHQODVPXMHUHVGHEHFDPELDUFRQHOQGH
IHUPHGDGVLJQLFDWLYDGHODVDUWHULDVFRURQDULDVHSLFiU- LGHQWLFDUSDFLHQWHVFRQDOWRULHVJRGHHYHQWRVFDU-
dicas. Curiosamente, la incidencia de angina progresiva diovasculares, en lugar de pacientes con enfermedad
QRIXHGLIHUHQWHHQWUHODVPXMHUHVFRQ\VLQHQIHUPHGDG FRURQDULDREVWUXFWLYD(QHVWHFRQWH[WRODVPXMHUHV
REVWUXFWLYDHSLFiUGLFD/DVPXMHUHVWUDWDGDVFRQUDQR- postmenopusicas con angina de pecho son un grupo
lazina reportaron menos angina y requirieron menos de pacientes en los que es conveniente concentrar los
LQWHQVLFDFLyQGHOWUDWDPLHQWRFRQRWURVIiUPDFRVDQWL HVIXHU]RVGHVWLQDGRVDUHGXFLUODPRUELOLGDG\PHMR-
isqumicos durante el seguimiento. rar la calidad de vida. Esto se puede considerar una
Ivabradina es un inhibidor de la corriente If en el gran necesidad no satisfecha en trminos de la tera-
ndulo sinusal y como tal capaz de reducir la frecuencia pia cardiovascular en la actualidad. El enfoque ac-
FDUGLDFDSDUWLFXODUPHQWHGXUDQWHHOHMHUFLFLRVLQHIHFWRV tual de los ensayos randomizados y guas clnicas de
SHUMXGLFLDOHV VREUH OD FRQWUDFWLOLGDG >@ (Q HQVD\RV angina en los pacientes varones ignora la importante
clnicos en pacientes con angina de esfuerzo y EC docu- FDUJDGHHVWDHQIHUPHGDGHQODVPXMHUHV


CAPTULO 10 Angina de pecho en la mujer

BIBLIOGRAFA
1. 5RVDPRQG:)OHJDO.)ULGD\*HWDO+HDUWGLVHDVHDQGVWURNHVWDWLVWLFVXSGDWHDUHSRUWIURPWKH$PHULFDQ
+HDUW$VVRFLDWLRQ6WDWLVWLFV&RPPLWWHHDQG6WURNH6WDWLVWLFV6XEFRPPLWWHH&LUFXODWLRQH
 3HWHUVRQ6395D\QHU0/XHQJR)HUQDQGH]5HWDO(XURSHDQ&DUGLRYDVFXODU'LVHDVH6WDWLVWLFVHQGHG/RQGRQ
%ULWLVK+HDUW)RXQGDWLRQ
 Hemingway H, Langenberg C, Damant J, et al. Prevalence of angina in women versus men: a systematic review and
PHWDDQDO\VLVRILQWHUQDWLRQDOYDULDWLRQVDFURVVFRXQWULHV&LUFXODWLRQ
 Bairey Merz CN, Shaw LJ, Reis SE, et al. Insights from the NHLBI-Sponsored Womens Ischemia Syndrome
(YDOXDWLRQ :,6( 6WXG\3DUW,,JHQGHUGLIIHUHQFHVLQSUHVHQWDWLRQGLDJQRVLVDQGRXWFRPHZLWKUHJDUGWRJHQGHU
based pathophysiology of atherosclerosis and macrovascular and microvascular coronary disease. J Am Coll Cardiol
6
 Shaw LJ, Bairey Merz CN, Pepine CJ, et al. Insights from the NHLBI-Sponsored Womens Ischemia Syndrome
(YDOXDWLRQ :,6( 6WXG\3DUW,JHQGHUGLIIHUHQFHVLQWUDGLWLRQDODQGQRYHOULVNIDFWRUVV\PSWRPHYDOXDWLRQDQG
JHQGHURSWLPL]HGGLDJQRVWLFVWUDWHJLHV-$P&ROO&DUGLRO66
 6KDUDI %/ 3HSLQH &- .HUHQVN\ 5$ HW DO 'HWDLOHG DQJLRJUDSKLF DQDO\VLV RI ZRPHQ ZLWK VXVSHFWHG LVFKHPLF
FKHVWSDLQ SLORWSKDVHGDWDIURPWKH1+/%,VSRQVRUHG:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ>:,6(@6WXG\
$QJLRJUDSKLF&RUH/DERUDWRU\ $P-&DUGLRO$
7. /LNRII:6HJDO%/.DVSDULDQ+3DUDGR[RIQRUPDOVHOHFWLYHFRURQDU\DUWHULRJUDPVLQSDWLHQWVFRQVLGHUHGWRKDYH
XQPLVWDNDEOHFRURQDU\KHDUWGLVHDVH1(QJO-0HG
 Shaw LJ, Shaw RE, Merz CN, et al. Impact of ethnicity and gender differences on angiographic coronary artery
disease prevalence and in-hospital mortality in the American College of Cardiology-National Cardiovascular Data
5HJLVWU\&LUFXODWLRQ
9. Shaw LJ, Merz CN, Pepine CJ, et al. The economic burden of angina in women with suspected ischemic heart
disease: results from the National Institutes of Health--National Heart, Lung, and Blood Institute--sponsored
:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ&LUFXODWLRQ
 Ong P, Athanasiadis A, Borgulya G, et al. High Prevalence of a Pathological Response to Acetylcholine Testing in
3DWLHQWV:LWK6WDEOH$QJLQD3HFWRULVDQG8QREVWUXFWHG&RURQDU\$UWHULHV7KH$&29$6WXG\ $EQRUPDO&2URQDU\
9$VRPRWLRQLQSDWLHQWVZLWKVWDEOHDQJLQDDQGXQREVWUXFWHGFRURQDU\DUWHULHV -$P&ROO&DUGLRO
11. Jespersen L, Hvelplund A, Abildstrom SZ, et al. Stable angina pectoris with no obstructive coronary artery disease is
DVVRFLDWHGZLWKLQFUHDVHGULVNVRIPDMRUDGYHUVHFDUGLRYDVFXODUHYHQWV(XU+HDUW-
 3HSLQH&-.HUHQVN\5$/DPEHUW&5HWDO6RPHWKRXJKWVRQWKHYDVFXORSDWK\RIZRPHQZLWKLVFKHPLFKHDUW
GLVHDVH-$P&ROO&DUGLRO6
 6KHLIHU 6( &DQRV 05 :HLQIXUW .3  HW DO 6H[ GLIIHUHQFHV LQ FRURQDU\ DUWHU\ VL]H DVVHVVHG E\ LQWUDYDVFXODU
XOWUDVRXQG$P+HDUW-
 'H %UX\QH % +HUVEDFK ) 3LMOV 1+ HW DO $EQRUPDO HSLFDUGLDO FRURQDU\ UHVLVWDQFH LQ SDWLHQWV ZLWK GLIIXVH
DWKHURVFOHURVLVEXW1RUPDOFRURQDU\DQJLRJUDSK\&LUFXODWLRQ
 =XFKL&7ULWWR,$PEURVLR*$QJLQDGHSHFKRHQODVPXMHUHV(QIRTXHVREUHODHQIHUPHGDGPLFURYDVFXODU,QW-
&DUGLRO
 .DVNL-&5RVDQR*0&ROOLQVHWDO&DUGLDFV\QGURPH;FOLQLFDOFKDUDFWHULVWLFVDQGOHIWYHQWULFXODUIXQFWLRQ/RQJ
WHUPIROORZXSVWXG\-$P&ROO&DUGLRO
17. Mohri M, Koyanagi M, Egashira K, et al. Angina pectoris caused by coronary microvascular spasm. Lancet

 1XJHQW/0HKWD3.%DLUH\0HU]&1*HQGHUDQGPLFURYDVFXODUDQJLQD-7KURPE7KURPERO\VLV
19. Lanza GA, Crea F. Primary coronary microvascular dysfunction: clinical presentation, pathophysiology, and
PDQDJHPHQW&LUFXODWLRQ
 9DFFDULQR9%DGLPRQ/&RUWL5HWDO,VFKDHPLFKHDUWGLVHDVHLQZRPHQDUHWKHUHVH[GLIIHUHQFHVLQSDWKRSK\VLRORJ\
DQGULVNIDFWRUV"3RVLWLRQ3DSHUIURPWKH:RUNLQJ*URXSRQ&RURQDU\3DWKRSK\VLRORJ\DQG0LFURFLUFXODWLRQRIWKH
(XURSHDQ6RFLHW\RI&DUGLRORJ\&DUGLRYDVF5HV
 9HUPHOWIRRUW,$5DLMPDNHUV3*5LSKDJHQ,,HWDO'HQLWLRQVDQGLQFLGHQFHRIFDUGLDFV\QGURPH;UHYLHZDQG
DQDO\VLVRIFOLQLFDOGDWD&OLQ5HV&DUGLRO
 Zeiher AM, Krause T, Schachinger V, et al. Impaired endothelium-dependent vasodilation of coronary resistance
YHVVHOVLVDVVRFLDWHGZLWKH[HUFLVHLQGXFHGP\RFDUGLDOLVFKHPLD&LUFXODWLRQ
 Chauhan A, Mullins PA, Taylor G, et al. Both endothelium-dependent and endothelium-independent function is
LPSDLUHGLQSDWLHQWVZLWKDQJLQDSHFWRULVDQGQRUPDOFRURQDU\DQJLRJUDPV(XU+HDUW-
 (JDVKLUD . ,QRX 7 +LURRND < HW DO (YLGHQFH RI LPSDLUHG HQGRWKHOLXPGHSHQGHQW FRURQDU\ YDVRGLODWDWLRQ LQ
SDWLHQWVZLWKDQJLQDSHFWRULVDQGQRUPDOFRURQDU\DQJLRJUDPV1(QJO-0HG
 5LJR)3UDWDOL/3DOLQNDV$HWDO&RURQDU\RZUHVHUYHDQGEUDFKLDODUWHU\UHDFWLYLW\LQSDWLHQWVZLWKFKHVWSDLQ
DQGIDOVHSRVLWLYHH[HUFLVHLQGXFHG67VHJPHQWGHSUHVVLRQ$P-&DUGLRO


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 2SKHUN'0DOO*=HEH+HWDO5HGXFWLRQRIFRURQDU\UHVHUYHDPHFKDQLVPIRUDQJLQDSHFWRULVLQSDWLHQWVZLWK
DUWHULDOK\SHUWHQVLRQDQGQRUPDOFRURQDU\DUWHULHV&LUFXODWLRQ
 5HLV6(+ROXENRY5&RQUDG6PLWK$-HWDO&RURQDU\PLFURYDVFXODUG\VIXQFWLRQLVKLJKO\SUHYDOHQWLQZRPHQ
with chest pain in the absence of coronary artery disease: results from the NHLBI WISE study. Am Heart J

 5HLV 6( +ROXENRY 5 /HH -6 HW DO &RURQDU\ RZ YHORFLW\ UHVSRQVH WR DGHQRVLQH FKDUDFWHUL]HV FRURQDU\
microvascular function in women with chest pain and no obstructive coronary disease. Results from the pilot phase
RIWKH:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ :,6( VWXG\-$P&ROO&DUGLRO
 Camici PG, Marraccini P, Lorenzoni R, et al. Coronary hemodynamics and myocardial metabolism in patients with
V\QGURPH;UHVSRQVHWRSDFLQJVWUHVV-$P&ROO&DUGLRO
 -DGKDY6)HUUHOO:*UHHU,$HWDO(IIHFWVRIPHWIRUPLQRQPLFURYDVFXODUIXQFWLRQDQGH[HUFLVHWROHUDQFHLQZRPHQ
with angina and normal coronary arteries: a randomized, double-blind, placebo-controlled study. J Am Coll Cardiol

 %XFKWKDO6'GHQ+ROODQGHU-$0HU]&1HWDO$EQRUPDOP\RFDUGLDOSKRVSKRUXVQXFOHDUPDJQHWLFUHVRQDQFH
VSHFWURVFRS\LQZRPHQZLWKFKHVWSDLQEXWQRUPDOFRURQDU\DQJLRJUDPV1(QJO-0HG
 Johnson BD, Shaw LJ, Buchthal SD, et al. Prognosis in women with myocardial ischemia in the absence of obstructive
coronary disease: results from the National Institutes of Health-National Heart, Lung, and Blood Institute-Sponsored
:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ :,6( &LUFXODWLRQ
 Pries AR, Habazettl H, Ambrosio G, al. A review of methods for assessment of coronary microvascular disease in
ERWKFOLQLFDODQGH[SHULPHQWDOVHWWLQJV&DUGLRYDVF5HV
 Daly C, Clemens F, Lopez Sendon JL, et al. Gender differences in the management and clinical outcome of stable
DQJLQD&LUFXODWLRQ
 3DVWHUQDN5&$EUDPV-*UHHQODQG3HWDOWK%HWKHVGD&RQIHUHQFH7DVNIRUFH,GHQWLFDWLRQRIFRURQDU\
KHDUWGLVHDVHULVNLVWKHUHDGHWHFWLRQJDS"-$P&ROO&DUGLRO
 5LGNHU30%XULQJ-(5LIDL1HWDO'HYHORSPHQWDQGYDOLGDWLRQRILPSURYHGDOJRULWKPVIRUWKHDVVHVVPHQWRI
JOREDOFDUGLRYDVFXODUULVNLQZRPHQWKH5H\QROGV5LVN6FRUH-$0$
 $QJHOL )$QJHOL ($PEURVLR * HW DO 1HXWURSKLO FRXQW IRU WKH LGHQWLFDWLRQ RI SRVWPHQRSDXVDO K\SHUWHQVLYH
ZRPHQDWLQFUHDVHGFDUGLRYDVFXODUULVN2EVWHW*\QHFRO
 1+61DWLRQDO ,QVWLWXWH IRU KHDOWK DQG &OLQLFDO ([FHOOHQFH 1DWLRQDO &OLQLFDO *XLGHOLQH &HQWUH 0DQDJHPHQW RI
VWDEOHDQJLQDZZZQLFHRUJXNJXLGDQFH&*
 =DPDQ 0- -XQJKDQV & 6HNKUL 1 HW DO 3UHVHQWDWLRQ RI VWDEOH DQJLQD SHFWRULV DPRQJ ZRPHQ DQG 6RXWK$VLDQ
SHRSOH&0$-
 3HSLQH&-$EUDPV-0DUNV5*HWDO&KDUDFWHULVWLFVRIDFRQWHPSRUDU\SRSXODWLRQZLWKDQJLQDSHFWRULV7,'(6
,QYHVWLJDWRUV$P-&DUGLRO
 Kimble LP, McGuire DB, Dunbar SB, et al. Gender differences in pain characteristics of chronic stable angina and
SHUFHLYHGSK\VLFDOOLPLWDWLRQLQSDWLHQWVZLWKFRURQDU\DUWHU\GLVHDVH3DLQ
 6KHSV'6.DXIPDQQ3*6KHIHOG'HWDO6H[GLIIHUHQFHVLQFKHVWSDLQLQSDWLHQWVZLWKGRFXPHQWHGFRURQDU\
DUWHU\GLVHDVHDQGH[HUFLVHLQGXFHGLVFKHPLD5HVXOWVIURPWKH3,0,VWXG\$P+HDUW-
 1+61DWLRQDO,QVWLWXWHIRUKHDOWKDQG&OLQLFDO([FHOOHQFH1DWLRQDO&OLQLFDO*XLGHOLQH&HQWUH&KHVWSDLQRIUHFHQW
RQVHWZZZQLFHRUJXNJXLGDQFH&*
 .ZRN<.LP&*UDG\'HWDO0HWDDQDO\VLVRIH[HUFLVHWHVWLQJWRGHWHFWFRURQDU\DUWHU\GLVHDVHLQZRPHQ$P-
&DUGLRO
 Morise AP, Dalal JN, Duval RD. Value of a simple measure of estrogen status for improving the diagnosis of coronary
DUWHU\GLVHDVHLQZRPHQ$P-0HG
 +ODWN\0$3U\RU'%+DUUHOO)(-UHWDO)DFWRUVDIIHFWLQJVHQVLWLYLW\DQGVSHFLFLW\RIH[HUFLVHHOHFWURFDUGLRJUDSK\
0XOWLYDULDEOHDQDO\VLV$P-0HG
 *XLWHUDV3&KDLWPDQ%5:DWHUV''HWDO'LDJQRVWLFDFFXUDF\RIH[HUFLVH(&*OHDGV\VWHPVLQFOLQLFDOVXEVHWV
RIZRPHQ&LUFXODWLRQ
 %DUROVN\60*LOEHUW&$)DUXTXL$HWDO'LIIHUHQFHVLQHOHFWURFDUGLRJUDSKLFUHVSRQVHWRH[HUFLVHRIZRPHQDQG
PHQDQRQ%D\HVLDQIDFWRU&LUFXODWLRQ
 Mieres JH, Shaw LJ, Arai A, et al. Role of noninvasive testing in the clinical evaluation of women with suspected
coronary artery disease: Consensus statement from the Cardiac Imaging Committee, Council on Clinical Cardiology,
and the Cardiovascular Imaging and Intervention Committee, Council on Cardiovascular Radiology and Intervention,
$PHULFDQ+HDUW$VVRFLDWLRQ&LUFXODWLRQ
 Handberg E, Johnson BD, Arant CB, et al. Impaired coronary vascular reactivity and functional capacity in women:
UHVXOWVIURPWKH1+/%,:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ :,6( 6WXG\-$P&ROO&DUGLRO6
 /LFKWOHQ 35 %DUJKHHU . :HQ]ODII 3 /RQJWHUP SURJQRVLV RI SDWLHQWV ZLWK DQJLQDOLNH FKHVW SDLQ DQG QRUPDO
FRURQDU\DQJLRJUDSKLFQGLQJV-$P&ROO&DUGLRO
 5DGLFH0*LXGLFL90DULQHOOL*/RQJWHUPIROORZXSLQSDWLHQWVZLWKSRVLWLYHH[HUFLVHWHVWDQGDQJLRJUDSKLFDOO\
QRUPDOFRURQDU\DUWHULHV V\QGURPH; $P-&DUGLRO


CAPTULO 10 Angina de pecho en la mujer

 Johnson BD, Shaw LJ, Pepine CJ, et al. Persistent chest pain predicts cardiovascular events in women without
obstructive coronary artery disease: results from the NIH-NHLBI-sponsored Womens Ischaemia Syndrome
(YDOXDWLRQ :,6( VWXG\(XU+HDUW-
 von Mering GO, Arant CB, Wessel TR, et al. Abnormal coronary vasomotion as a prognostic indicator of
cardiovascular events in women: results from the National Heart, Lung, and Blood Institute-Sponsored Womens
,VFKHPLD6\QGURPH(YDOXDWLRQ :,6( &LUFXODWLRQ
 Pepine CJ, Anderson RD, Sharaf BL, et al. Coronary microvascular reactivity to adenosine predicts adverse outcome
in women evaluated for suspected ischemia results from the National Heart, Lung and Blood Institute WISE
:RPHQV,VFKHPLD6\QGURPH(YDOXDWLRQ VWXG\-$P&ROO&DUGLRO
 +DOFR[-36FKHQNH:+=DORV*HWDO3URJQRVWLFYDOXHRIFRURQDU\YDVFXODUHQGRWKHOLDOG\VIXQFWLRQ&LUFXODWLRQ

 6XZDLGL-$+DPDVDNL6+LJDQR67HWDO/RQJWHUPIROORZXSRISDWLHQWVZLWKPLOGFRURQDU\DUWHU\GLVHDVHDQG
HQGRWKHOLDOG\VIXQFWLRQ&LUFXODWLRQ
 %RGHQ:(25RXUNH5$7HR..HWDO2SWLPDOPHGLFDOWKHUDS\ZLWKRUZLWKRXW3&,IRUVWDEOHFRURQDU\GLVHDVH
1(QJO-0HG
 +ROXENRY5/DVNH\:.+DYLODQG$HWDO$QJLQD\HDUDIWHUSHUFXWDQHRXVFRURQDU\LQWHUYHQWLRQDUHSRUWIURP
WKH1+/%,'\QDPLF5HJLVWU\$P+HDUW-
 &XUWLV-36FKUHLQHU*:DQJ<HWDO$OOFDXVHUHDGPLVVLRQDQGUHSHDWUHYDVFXODUL]DWLRQDIWHUSHUFXWDQHRXVFRURQDU\
LQWHUYHQWLRQLQDFRKRUWRIPHGLFDUHSDWLHQWV-$P&ROO&DUGLRO
 Serruys PW, Morice MC, Kappetein AP, et al. Percutaneous coronary intervention versus coronary-artery bypass
JUDIWLQJIRUVHYHUHFRURQDU\DUWHU\GLVHDVH1(QJO-0HG
 Tritto I, Lanza GA, Rigo F, et al. Long-Term Prognosis of Patients With Cardiac Syndrome X: Data From the Italian
5HJLVWU\RI6\QGURPH; 5,6; -$P&ROO&DUGLRO$
 &RFFR*&KX'7KHDQWLLVFKHPLFHIIHFWRIPHWRSUROROLQSDWLHQWVZLWKFKURQLFDQJLQDSHFWRULVLVJHQGHUVSHFLF
&DUGLRORJ\
 Olson MB, Kelsey SF, Matthews K, et al. Symptoms, myocardial ischaemia and quality of life in women: results
IURPWKH1+/%,VSRQVRUHG:,6(6WXG\(XU+HDUW-
 Hemingway H, McCallum A, Shipley M, et al. Incidence and prognostic implications of stable angina pectoris
DPRQJZRPHQDQGPHQ-$0$
 -RFKPDQQ16WDQJO.*DUEH(HWDO)HPDOHVSHFLFDVSHFWVLQWKHSKDUPDFRWKHUDS\RIFKURQLFFDUGLRYDVFXODU
GLVHDVHV(XU+HDUW-
 /X]LHU$%.LOOLDQ$:LOWRQ-+HWDO*HQGHUUHODWHGHIIHFWVRQPHWRSUROROSKDUPDFRNLQHWLFVDQGSKDUPDFRG\QDPLFV
LQKHDOWK\YROXQWHHUV&OLQ3KDUPDFRO7KHU
 Stramba-Badiale M. Women and research on cardiovascular diseases in Europe: a report from the European Heart
+HDOWK6WUDWHJ\ (XUR+HDUW SURMHFW(XU+HDUW-G
 +HLGHQUHLFK3$0F'RQDOG.0+DVWLH7HWDO0HWDDQDO\VLVRIWULDOVFRPSDULQJEHWDEORFNHUVFDOFLXPDQWDJRQLVWV
DQGQLWUDWHVIRUVWDEOHDQJLQD-$0$
 Bugiardini R, Borghi A, Biagetti L, et al. Comparison of verapamil versus propranolol therapy in syndrome X. Am
-&DUGLRO
71. /DQ]D *$ &RORQQD * 3DVFHUL 9 HW DO$WHQRORO YHUVXV DPORGLSLQH YHUVXV LVRVRUELGHPRQRQLWUDWH RQ DQJLQDO
V\PSWRPVLQV\QGURPH;$P-&DUGLRO$
 )UDJDVVR*&KLHUFKLD6/3L]]HWWL*HWDO,PSDLUHGOHIWYHQWULFXODUOOLQJG\QDPLFVLQSDWLHQWVZLWKDQJLQDDQG
DQJLRJUDSKLFDOO\QRUPDOFRURQDU\DUWHULHVHIIHFWRIEHWDDGUHQHUJLFEORFNDGH+HDUW
 6XWVFK*2HFKVOLQ(0D\HU,HWDO(IIHFWRIGLOWLD]HPRQFRURQDU\RZUHVHUYHLQSDWLHQWVZLWKPLFURYDVFXODU
DQJLQD,QW-&DUGLRO
 0DVXPRWR$ 0RKUL 0 7DNHVKLWD$ 7KUHH\HDU IROORZXS RI WKH -DSDQHVH SDWLHQWV ZLWK PLFURYDVFXODU DQJLQD
DWWULEXWDEOHWRFRURQDU\PLFURYDVFXODUVSDVP,QW-&DUGLRO
 <RVKLR+6KLPL]X0.LWD<HWDO(IIHFWVRIVKRUWWHUPDPLQRSK\OOLQHDGPLQLVWUDWLRQRQFDUGLDFIXQFWLRQDOUHVHUYH
LQSDWLHQWVZLWKV\QGURPH;-$P&ROO&DUGLRO
 (OOLRWW30.U]\]RZVND'LFNLQVRQ.&DOYLQR5HWDO(IIHFWRIRUDODPLQRSK\OOLQHLQSDWLHQWVZLWKDQJLQDDQG
QRUPDOFRURQDU\DUWHULRJUDPV FDUGLDFV\QGURPH; +HDUW
77. 3L]]L&0DQIULQL2)RQWDQD)HWDO$QJLRWHQVLQFRQYHUWLQJHQ]\PHLQKLELWRUVDQGK\GUR[\PHWK\OJOXWDU\O
FRHQ]\PH$UHGXFWDVHLQFDUGLDF6\QGURPH;UROHRIVXSHUR[LGHGLVPXWDVHDFWLYLW\&LUFXODWLRQ
 .DVNL-&5RVDQR**DYULHOLGHV6HWDO(IIHFWVRIDQJLRWHQVLQFRQYHUWLQJHQ]\PHLQKLELWLRQRQH[HUFLVHLQGXFHG
DQJLQDDQG67VHJPHQWGHSUHVVLRQLQSDWLHQWVZLWKPLFURYDVFXODUDQJLQD-$P&ROO&DUGLRO
79. Chen JW, Hsu NW, Wu TC, et al. Long-term angiotensin-converting enzyme inhibition reduces plasma asymmetric
GLPHWK\ODUJLQLQH DQG LPSURYHV HQGRWKHOLDO QLWULF R[LGH ELRDYDLODELOLW\ DQG FRURQDU\ PLFURYDVFXODU IXQFWLRQ LQ
SDWLHQWVZLWKV\QGURPH;$P-&DUGLRO
 1DOEDQWJLO,2QGHU5$OWLQWLJ$HWDO7KHUDSHXWLFEHQHWVRIFLOD]DSULOLQSDWLHQWVZLWKV\QGURPH;&DUGLRORJ\



J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 Fabian E, Varga A, Picano E, et al. Effect of simvastatin on endothelial function in cardiac syndrome X patients. Am
-&DUGLRO
 .D\LNFLRJOX 0 3D\]LQ 6 <DYX]JLO 2 HW DO %HQHWV RI VWDWLQ WUHDWPHQW LQ FDUGLDF V\QGURPH; (XU +HDUW -

 1DVK'71DVK6'5DQROD]LQHIRUFKURQLFVWDEOHDQJLQD/DQFHW
 %HODUGLQHOOL/6KU\RFN-&)UDVHU+,QKLELWLRQRIWKHODWHVRGLXPFXUUHQWDVDSRWHQWLDOFDUGLRSURWHFWLYHSULQFLSOH
HIIHFWVRIWKHODWHVRGLXPFXUUHQWLQKLELWRUUDQROD]LQH+HDUW6XSSOLYLY
 -X<. 6DLQW '$ *DJH 3: +\SR[LD LQFUHDVHV SHUVLVWHQW VRGLXP FXUUHQW LQ UDW YHQWULFXODU P\RF\WHV - 3K\VLRO
 3W 
 8QGURYLQDV$,)OHLGHUYLVK,$0DNLHOVNL-&,QZDUGVRGLXPFXUUHQWDWUHVWLQJSRWHQWLDOVLQVLQJOHFDUGLDFP\RF\WHV
LQGXFHGE\WKHLVFKHPLFPHWDEROLWHO\VRSKRVSKDWLG\OFKROLQH&LUF5HV
 Murphy E, Perlman M, London RE, et al. Amiloride delays the ischemia-induced rise in cytosolic free calcium. Circ
5HV
 %LQJ2+.HHIH-):RON0-HWDO7HQVLRQSURORQJDWLRQGXULQJUHFRYHU\IURPP\RFDUGLDOK\SR[LD-&OLQ,QYHVW

 Hayashida W, van Eyll C, Rousseau MF, et al. Effects of ranolazine on left ventricular regional diastolic function in
SDWLHQWVZLWKLVFKHPLFKHDUWGLVHDVH&DUGLRYDVF'UXJV7KHU
 %HODUGLQHOOL/6KU\RFN-&)UDVHU+7KHPHFKDQLVPRIUDQROD]LQHDFWLRQWRUHGXFHLVFKHPLDLQGXFHGGLVWROLF
G\VIXQFWLRQ(XU+HDUW-$$
91. 0HKWD3.*R\NKPDQ37KRPVRQ/(HWDO5DQROD]LQH,PSURYHV$QJLQDLQ:RPHQ:LWK(YLGHQFHRI0\RFDUGLDO
,VFKHPLD%XW1R2EVWUXFWLYH&RURQDU\$UWHU\'LVHDVH-$P&ROO&DUGLRO,PJ
 &KDLWPDQ %5 6NHWWLQR 6/ 3DUNHU -2 HW DO $QWLLVFKHPLF HIIHFWV DQG ORQJWHUP VXUYLYDO GXULQJ UDQROD]LQH
PRQRWKHUDS\LQSDWLHQWVZLWKFKURQLFVHYHUHDQJLQD-$P&ROO&DUGLRO
 &KDLWPDQ%53HSLQH&-3DUNHU-2HWDO(IIHFWVRIUDQROD]LQHZLWKDWHQRORODPORGLSLQHRUGLOWLD]HPRQH[HUFLVH
tolerance and angina frequency in patients with severe chronic angina: a randomized controlled trial. JAMA

 6WRQH 3+ *UDWVLDQVN\ 1$ %ORNKLQ$ HW DO$QWLDQJLQDO HIFDF\ RI UDQROD]LQH ZKHQ DGGHG WR WUHDWPHQW ZLWK
DPORGLSLQHWKH(5,&$ (IFDF\RI5DQROD]LQHLQ&KURQLF$QJLQD WULDO-$P&ROO&DUGLRO
 5RXVVHDX0)3RXOHXU+&RFFR*HWDO&RPSDUDWLYHHIFDF\RIUDQROD]LQHYHUVXVDWHQROROIRUFKURQLFDQJLQD
SHFWRULV$P-&DUGLRO
 :HQJHU1.&KDLWPDQ%9HWURYHF*:*HQGHUFRPSDULVRQRIHIFDF\DQGVDIHW\RIUDQROD]LQHIRUFKURQLFDQJLQD
SHFWRULVLQIRXUUDQGRPL]HGFOLQLFDOWULDOV$P-&DUGLRO
97. Koren MJ, Crager MR, Sweeney M. Long-term safety of a novel antianginal agent in patients with severe chronic
VWDEOHDQJLQDWKH5DQROD]LQH2SHQ/DEHO([SHULHQFH 52/( -$P&ROO&DUGLRO
 0RUURZ '$ 6FLULFD %0 .DUZDWRZVND3URNRSF]XN ( HW DO (IIHFWV RI UDQROD]LQH RQ UHFXUUHQW FDUGLRYDVFXODU
HYHQWVLQSDWLHQWVZLWKQRQ67HOHYDWLRQDFXWHFRURQDU\V\QGURPHVWKH0(5/,17,0,UDQGRPL]HGWULDO-$0$

99. Mega JL, Hochman JS, Scirica BM, et al. Clinical features and outcomes of women with unstable ischemic heart
GLVHDVHREVHUYDWLRQVIURPPHWDEROLFHIFLHQF\ZLWKUDQROD]LQHIRUOHVVLVFKHPLDLQQRQ67HOHYDWLRQDFXWHFRURQDU\
V\QGURPHVWKURPERO\VLVLQP\RFDUGLDOLQIDUFWLRQ 0(5/,17,0, &LUFXODWLRQ
0DQ]05HXWHU0/DXFN*HWDO$VLQJOHLQWUDYHQRXVGRVHRILYDEUDGLQHDQRYHO, I LQKLELWRUORZHUVKHDUWUDWH
EXWGRHVQRWGHSUHVVOHIWYHQWULFXODUIXQFWLRQLQSDWLHQWVZLWKOHIWYHQWULFXODUG\VIXQFWLRQ&DUGLRORJ\

%RUHU-6)R[.-DLOORQ3HWDO$QWLDQJLQDODQGDQWLLVFKHPLFHIIHFWVRILYDEUDGLQHDQ, I LQKLELWRULQVWDEOHDQJLQD
DUDQGRPL]HGGRXEOHEOLQGPXOWLFHQWHUHGSODFHERFRQWUROOHGWULDO&LUFXODWLRQ
7DUGLI-&3RQLNRZVNL3.DKDQ7(IFDF\RIWKH, I FXUUHQWLQKLELWRULYDEUDGLQHLQSDWLHQWVZLWKFKURQLFVWDEOH
DQJLQDUHFHLYLQJEHWDEORFNHUWKHUDS\DPRQWKUDQGRPL]HGSODFHERFRQWUROOHGWULDO(XU+HDUW-
7DUGLI-&)RUG,7HQGHUD0HWDO(IFDF\RILYDEUDGLQHDQHZVHOHFWLYH, I LQKLELWRUFRPSDUHGZLWKDWHQROROLQ
SDWLHQWVZLWKFKURQLFVWDEOHDQJLQD(XU+HDUW-
5X]\OOR:7HQGHUD0)RUG,HWDO$QWLDQJLQDOHIFDF\DQGVDIHW\RILYDEUDGLQHFRPSDUHGZLWKDPORGLSLQHLQ
SDWLHQWV ZLWK VWDEOH HIIRUW DQJLQD SHFWRULV D PRQWK UDQGRPLVHG GRXEOHEOLQG PXOWLFHQWUH QRQLQIHULRULW\ WULDO
'UXJV
Koster R, Kaehler J, Meinertz T. Treatment of stable angina pectoris by ivabradine in every day practice: the
5('8&7,21VWXG\$P+HDUW-H
)R[.)RUG,6WHJ3*HWDO,YDEUDGLQHIRUSDWLHQWVZLWKVWDEOHFRURQDU\DUWHU\GLVHDVHDQGOHIWYHQWULFXODUV\VWROLF
G\VIXQFWLRQ %($87,)8/ DUDQGRPLVHGGRXEOHEOLQGSODFHERFRQWUROOHGWULDO/DQFHW
)R[.)RUG,6WHJ3*HWDO5HODWLRQVKLSEHWZHHQLYDEUDGLQHWUHDWPHQWDQGFDUGLRYDVFXODURXWFRPHVLQSDWLHQWV
with stable coronary artery disease and left ventricular systolic dysfunction with limiting angina: a subgroup analysis
RIWKHUDQGRPL]HGFRQWUROOHG%($87,)8/WULDO(XU+HDUW-
&DQQRQ52UG:DWVRQ505RVLQJ'5HWDO(IFDF\RIFDOFLXPFKDQQHOEORFNHUWKHUDS\IRUDQJLQDSHFWRULV


CAPTULO 10 Angina de pecho en la mujer

UHVXOWLQJIURPVPDOOYHVVHOFRURQDU\DUWHU\GLVHDVHDQGDEQRUPDOYDVRGLODWRUUHVHUYH$P-&DUGLRO
Montorsi P, Cozzi S, Loaldi A, et al. Acute coronary vasomotor effects of nifedipine and therapeutic correlates in
V\QGURPH;$P-&DUGLRO
&DQQRQ52UG%UXVK-(-U6FKHQNH:+HWDO%HQHFLDODQGGHWULPHQWDOHIIHFWVRIOLGRD]LQHLQPLFURYDVFXODU
DQJLQD$P-&DUGLRO
111. /DQ]D*$0DQ]ROL$%LD(HWDO$FXWHHIIHFWVRIQLWUDWHVRQH[HUFLVHWHVWLQJLQSDWLHQWVZLWKV\QGURPH;&OLQLFDO
DQGSDWKRSK\VLRORJLFDOLPSOLFDWLRQV&LUFXODWLRQ
Radice M, Giudici V, Pusineri E, et al. Different effects of acute administration of aminophylline and nitroglycerin
RQH[HUFLVHFDSDFLW\LQSDWLHQWVZLWKV\QGURPH;$P-&DUGLRO
5XVVHOO6-'L6WHIDQR(01DIIDWL07HWDO7KHHIIHFWVRIWKHDQJLRWHQVLQ,,UHFHSWRU W\SH, DQWDJRQLVWLUEHVDUWDQ
LQSDWLHQWVZLWKFDUGLDFV\QGURPH;+HDUW
Rosano GM, Peters NS, Lefroy D, et al. 17-beta-Estradiol therapy lessens angina in postmenopausal women with
V\QGURPH;-$P&ROO&DUGLRO
Lerman A, Burnett JC, Jr., Higano ST, et al. Long-term L-arginine supplementation improves small-vessel coronary
HQGRWKHOLDOIXQFWLRQLQKXPDQV&LUFXODWLRQ
%RWNHU +( 6RQQH +6 6FKPLW] 2 HW DO (IIHFWV RI GR[D]RVLQ RQ H[HUFLVHLQGXFHG DQJLQD SHFWRULV 67VHJPHQW
GHSUHVVLRQDQGLQVXOLQVHQVLWLYLW\LQSDWLHQWVZLWKV\QGURPH;$P-&DUGLRO


CAPITULO 11

ACTUALIZACIN EN SNDROMES
CORONARIOS AGUDOS
RICARDO PREZ DE LA HOZ

INTRODUCCIN Recientemente una nueva fuerza de tareas globales


 UHSUHVHQWDGDVSRU6RFLHGDG(XURSHDGH&DUGLRORJtD
El sndrome coronario agudo, desde hace tiempo (6& OD$PHULFDQ&ROOHJHRI&DUGLRORJ\)RXQGDWLRQ
comprende a la angina inestable, el infarto agudo de $&&) OD$PHULFDQ+HDUW$VVRFLDWLRQ $+$ \OD)H-
miocardio sin supradesnivel del ST y el infarto agudo GHUDFLyQ0XQGLDOGHO&RUD]yQ :+) KDQSUHVHQWDGR
de miocardio con supradesnivel del ST. Estos en su una actualizacin referida al desarrollo de marcadores
FRQMXQWRFRQWLQ~DQFRQVWLWX\HQGRXQRGHORVPD\R- ms sensibles de necrosis miocrdica y la revisin en
res problemas para la salud pblica. particular de necrosis que ocurren en el paciente crtico,
0iVDOOiGHODVFDUDFWHUtVWLFDVFRPXQHVHQOD- y despus de procedimientos de revascularizacin per-
siopatologa primaria en referencia a la complica- cutneos o a travs de ciruga de by-pass.
FLyQGHODSODFDDWHURHVFOHUyWLFD\HQHOFRQWH[WRJH- 6L ELHQ HVWRV ELRPDUFDGRUHV UHHMDQ HQ VDQJUH
QHUDOGHOWUDWDPLHQWRGLULJLGRDOFRPSOHMRWURPEyWLFR SHULIpULFR HO GDxR PLRFiUGLFR QR VRQ FDSDFHV GH
oclusivo, cada una de estas entidades se diferencia LGHQWLFDU HO PHFDQLVPR VXE\DFHQWH    &RPR HV
entre si y constituyen tres instancias diferentes de sabido muchos son los mecanismos involucrados que
una misma enfermedad. van desde la apoptosis y el reemplazo habitual de c-
Este captulo no pretende ser un nuevo tratado lulas miocrdicas hasta la liberacin celular de pro-
sobre los sndromes coronarios agudos sino, por el ductos de degradacin de la troponina, el aumento
contrario, limitarse a la actualizacin de algunas de GHODSHUPHDELOLGDGFHOXODU\QDOPHQWHODQHFURVLV
ODV QRYHGDGHV PiV UHOHYDQWHV GH ORV ~OWLPRV  DxRV GHORVPLRFDUGLRFLWRV  (VDVtTXHDWRGDQHFURVLV
con respecto a este tema. miocrdica que continua a la isquemia miocrdica se
la denomina Infarto de Miocardio.
Es decir que el trmino infarto agudo de miocar-
UNA NUEVA CLASIFICACIN UNIVERSAL GLR 0, VHGHEHXWLOL]DUVRORFXDQGRKD\HYLGHQFLD
DE INFARTO DE MIOCARDIO ESC/ACCF/ de necrosis miocrdica en un entorno clnico consis-
AHA/WHF. SU IMPACTO. VALOR DE LOS tente con infarto agudo de miocardio e isquemia.
MARCADORES /DFODVLFDFLyQSURSXHVWDLQVLVWHHQODQHFHVLGDG
(QHODxRVHSUHVHQWRODSULPHUIXHU]DGHWD- de la presencia de evidencias clnicas o imagenolgi-
UHDV VREUH OD GHQLFLyQ GH LQIDUWR GH PLRFDUGLR OR cas del infarto de miocardio a la elevacin de marca-
TXHVLJQLFyOLVD\OODQDPHQWHDFHSWDUTXHFXDOTXLHU GRUHVSDUDGHQLUORFRPRWDO 7DEOD
necrosis en el entorno de isquemia miocrdica debe ,QGHSHQGLHQWHPHQWHGHHVWDUHDOLGDGHOGDxRPLR-
VHUHWLTXHWDGRFRPR,QIDUWRGHPLRFDUGLR  crdico tambin puede ser detectado en condiciones
$xRVGHVSXpVHOFRQVHQVRGHOSXVRGHUH- clnicas en donde no est presente el mecanismo de la
lieve las distintas condiciones que puede llevar a la LVTXHPLD WDEOD 7DOHVVRQORVFDVRVGHSHTXH-
SURGXFFLyQGHXQLQIDUWRGHPLRFDUGLR  xDV QHFURVLV DVRFLDGDV D ,QVXFLHQFLD FDUGLDFD LQ-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Tabla 11.1. Denicin de infarto de miocardio ESC/ACCF/AHA/WHF

En estas condiciones, cualquiera de los siguientes criterios se encuentra con el diagnstico de MI:
1. La deteccin de un aumento y / o disminucin de los valores de los biomarcadores cardacos [preferiblemente
troponina cardiaca (cTn)] con al menos un valor por encima del percentil 99 superior lmite de referencia y
con al menos una de las siguientes:
Los sntomas de isquemia.
Nuevo o presunta nueva y signicativa del segmento ST-T de onda (ST-T) cambio o nuevo bloqueo de rama
izquierda (BRI).
Desarrollo de ondas Q patolgicas en el ECG.
Imgenes evidencia de nueva prdida de miocardio viable o movimiento de la pared regional nueva anomala
La identicacin de un trombo intracoronario por angiografa o autopsia.
Espontnea infarto de miocardio relacionado con la ruptura de placa aterosclertica, ulceracin, suras, erosin
o diseccin con trombo intraluminal resultante en una o ms de las arterias coronarias que conducen a una
disminucin del ujo sanguneo miocrdico o embolia distal de plaquetas con la consiguiente necrosis de miocitos.
El paciente puede tener subyacente grave CAD pero en ocasiones no obstructiva o no CAD.
Tipo 2: infarto de miocardio secundario a un desequilibrio isqumica
En los casos de lesiones de miocardio con necrosis en una condicin distinta de CAD contribuye a un desequilibrio
entre el suministro de oxgeno al miocardio y / o demanda, por ejemplo, disfuncin endotelial coronaria, espasmo
de la arteria coronaria, embolia coronaria, tachy-/brady-arrhythmias, anemia, insuciencia respiratoria, hipotensin,
y la hipertensin con o sin HVI.
2. Muerte cardaca con sntomas sugestivos de isquemia miocrdica y presuntos nuevos cambios isqumicos del
ECG o bloqueo de rama izquierda nuevo, pero la muerte se produjo antes de que los biomarcadores cardacos
fueran obtenidos, o los valores de biomarcadores cardacos que se obtienen son antes de producirse el
aumento
3. El infarto de miocardio relacionado a la intervencin coronaria percutnea (PCI) se dene arbitrariamente
por la elevacin de los valores de cTn > 5 por encima del percentilo 99 en pacientes con niveles normales
(valores basales d al percentil 99 ) o un aumento de los valores de cTn > 20% si los valores de referencia son
elevados y son estables o descienden . Adems, ya sea (i) sntomas sugestivos de isquemia miocrdica o (ii)
cambios isqumicos del ECG nuevos o (iii) los hallazgos angiogrcos consistentes con una complicacin
de procedimiento o (iv) la demostracin de la nueva prdida de miocardio viable o nuevo movimiento de la
pared regional anormalidad de formacin de imgenes son obligatorios.
4. El infarto de miocardio asociado a la trombosis del stent se dene cuando se detecta la misma por la
angiografa coronaria o autopsia en el contexto de isquemia de miocardio y con una variacin de valores de
biomarcadores cardacos con al menos un valor por encima del percentil 99
5. El infarto de miocardio asociado a Ciruga de revascularizacin coronaria se dene arbitrariamente por la
elevacin de los valores de biomarcadores cardacos (> 10 sobre el percentil 99) en pacientes con valores
normales de referencia cTn (d 99 percentil). Adems, debern presentar (i) las nuevas ondas Q patolgicas
o nuevo BCRI, o documentacin angiogrca (ii) de nueva oclusin del puente o de la coronaria nativa,
o prdida angiogrca de la permeabilidad de la arteria coronaria principal o una rama lateral o slowor
persistente sin ujo o embolizacin (iii) la evidencia por imgenes de nueva prdida de miocardio viable o
nuevo movimiento anormal de la pared regional.
Reproducida, modicada y traducida de (3)

Tabla 11.2. Probables mecanismos de aumento de las concentraciones de Troponina Cardaca.

Clasicacin patobiolgica de tipos de mecanismos potenciales que causan elevaciones de troponina

Tipo Ejemplos / Explicacin


Isquemia necrosis, infarto, inamacin, inltracin, trauma
Miocitos Isquemia necrosis
txicos / metablica (por ejemplo, sepsis)
Apoptosis La muerte celular programada debido a la activacin de las caspasas
Cifra de recambio anual de bajo grado habitual de los miocitos (no est
Recambio normal de miocardiocitos
claro si son detectables en la circulacin sistmica con ensayos actuales)
Liberacin celular de troponina proteoltica Creacin de fragmentos pequeos que pasan a travs de la
productos de degradacin membrana intacta de los miocitos, sin muerte celular
Aumento de la permeabilidad de la pared Lesin reversible de las membranas de los miocitos resultando en
celular permeabilidad alterada (por ejemplo, estiramiento, isquemia)
Formacin y liberacin de vesculas La secrecin activa de vesculas o expresin en la membrana (por
membrenosas ejemplo, debido a la anoxia)


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

Tabla 11.3. Elevacin de troponina por injuria miocrdica


Injuria relacionada a la Isquemia miocrdica primaria
Ruptura de la placa principal
Formacin intraluminal del trombo en la arteria coronaria
Lesiones relacionadas con el desequilibrio de la oferta / demanda de O2 con produccin de isquemia miocrdica
Tachi-/bradi-arritmias
Diseccin artica o enfermedad severa de la vlvula artica
Miocardiopata hipertrca
Shock cardiognico, hipovolmico, o sptico
Insuciencia respiratoria grave
La anemia grave
Hipertensin con o sin HVI
El espasmo coronario
Embolia coronaria o vasculitis
Disfuncin endotelial coronaria sin EAC signicativa
Lesiones no relacionadas con isquemia miocrdica
Contusin cardiaca, ciruga, ablacin, el ritmo, o descargas de desbrilacin
Rabdomilisis con afectacin cardaca
Miocarditis
Agentes cardiotxicos, por ejemplo, antraciclinas, herceptin
Dao miocrdico Multifactorial o indeterminado
Insuciencia cardaca
Miocardiopata por Estrs (Takotsubo)
Embolia pulmonar grave o hipertensin pulmonar
Sepsis y los pacientes en estado crtico
La insuciencia renal
Graves enfermedades neurolgicas agudas, por ejemplo, derrame cerebral, hemorragia subaracnoidea
Enfermedades inltrativas, por ejemplo, amiloidosis, sarcoidosis
Reproducida y traducida de (3)

VXFLHQFLDUHQDOPLRFDUGLWLVSHULFDUGLWLVDUULWPLDV UUHFWLYDVSDUDPHMRUDUORVSURWRFRORVGHVHOHFFLyQGH
o tromboembolismo pulmonar. Se incluyen tambin pacientes y pruebas, sobre todo ante la llegada de los
en este caso la posibilidad de elevacin de marca- ensayos de troponina de alta sensibilidad y nuevas
dores en procedimientos no cardiacos o incluso en HVWUDWHJLDVGHPXOWLPDUFDGRU 
procedimientos cardiovasculares en donde no hubo Indudablemente la incorporacin de marcadores
incidentes. sensibles en el diagnostico de infarto aumento la sen-
Sin embargo surge del consenso que estas necro- VLELOLGDG\ODHVSHFLFLGDGHQHOPRPHQWRGHOGLDJQyV-
sis no deben ser igualadas al concepto de infarto de tico, el incremento en el nmero total de pacientes in-
PLRFDUGLRVLELHQUHFRQRFHQODGLFXOWDGGHPDUFDU cluidos sugiere tambin la posibilidad de un sobrediag-
los lmites entre los distintos cuadros. nstico incluyendo pacientes que a pesar de presentar
As en una poblacin que abarque todo el espectro QHFURVLVPLRFiUGLFDQRVRQGHQLGDPHQWHLQIDUWR
GHO6tQGURPH&RURQDULR$JXGRODGHQLFLyQXQLYHU- El valor pronstico reconocido a la troponina,
sal de infarto de miocardio aument este diagnstico se enfrenta con la posibilidad de que valores esca-
en una cuarta parte y fue un predictor independiente VDPHQWH SRU HQFLPD GHO YDORU GH FRUWH GHQLGR QR
GHPRUWDOLGDGDORVDxRV  $GHPiVODUHYDVFX- VHDQ YHUGDGHURV LQIDUWRV H LQX\DQ HQ OD UHGXFFLyQ
larizacin miocrdica se asocia con una mortalidad JOREDOGHODPRUWDOLGDGTXHVHHQXQFLDHQORVWUDEDMRV
VLJQLFDWLYDPHQWHLQIHULRUDORVDxRV con o sin revascularizacin por catter.
La tendencia a la realizacin de pruebas con bio- En un prrafo especial dirigido a las tcnicas en
marcadores, en especial con troponina, ha mostrado LPiJHQHVODUHFLHQWHIXHU]DGHWDUHDVHVSHFLFDTXH
un aumento anual en las solicitudes de troponina sin no pretende abarcar toda la temtica sobre las mis-
un aumento correspondiente en la inclusin de pa- mas en relacin al infarto agudo de miocardio.
cientes lo que plantea la posibilidad de un uso cada Basndose en la conocida cascada isqumica que
vez ms indiscriminado en la prueba de troponina. incluye la disfuncin miocrdica, la muerte celular
Los costes acumulativos directos e indirectos de las \ODFXUDFLyQSRUEURVLV PHFDQLVPRVSRVWLVTXpPL-
SUXHEDVQRDSURSLDGDVVRQVLJQLFDWLYRV FRV VXJLHUHTXHORVSDUiPHWURVLPSRUWDQWHVGHIRU-
Esto planteara la necesidad de estrategias co- macin de imgenes de perfusin son: la viabilidad


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

de los miocitos, el espesor miocrdico, el engrosa- TRATAMIENTO PRECOZ VS DIFERIDO EN EL


miento y movimiento del mismo y los fenmenos de SNDROME CORONARIO AGUDO EN EL SCA
ODEURVLVHQODFLQpWLFDGHORVPpWRGRVSDUDPDJQp- SIN ST
WLFRV  R GH DJHQWHV GH FRQWUDVWH PHGLFLQD QXFOHDU (V XQD SROpPLFD TXH OOHYD PXFKRV DxRV \ TXH FR-
FRQWUDVWH(FRFDUGLRJUiFRHWF   PHQ]yFRQORVSULPHURVWUDEDMRVFRQDQJLRSODVWLDHQ
Las tcnicas de imgenes ms comnmente uti- el infarto no transmural o en la angina inestable, que
lizados y mencionadas en el infarto agudo y crnico WXYRXQRGHVXVSLODUHVHQHOHVWXGLR9$148,6+  
son la Ecocardiografa, ventriculografa isotpica, la \TXHHQORV~OWLPRVDxRVVHKDQSUHVHQWDGRGLVWLQWRV
JDPPDJUDItDGHSHUIXVLyQ 036 FRQHPLVLyQGHIR- estudios que tienden a poner un punto medio ade-
WyQ~QLFRODWRPRJUDItDFRPSXWDUL]DGD 63(&7 \ FXDGRVREUHODLQGLFDFLyQ\ORVEHQHFLRVGHOWUDWD-
UHVRQDQFLDPDJQpWLFD 05,  miento precoz en los Sndromes Coronarios Agudos.
Reconoce as mismo que tanto la tomografa por )LJXUDV\
HPLVLyQGHSRVLWURQHV 3(7 \ODWRPRJUDItDFRPSX- La ltima actualizacin de la fuerza de tareas en
WDUL]DGD 7& VRQPHQRVXWLOL]DGDV  6tQGURPHVFRURQDULRVDJXGRVVLQVXSUD67  SHU-
Siguiendo los postulados de esta publicacin in- PLWHGHQLUTXH8QDHVWUDWHJLDLQYDVLYDGHQWURGH
ternacional, se podra concluir que a pesar de la su- ODVDKVGHOLQJUHVRFRQFDWHWHULVPR\SRVLEOH
perposicin de varios de los mtodos enunciados en revascularizacin, es razonable en pacientes inicial-
cuanto al anlisis de la viabilidad la perfusin y la mente estabilizados pero de alto riesgo de eventos
funcin, solo las tcnicas de radioistopos proporcio- LVTXpPLFRV UHFRPHQGDFLyQ,,D 
nan una evaluacin directa de los miocitos debido a Avalando esta postura se podra mencionar al
las propiedades de los marcadores utilizados. HVWXGLR,6$5&22/ ,QWUDFRURQDU\6WHQWLQJZLWK
$QWLWKURPERWLF5HJLPHQ&RROLQJ2II   GHORV
HVWXGLRVTXHSODQWHDURQHVWDSHUVSHFWLYD $%2$5'
2005 (/,6$,6$5&22/7,0$&6 \TXHVHOOHYyD
FDERHQKRVSLWDOHVHQWUHORVDxRV\LQ-
ISAR-COOL JUHVDQGR   SDFLHQWHV  FRQ GRORU GH SHFKR LQHV-
VANQWISH ICTUS RITA-3 WDEOH\FDPELRVHOHFWURFDUGLRJUiFRVFRQGHSUHVLyQ
MATE VINO del segmento ST, o niveles elevados de troponina y
TIMI IIIB TRUCS que asignados al azar se sometieron a angiografa co-
TACTICS-
TIMI 18 URQDULDGHQWURGHODVKRUDVGHODSUHVHQWDFLyQ PH-
FRISC II GLDQDKRUDV RGHVSXpVGHDGtDV PHGLDQDGH
KRUDV GHSUHWUDWDPLHQWRDQWLWURPEyWLFR
El planteo que motivo toda una revisin con res-
Conservative Invasive
# Patients: 920 7018 pecto a la conducta a tomar se hace presente con la
2674
SXEOLFDFLyQGHOHVWXGLR,&786  HQGRQGHHQOD
Figura 11.1. Clsico esquema donde se comparan los resul- introduccin los autores planteaban claramente que
tados a favor de las diferentes terapias a considerar en los
sndromes coronarios agudos en distintos estudios de la bi-
SDUD HVH WLHPSR    ODV JXtDV DFWXDOHV UHFR-
bliografa (ao 2005) miendan una estrategia invasiva precoz en pacientes
con sndromes coronarios agudos sin elevacin del
24
segmento ST y con un elevado nivel de troponina
25
0,05 Invasiva
Conservadora
T cardaca. Sin embargo, los ensayos aleatorios no
20
ns
18,6
0,005 <0,05
han mostrado una reduccin global de la mortalidad.
14,1
Mientras que la reduccin en la tasa de infarto de
15
10,8
12,2
10,4
miocardio en los ensayos anteriores ha variado de-
10 7,2
9,3
SHQGLHQGRGHODGHQLFLyQGHLQIDUWRGHPLRFDUGLR
(OHVWXGLR,&786DVLJQyDOHDWRULDPHQWHD
5
pacientes con sndrome coronario agudo sin elevacin
0 del segmento ST que tena dolor en el pecho, un eleva-
TIMI IIIB VANQWISH FRISC II TACTICS TIMI GRQLYHOGHWURSRQLQDFDUGLDFD7 PLFURJUDPRV
18
SRU OLWUR  \ HYLGHQFLD HOHFWURFDUGLRJUiFD GH LVTXH-
1 ao 8 meses
mia en la admisin o una historia documentada de la
Figura 11.2. Puntos nales duros alejados en estudios com- HQIHUPHGDGFRURQDULDDORTXHGHQLHURQFRPRXQD
parativos entre estrategia invasiva vs. conservadora estrategia invasiva precoz o a una ms conservadora


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

VHOHFWLYDPHQWH LQYDVLYD  /RV SDFLHQWHV UHFLELHURQ SDFLHQWHVODKHSDULQDRIRQGDSDULQX[HLQKLELGRUHVGH


DVSLULQDGXUDQWHKRUDVHQR[DSDULQD\DEFL[LPDEHQ OD*3,,E,,,DHQHOGHORVSDFLHQWHV
HOPRPHQWRGHODDQJLRSODVWLD(OSXQWRQDOSULPDULR Aunque el ensayo fue inicialmente previsto
fue un compuesto de muerte, infarto de miocardio no FRQ  OD LQFRUSRUDFLyQ GH  SDFLHQWHV SDUD GH-
fatal o rehospitalizacin por sntomas de angina dentro WHFWDU XQ  UHGXFFLyQ HQ OD YDULDEOH SULQFLSDO GH
GHXQDxRGHVSXpVGHODUDQGRPL]DFLyQ PXHUWH ,0 QXHYR R $&9 D ORV  PHVHV HO FRPLWp
Este estudio conclua diciendo que no fue posible directivo decidi dar por terminado la inclusin en
demostrar que, dada la terapia mdica optimizada,  SDFLHQWHV GHELGR D SUREOHPDV GH FRQWUDWDFLyQ
una estrategia invasiva precoz era superior a una es- Los resultados del estudio TIMSCA sugieren una ma-
trategia selectiva invasiva en pacientes con sndrome \RUHFDFLDHQWUHORVSDFLHQWHVWUDWDGRVWHPSUDQDPHQWH
coronario agudo sin elevacin del segmento ST y con que en aquellos en los que se retras la intervencin en
un elevado nivel de troponina T cardaca. el marco de AI / IMSEST, aunque la reduccin en el
Posteriormente el mismo grupo del ICTUS trial y REMHWLYR SULPDULR QR DOFDQ]y VLJQLFDFLyQ HVWDGtVWLFD
otros autores evaluaron la posibilidad de que los esca- SDUD OD SREODFLyQ GHO HQVD\R JHQHUDO GHVGH HO 
VRVEHQHFLRVREWHQLGRVGXUDQWHODHYDOXDFLyQDODxR HQHOJUXSRGHLQWHUYHQFLyQWDUGtDKDVWDHOHQHO
WXYLHVHQ RWUR VLJQLFDGR HV GHFLU XQ PD\RU EHQH- EUD]RGHLQWHUYHQFLyQWHPSUDQD +5SDUDSULQFLSLRVGH
FLRHQHOVHJXLPLHQWRDODUJRSOD]R$VLSRUHMHPSOR LQWHUYHQFLyQ,&DS 
Hoenig MR\FRO  FRQFOX\HTXHHQFRPSDUDFLyQ 6LQ HPEDUJR XQ SXQWR QDO VHFXQGDULR  GHQL-
con una estrategia conservadora para AI / IMSEST, la do prospectivamente como muerte, IM o isquemia
estrategia invasiva se asocia con menores tasas de an- UHIUDFWDULD VH UHGXMR VLJQLFDWLYDPHQWH PHGLDQWH OD
gina refractaria y reingreso en el plazo ms corto y de LQWHUYHQFLyQWHPSUDQDGHODO +5
infarto de miocardio en el largo plazo. Sin embargo, ,&   D  S  SULQFLSDOPHQWH GH-
la estrategia invasiva se asocia con un riesgo doble de bido a una diferencia en la incidencia de isquemia
ataque cardaco relacionado con el procedimiento y UHIUDFWDULD YHUVXVHQHOWDUGtRYHUVXVOD
mayor riesgo de hemorragia y fugas de procedimien- rama de intervencin temprana, respectivamente, p
to de biomarcadores. Los datos disponibles sugieren   /D RFXUUHQFLD GH LVTXHPLD UHIUDFWDULD VH
que una estrategia invasiva puede ser particularmente DVRFLyFRQXQDXPHQWRGHYHFHVHOULHVJRGHLQIDUWR
til en aquellos con alto riesgo de eventos recurrentes de miocardio subsiguiente.
al igual que Hirsch A  cuando concluye de igual Cuando se analiz los resultados segn el score de
manera diciendo que luego de un largo plazo de se- ULHVJRGHO*5$&(  ODLVTXHPLDUHIUDFWDULDVHUHGX-
guimiento del ensayo ICTUS se sugiere que una es- MRHQXQSULPHUDQiOLVLVDVtFRPRORVULHVJRVGHPXHUWH
WUDWHJLDLQYDVLYDSUHFR]QRSXHGHVHUPHMRUTXHXQD infarto de miocardio y accidente cerebrovascular entre
estrategia invasiva ms selectiva como en pacientes los pacientes en el tercilo superior de riesgo isqumico.
con SCASEST y una troponina cardaca elevada y que Para evaluar si una estrategia ms agresiva de muy
la aplicacin de cualquiera de estas estrategias podra temprana intervencin, anloga a la norma de la an-
ser aceptable en estos pacientes. JLRSODVWLDSULPDULDSDUD67(0,FRQGXFLUtDDPHMRUHV
La informacin ms relevante para los patrones resultados en los pacientes con SCA sin elevacin del
de la prctica contempornea fue proporcionada en 67 VH UHDOL]R HO HVWXGLR$%2$5' $QJLRSODVW\ WR
OD SXEOLFDFLyQ GH  GHO 7,06&$ PXOWLFpQWULFR Blunt the Rise of Troponin in Acute Coronary Syndro-
0RPHQWR GH OD LQWHUYHQFLyQ HQ &RURQDULR $JXGR PHV  GRQGHVHFRPSDUyORVUHVXOWDGRVGHODDQ-
6tQGURPHV  TXHFRPSDUyLQWHUYHQFLyQWHPSUD- giografa y la intervencin realizada inmediatamente a
na versus tarda con angiografa en pacientes con la presentacin, con la intervencin llevado a cabo en
SCA sin elevacin del segmento ST. HOSULPHUGtDKiELOVLJXLHQWH8QWRWDOGHSDFLHQWHV
Los pacientes fueron incluidos si se presentaban con sntomas isqumicos inestables, cambios ECG, o
GHQWURGHODVKRUDVGHODDSDULFLyQGHVtQWRPDVGH HOHYDFLyQGHODWURSRQLQDVHDVLJQDURQDOD]DUHQ
DQJLQDLQHVWDEOHHGDGDYDQ]DGD !DxRV HOHYDFLyQ KRVSLWDOHVDXQDLQPHGLDWDLQWHUYHQFLyQ HQXQDPH-
GHELRPDUFDGRUHVRFDPELRVHOHFWURFDUGLRJUiFRVLV- GLDQDGHPLQXWRVGHVSXpVGHODVHOHFFLyQ YHUVXV
qumicos y fueron aleatorizados para someterse a una XQD  WDUGtD  UHYDVFXODUL]DFLyQ D XQD PHGLDQD GH 
angiografa tan rpidamente como sea posible y dentro KRUDV (OWUDWDPLHQWRDQWLWURPEyWLFRFRQVLVWLyHQDV-
GHODVKRUDVGHODDOHDWRUL]DFLyQ PHGLDQDKRUD  SLULQD&ORSLGRJUHOHQPJUVDE[LFLPDE\DQWLFRD-
versus los que se sometan despus de un retardo m- gulacin segn criterio del mdico tratante. Una dosis
QLPRGHKRUDV PHGLDQDKRUDV /DDQWLDJUHJD- VXSHULRU D  PJUV GH WUDWDPLHQWR FRQ &ORSLGRJUHO
FLyQLQFOX\yDVSLULQD\&ORSLGRJUHOHQHOGHORV aument la tasa de sangrado mayor en la poblacin


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

JHQHUDO YHUVXVS \HQHOVXEJUX-  \ HO ,&786 WULDO \ OD FRQFOXVLyQ TXH VXUJH GH
SR$7& YHUVXV3  este estudio sera la siguiente: El anlisis actual
(OEHQHFLRGHODPD\RUGRVLVGHFDUJDGH&ORSL- GHOFRQMXQWRGHGDWRV),5PXHVWUDTXHHOEHQHFLR
dogrel fue compensado por un aumento en los san- a largo plazo de la estrategia invasiva sistemtica
grados mayores. sobre la estrategia invasiva selectiva es atenuada
Sin embargo la conclusin del estudio ABOARD HQORVSDFLHQWHVPiVMyYHQHV GHHGDGDxRV \
al analizar la angioplastia realizada, no puede ser re- HQODVPXMHUHVSRUHODXPHQWRGHOULHVJRGHHYHQ-
ferida como absoluta, sino como simple generadora tos tempranos que parecen no tener consecuencias
GHKLSyWHVLVGDGRTXHQRFXPSOLyFRQORVREMHWLYRV a largo plazo de la mortalidad cardiovascular. Nin-
del estudio. gn otro factor de riesgo clnico fue capaz de iden-
(VWRVWUHVWUDEDMRVEXVFDQXQPLVPRUHVXOWDGRVLQ WLFDUDORVSDFLHQWHVFRQUHVSXHVWDVGLIHUHQFLDOHV
embargo su gran diferencia esta en el tiempo de demora a una estrategia invasiva de rutina.
al procedimiento largo en el caso del ISAR COOL, me-
GLDQRHQHO7,0$&6\EUHYHHQHO$%2$5'GLFXOWDQ RECOMENDACIONES SOBRE TERAPIA
la comparacin de sus conclusiones. De igual manera ANTIAGREGANTE / ANTICOAGULANTE EN
debe considerarse que estos estudios estudiaron score PACIENTES CON DIAGNOSTICO DE AI /SCA
GHULHVJRVGLIHUHQWHVHQWUHVL *5$&(7,0, SIN ST
Resulta interesante remarcar los resultados del
&$67ULDO   HQ HO FXDO HO  JUXSR LWDOLDQR LQWHU- Introduccin
viniente analizo las respuestas a los tratamientos 3RGHPRV GHQLU DO PHMRU HVTXHPD WHUDSpXWLFR D
propuestos en un grupo especial como es el de los aquel que es el ms efectivo con la menor dosis posi-
pacientes ancianos y que concluye diciendo que el ble o en su defecto el menor nmero de drogas, con
HVWXGLR QR SHUPLWH XQD FRQFOXVLyQ GHQLWLYD DFHU- la menor cantidad y calidad de efectos adversos, con
FD GH ORV EHQHFLRV GH XQ HQIRTXH GH WUDWDPLHQWR el menor costo sin desmedro del efecto teraputico y
agresivo cuando se aplica sistemticamente en los en lo posible de aplicacin universal.
pacientes de edad avanzada con SCASEST. El ha-
OOD]JRGHXQDLQWHUDFFLyQVLJQLFDWLYDSDUDHOHIHFWR Sobre quien acta la antiagregacin?
del tratamiento segn el estado de troponina al ini- La agregacin es una propiedad de la plaqueta, que
FLRGHOHVWXGLRGHEHVHUFRQUPDGRHQXQHVWXGLRGH RFXUUHFRPRUHVXOWDGRGHXQGDxRHQGRWHOLDO
PD\RUWDPDxR Las plaquetas son partculas anucleadas que cir-
(VWH HVWXGLR LQJUHVy HO  GH ORV SDFLHQWHV HQ culan como elementos formes en la sangre y que son
HO JUXSR GH (VWUDWHJLD$JUHVLYD 7HPSUDQD ($7  DO producto de la liberacin de fragmentos citoplasmti-
FXDO OH UHDOL]y XQD DQJLRJUDItD FRQ XQ  GH SUR- cos de los megacariocitos con grnulos de liberacin
FHGLPLHQWRV GH UHYDVFXODUL]DFLyQ  HQ FRPSDUDFLyQ de sustancia activa en la zona de lesin. Su estructu-
FRQ HO  FRQ XQ  GH UHYDVFXODUL]DFLRQHV  HQ ra est constituida por:
HOJUXSR,QLFLDOPHQWH&RQVHUYDGRU ,& (OUHVXOWDGR a. Membrana celular: formada por protenas, fos-
SULPDULRVHSURGXMRHQSDFLHQWHV  HQHOJUX- folpidos y glucosa-aminoglicanos con un Glu-
SRGH($7\  HQHOJUXSR,& +5,& cocalix que contiene mucopolisacridos cidos,
DS  /DVWDVDVGHPRUWDOLGDG glicoprotenas y ATPasa contrctil magnesio de-
+5,&D LQIDUWRGHPLRFDUGLR pendiente. Es la estructura con la que se adhie-
+5,&D \ODUHKRVSLWDOL]DFLyQ UHQODVSODTXHWDV<
+5,&D QRGLULHURQHQWUHORV b. Hialoplasma: Haz marginal de microtbulos y
JUXSRV(OSXQWRQDOSULPDULRIXHVLJQLFDWLYDPHQWH PLFURODPHQWRV/RVPLFURODPHQWRVHVWiQIRU-
menor en los pacientes con elevacin de troponina al mados por protenas contrctiles como la actina,
LQJUHVR +5,&D SHURQRHQ miosina, actomiosina o trombostenina, la Tropo-
DTXHOORVFRQWURSRQLQDQRUPDOHV +5,& nina y la tropomiosina.
DSSDUDODLQWHUDFFLyQ  
(QHOPLVPRVHQWLGR'DPPDQ3&OD\WRQ7   Cmo actan las plaquetas
en un meta anlisis recientemente publicado don- )UHQWHDXQGDxRHQGRWHOLDOVHSURGXFHXQDH[SRVL-
de evalan los resultados de seguimiento a largo FLyQGHEUDVFROiJHQDVTXHSUHVHQWDQXQLPSRUWDQWH
plazo entre los gerontes en los tres trials mas im- fenmeno quimio tctico sobre las plaquetas.
portantes en cuanto comparacin de tratamiento A partir de ah se comienzan a producir un fe-
invasivo vs.selectivo que son el FRISC II, RITA QyPHQR GHQLGR FRPR DGKHVLyQ SODTXHWDULD \ TXH


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

se caracteriza por un aposicin de plaquetas de ca- adicionales para su uso en pacientes con AI / IMSEST.
rcter reversible y que esta mediado por la unin a Temas ampliamente debatidos relacionados con
UHFHSWRUHVHVSHFtFRVGHODPHPEUDQDSODTXHWDULDDO la terapia dual antiplaquetaria en pacientes con SCA
colgeno y al Factor de Von Willebrand liberado por sometidos a ICP incluyen.
HOHQGRWHOLRGDxDGR 1. la dosis de carga de Clopidogrel apropiada,
La plaqueta es entonces estimulada por dos ele-  el momento ptimo para iniciar la dosis de carga
mentos que son la trombina y la epinefrina. La primera de Clopidogrel,
est mediada por la activacin de la hemostasia secun-  la duracin ptima de la terapia antiplaquetaria
GDULDSRUDFFLyQGHODYtDH[WUtQVHFDHLQWUtQVHFDTXH dual luego de SCA o PCI,
WLHQHQFRPRQDOLGDGODDFWLYDFLyQGHOIDFWRU;WLVXODU  el impacto de la variabilidad de la respuesta de
y la activacin de protrombina en trombina. El efecto las plaquetas en los resultados del paciente, y
de la trombina sobre la plaqueta lleva a su activacin. El  HOSDSHOGHRWUDVGURJDV3<DQWDJRQLVWDVUHFR-
resultado de la activacin tiene tres efectos principales: mendadas y emergentes
 Secrecin del contenido de los grnulos intrace- El Clopidogrel es bien absorbido desde el tracto
OXODUHVGHODSODTXHWD JDVWURLQWHVWLQDO\HOXVRGHXQDGRVLVGHFDUJDGH
 ([SRVLFLyQGHUHFHSWRUHVGHVXSHUFLHSDUDODV mg puede reducir el tiempo requerido para lograr un
protenas plasmticas EORTXHRPi[LPRGHODDFWLYDFLyQGHODVSODTXHWDVD
 Alteracin de la estructura lipdica de la mem- KRUDVFRPSDUDGRFRQGtDVGHOD7LFORSLGLQD
brana plaquetaria, que induce la aceleracin de /DGRVLVKDELWXDOGH&ORSLGRJUHOHVGHPJGtD
la coagulacin plasmtica. Despus de discontinuar el Clopidogrel, su efecto
)LQDOPHQWHODOLEHUDFLyQGHWURPER[DQR\GH$'3 SXHGHSHUVLVWLUKDVWDSRUGtDV
FRPLHQ]DGHQLUXQSURFHVRLUUHYHUVLEOHGHDJUHJD- La declaracin del consenso no prohbe el uso de
FLyQTXHMDODVSODTXHWDVHQWUHVLDWUDYpVGHSXHQWHV agentes PPI en correspondientes mbitos clnicos, sin
GHEULQDTXHVHSURGXFHQSRUPRGLFDFLyQGHORVVL- embargo, pone de relieve los riesgos potenciales y
WLRVGHMDFLyQGHODJOLFRSURWHtQD,,E,,,DJHQHUDQGR ORV EHQHFLRV GHULYDGRV GHO XVR GH DJHQWHV 33, HQ
los sitios FIb y perpeta su accin por efecto de otras combinacin con Clopidogrel.
sustancias liberadas en el sitio de lesin.
USO DEL CLOPIDOGREL
Dnde actuar para una efectiva antiagregacin En el estudio Clopidogrel in Unstable Angina to
De esta manera es fcil entender que conociendo los 3UHYHQW 5HFXUUHQW (YHQWV &85(   VH GHPRVWUy
mecanismos intervinientes en las etapas de adhesin, TXHXQDGRVLVGHFDUJDGHPJUVVHJXLGRGHXQD
activacin y agregacin reversible es posible al mo- GRVLVGHPDQWHQLPLHQWRGHPJUVGLDULRVGXUDQWH
GLFDUORVLQKLELUODDJUHJDFLyQSODTXHWDULDLUUHYHUVL- DPHVHVHQDVRFLDFLyQDODDVSLULQDUHGXFHOD
ble. Surge entonces el concepto de Inhibicin plaque- incidencia de muerte cardiovascular , infarto no fa-
taria pluripotente. WDO\VWURNHFXDQGRVHODFRPSDUDFRQHOHIHFWRGH
El Clopidogrel no tiene actividad antiplaquetaria ODDVSLULQDDLVODGD YV55
in vitro. Despus de la ingestin oral es metabolizado &,3 HQSDFLHQWHVFRQ167(
HQ HO KtJDGR SRU HO FLWRFURPR 3 \ FRQYHUWLGR HQ ACS asociados con aumento de los marcadores de
R[RFORSLGRJUHOHOFXDOH[SHULPHQWDKLGUyOLVLVDQWHV lesin o depresin del segmento ST, o mayores de
GHXQLUVHHLQKLELULUUHYHUVLEOHPHQWHHOUHFHSWRU3< DxRVFRQKLVWRULDSUHYLDGHHQIHUPHGDG&RURQD-
Esta accin previene el acoplamiento del siste- ULD  (O EHQHFLR IXH FRQVLVWHQWH D WUDYpV GH WRGRV
ma Gi/adenil ciclasa a travs de la formacin de un los grupos de riesgo analizados.
puente disulfuro entre un residuo tiol del metabolito  PJ GH GRVLV GH FDUJD KD GHPRVWUDGR XQ
activo del clopidogrel y un residuo de cistena en el ms rpido inicio del comienzo de la accin y un
UHFHSWRU3< ms potente efecto de inhibicin que la observa-
(O XOWLPR XSGDWH D OD WDVN IRUFp GHO $&& GD  FRQ  PJUV  8QD GRVLV GH PDQWHQLPLHQWR
$+$\(6&SXEOLFDGRHQDJRVWRGHODxRUH- tambin proveera un leve incremento en el efecto
visa claramente las indicaciones actualizadas del uso LQKLELWRULRFXDQGRVHORFRPSDURFRQPJUVGLD
de antiagregantes y anticoagulantes en el sndrome En el estudio CURRENT/Optimal Antiplatelet
coronario agudo. De esta manera podramos resur- 6WUDWHJ\IRU,QWHUYHQWLRQV &855(172$6,6 VH
mirlos en los siguientes trminos. DGPLQLVWUR OD GRVLV GH PJUV  PJUV SRU 
'HVGHODSXEOLFDFLyQGHOD~OWLPDGLUHFWLYD  OD GtDV VHJXLGR SRU  PJUV \ VH OR FRPSDUH FRQ HO
)'$ KD DSUREDGR  LQKLELGRUHV GHO UHFHSWRU 3< esquema estndar.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

En general el rgimen de altas dosis no fue ms enfoques preventivos. La informacin ha acumulado


efectivo que el convencional con una frecuencia rpidamente de varias fuentes, incluyendo ensayos cl-
VLPLODUHQHOHQGSRLQWFRPELQDGRDGtDV> nicos controlados aleatorios de SL versus SC en sub-
YVUHVSHFWLYDPHQWHKD]DUGUDWLR +5  grupos de pacientes cuidadosamente seleccionados y
3@SHURDVRFLDGRDXQLQFUHPHQ- H[SHULHQFLDVGHUHJLVWURHQORVJUXSRVGHSDFLHQWHVPiV
WR GH VDQJUDGR PD\RU D  GtDV HYDOXDGR SRU ORV grandes, proporcionan una imagen ms universal del
FULWHULRVGHO&855(17 YV+5 PXQGRUHDO/RVUHVXOWDGRVGHHVWRVGLIHUHQWHVFRQMXQ-
3 RGHO7,0, YV tos de datos no son completamente concordantes.
+53 \SRUODQHFHVLGDG Sin embargo, varias conclusiones generales se
GH WUDQVIXVLRQV   YV  +5   SXHGHQKDFHU 76HVXQDFRPSOLFDFLyQSRFRIUH-
3  FXHQWH SHUR PX\ JUDYH GH DPERV %06 \ '(6  
(OHVWXGLR*5$9,7$6  GHUHFLHQWHSXEOLFD- GXUDQWHPiVGHDxRVGHVHJXLPLHQWRGHORVHQVD-
cin propuso una administracin diferente en cuanto yos controlados aleatorios que compararon la DES y
a la comparacin con la dosis de carga y manteni- BMS, no hubo ninguna diferencia aparente en la fre-
PLHQWRFRQDOWDVGRVLVGH&ORSLGRJUHO PJGRVLV cuencia de TS en general, aunque el momento para
LQLFLDOPJDOGtDSRVWHULRUPHQWH RODGRVLVHV- su aparicin parece diferir, con un mayor numero re-
WiQGDUGH&ORSLGRJUHO VLQGRVLVGHFDUJDDGLFLRQDO ODWLYRGH76WDUGtDGHVSXpVGHLPSODQWH'(6 4XH
PJGLDULRV GXUDQWHPHVHV/DFRQFOXVLyQGHO a pesar de este desequilibrio relativo, no hay diferen-
WUDEDMRVXJLHUHTXHDXQHQORVSDFLHQWHVFRQDOWDUHDF- FLDVHQORVSXQWRVQDOHVGHODPXHUWHRODPXHUWH\
tividad durante el tratamiento despus de la ATC con HOLQIDUWRHQWUH'(6\%06  
stents liberadores de frmacos, el uso de dosis altas
de clopidogrel en comparacin con la dosis estndar OTROS ANTIAGREGANTES
GHFORSLGRJUHOQRUHGXMRODLQFLGHQFLDGHPXHUWHSRU 'HVGH OD SXEOLFDFLyQ GH OD ~OWLPD GLUHFWUL]   OD
causas cardiovasculares, infarto de miocardio no fa- )'$KDDSUREDGRLQKLELGRUHVGHOUHFHSWRU3<
tal o trombosis del stent. adicionales para su uso en pacientes con AI / IM-
(O DQiOLVLV GH XQ JUXSR SUHGHQLGR GH   SEST. La FDA aprob el uso de Prasugrel y Tica-
pacientes que fueron sometidos a angioplastia de- grelor basado en datos de ensayos de comparacin
PRVWUDURQXQDUHGXFFLyQVLJQLFDWLYDGHOHQGSRLQW con Clopidogrel, y en donde tanto el Prasugrel como
FRPELQDGRYV +5&, el Ticagrelor fueron, respectivamente, superiores al
3 FRQHOUpJLPHQGHDOWDVGRVLV  primero en la reduccin de eventos clnicos, pero a
YV  +5   &,   3   costa de un mayor riesgo de hemorragia.
/DIUHFXHQFLDGHWURPERVLVGHOVWHQWVHJ~QODGH-
QLFLyQGHO$FDGHPLF5HVHDUFK&RQVRUWLXP $5& @ PRASUGREL
VHUHGXMRVLJQLFDWLYDPHQWHPDVDOODGHODQDWXUD- El Prasugrel es tambin una prodroga, que in vivo
OH]D GHO VWHQW  SDUD GHQLGD R SUREDEOH WURPERVLV HVPHWDEROL]DGDD5HVSHFtFRSDUD
GHOVWHQW +5&,3 \ 3<3UDVXJUHOUHTXLHUHSDVRVPHWDEyOLFRVSDUD
SDUDGHQLWLYDWURPERVLVV +5&, la formacin del metabolito activo que es qumica-
3 mente similar al metabolito activo del Clopidogrel.
(O&ORSLGRJUHOWXYRVXSULQFLSDOMXVWLFDFLyQHQ El primer paso metablico requiere solo de esteara-
la presencia de fenmenos trombticos observados sas plasmticas mientras que el segundo paso esta
desde el comienzo del tratamiento endovascular con PHGLDGR HQ HO  KtJDGR SRU HQ]LPDV &<3   3RU OR
stent convencionales y que no eran prevenidos con tanto el Prasugrel produce una inhibicin plaquetaria
el uso de aspirina en las dosis usualmente tiles. La ms rpida y ms consistente cuando se lo compara
WURPERVLVGHOVWHQW 76 GHVSXpVGHODLQWHUYHQFLyQ con el Clopidogrel.
coronaria percutnea ha sido el centro de gran inters Administrada en forma oral causa inhibicin de
debido a la morbilidad y la mortalidad. ODDJUHJDFLyQSODTXHWDULDGRVLVGHSHQGLHQWH\HV
Desde entonces muchas preguntas han ido apa- veces ms potente que Clopidogrel. Es tambin inhi-
UHFLHQGR DFRPSDxDQGR D OD HYROXFLyQ GH ORV VWHQWV bidor irreversible del receptor.
&RPRSRUHMHPSORODIUHFXHQFLDGH76FRQVWHQWVOL- El estudio que ms recientemente estudio los
EHUDGRUHV GH IiUPDFRV 6/)  IUHQWH D ORV VWHQWV FRQ- efectos del Prasugrel cuando era utilizado en los SCA
YHQFLRQDOHV 6& HOPRPHQWRGHDSDULFLyQODVFRQVH- IXHHO75,7217,0,  
FXHQFLDVFOtQLFDVGHQLFLyQGHIDFWRUHVGHULHVJRTXH De las conclusiones del mismo se desprende que
predispongan a la TS, la terapia adyuvante, y nuevos el uso de Prasugrel en comparacin con el Clopido-


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

grel en pacientes de alto riesgo que fueron sometidos las posibilidades de un mayor riesgo de muerte y
D DQJLRSODVWLD  VH DVRFLy FRQ XQD VLJQLFDWLYD  UH- GHKHPRUUDJLDLQWUDFUDQHDOFRQXQEHQHFLRLQFLHU-
GXFFLyQDEVROXWDGHO\XQDUHGXFFLyQUHODWLYD WRVDOYRHQVLWXDFLRQHVGHDOWRULHVJR SDFLHQWHVFRQ
GHOHQHOSXQWRQDOGHHFDFLDSULPDULDTXH diabetes o antecedentes de MI. En los pacientes
consideraba una combinacin de mortalidad de cau- con SCACEST sometidos a ICP, Prasugrel es ms
VDFDUGLRYDVFXODU LQFOX\HQGRDUULWPLDLQVXFLHQFLD efectiva que Clopidogrel en la prevencin de eventos
FDUGLDFDFRQJHVWLYDVKRFN\PXHUWHV~ELWDRVLQWHV- LVTXpPLFRVVLQXQDSDUHQWHH[FHVRGHVDQJUDGR  
WLJRV ,$0QRIDWDO ,0 R$&9QRIDWDOGXUDQWHHO $OFHQWUDUVHHVSHFtFDPHQWHHQORVSDFLHQWHVFRQ$,
periodo de seguimiento.  ,06(67 OD WDVD GH OD HFDFLD SULPDULD GHO SXQWR
Cabe destacar que en forma asilada, la incidencia QDO VH UHGXMR VLJQLFDWLYDPHQWH D IDYRU GH 3UDVX-
GHPXHUWHFDUGLRYDVFXODU YHUVXVS  JUHO YHUVXV+5DMXVWDGD,&
\HODFFLGHQWHFHUHEURYDVFXODUQRIDWDO YHUVXV DS 
S QRVHUHGXMHURQSRU3UDVXJUHOHQUHOD-
cin con Clopidogrel. TICAGRELOR
As tambin un subestudio del mismo trial mos- El ensayo principal del Ticagrelor, PLATO, fue un
tro una reduccin de eventos recurrentes en pacientes estudio multicntrico, internacional, aleatorizado
tratados con Prasugrel en comparacin con Clopido- \ FRQWURODGR FRPSDUDQGR 7LFDJUHORU PJUV GH
grel, notando este efecto en particular en pacientes FDUJD \  PJUV GLDULRV  FRQ &ORSLGRJUHO 
GLDEpWLFRV   PJUVGHFDUJD\PJUVGHPDQWHQLPLHQWRGLDULR 
(VWHEHQHFLRVHKDREVHUYDGRLQFOXVRKDVWDORV DPERVDVRFLDGRVDODDGPLQLVWUDFLyQGHDVSLULQDDQ
PHVHVGHWUDWDPLHQWRFRQGREOHDQWLDJUHJDFLRQD de determinar si el Ticagrelor es superior a Clopido-
IDYRUGHORVSDFLHQWHVWUDWDGRVFRQFORSLGRJUHO  grel en la prevencin de eventos cardiovasculares y
)LQDOPHQWHHO3UDVXJUHOUHGXFHVLJQLFDWLYDPHQ- muerte cardiovascular en una poblacin amplia de
te el riesgo de eventos cardiovasculares en pacientes los pacientes con SCA con y sin supradesnivel del
con sndromes coronarios agudos despus de la in- 67 
tervencin coronaria percutnea, independientemen- /RVEHQHFLRVGH7LFDJUHORUHQ3/$72VHREVHU-
te de si se utiliza o no un GP IIb / IIIa . El uso de un YDURQGHQWURGHORVSULPHURVGtDV\SHUVLVWLHURQ
GP IIb / IIIa no acenta el riesgo relativo de sangrado KDVWDORVGtDV\IXHURQHYLGHQWHVLQGHSHQGLHQ-
FRQ3UDVXJUHOHQFRPSDUDFLyQFRQ&ORSLGRJUHO  temente del pre tratamiento con Clopidogrel o si los
Por otro lado las tasas de trombosis del stent de pacientes tenan tratamiento invasivo o mdico. En
FXDOTXLHUWLSRVHUHGXMHURQVLJQLFDWLYDPHQWHGHVGH los pacientes con un sndrome coronario agudo con
D S SRU3UDVXJUHO  o sin elevacin del segmento ST, el tratamiento con
En el sentido opuesto el Prasugrel se asoci con 7LFDJUHORU HQ FRPSDUDFLyQ FRQ &ORSLGRJUHO UHGXMR
XQDXPHQWRVLJQLFDWLYRHQODWDVDGHKHPRUUDJLDV VLJQLFDWLYDPHQWHODWDVDGHPXHUWHSRUFDXVDVYDV-
especialmente en el score TIMI para hemorragia gra- culares, infarto de miocardio o ictus sin un aumento
YHODFXDOVHREVHUYyHQHOGHORVSDFLHQWHVTXH en la tasa de hemorragias mayores en general, pero
WRPDEDQ3UDVXJUHO\HQHOGHORVSDFLHQWHVFRQ con un aumento en la tasa de hemorragias no relacio-
&ORSLGRJUHO +5SDUD3UDVXJUHOIUHQWHD&ORSLGRJUHO nada con el procedimiento.
,&GHO,&DS  $OFHQWUDUVHHVSHFtFDPHQWHHQSDFLHQWHVFRQ$,
3UDVXJUHO VH DVRFLy FRQ XQD DXPHQWR VLJQLFD- ,06(67HO7LFDJUHORUVHDVRFLyFRQXQDVLJQLFD-
tivo de hemorragias mortales en comparacin con WLYD UHGXFFLyQ HQ OD YDULDEOH SULQFLSDO GH HFDFLD 
&ORSLGRJUHO YHUVXV"3 3RUHVWH HQGSRLQWSULPDULR SDUDORVSDFLHQWHVFRQ,06(67
PRWLYR/D)'$DSUREyHO3UDVXJUHOHOGHMXOLR QSDFLHQWHVYHUVXV+5
GHFRQXQDFRQWUDLQGLFDFLyQFRQWUDVXXVRHQ ,& GHO   D   SHUR QR SDUD ORV SDFLHQ-
pacientes con una historia de ataque isqumico tran- WHV$, Q   SDFLHQWHV  YHUVXV  +5
sitorio o accidente cerebrovascular o con sangrado ,&D DXQTXHHVWRVUHVXOWDGRV
DFWLYRSDWROyJLFR3RUFDGDSDFLHQWHVWUDWDGRV podran estar viciados por la superposicin que ocu-
con prasugrel en lugar de clopidogrel, se podra re- UUHFRQIUHFXHQFLDHQWUHDPEDVSDWRORJtDV OODPDOD
GXFLUXQWRWDOGHHYHQWRVQDOHVDOSUHFLRGH DWHQFLyQHOPD\RUQXPHURGH,$0TXHGH$,  
HYHQWRVKHPRUUiJLFRVDGLFLRQDOHV  Sin embargo cuando se analizo al subgrupo de
En concordancia con esto es que la misma FDA pacientes con SCA con supra ST se observaron los
incluye una advertencia general contra el uso de Pra- PLVPRV UHVXOWDGRV EHQHFLRVRV TXH SDUD OD SREOD-
VXJUHO HQ SDFLHQWHV  PD\RUHV D  DxRV  GHELGR D FLyQJHQHUDOGHOHVWXGLR 


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Notablemente, Ticagrelor se asoci con una re- el PLATO, este patrn parece haber favorecido al
GXFFLyQ GHO  DEVROXWR HQ WRGDV ODV FDXVDV GH IiUPDFRH[SHULPHQWDO\SUREDEOHPHQWHUHTXHULUiGH
PRUWDOLGDG  YHUVXV  +5  ,&  XQDHYDOXDFLyQDGLFLRQDO 
 KDVWD   \ FRQ PHQRUHV WDVDV GH WURPERVLV La probabilidad de morir en PLATO en la rama
GHOVWHQW IUHQWHD+5,& Clopidogrel supera con creces los riesgos de mortali-
D  dad observadas en los brazos de Clopidogrel de otros
1R KXER GLIHUHQFLDV VLJQLFDWLYDV HQWUH HO 7L- cuatro ensayos recientes de SCA, y se vuelve espe-
cagrelor y el grupo Clopidogrel en las tasas de he- FLDOPHQWHHYLGHQWHGHVSXpVGHODMXVWHGHODVWDVDVGH
PRUUDJLDPD\RU HOREMHWLYRSULPDULRGHVHJXULGDG LIFU entre los ensayos. No es probable que estos n-
compuesto por sangrados que ponen en peligro la PHURVVHDQUHVSRQVDEOHVGHODSDUDGyMLFDPRUWDOLGDG
YLGD\RWURVHYHQWRVGHVDQJUDGRPD\RUYHU- 3/$72 SURSRUFLRQDQGR XQD MXVWLFDFLyQ DGLFLRQDO
VXV  +5  ,&   D   7,0, para una auditora independiente de la cohorte PLA-
VDQJUDGR PD\RU  YHUVXV  +5  ,& TO de los presumiblemente fallecidos en el brazo
  D   R VDQJUDGR IDWDO  YHUVXV &ORSLGRJUHO  
+5,&GHO,&D  La FDA tambin emiti un Recuadro de Adver-
Tampoco hubo diferencias en el sangrado mayor tencia donde indica que la aspirina en dosis diarias
en pacientes sometidos a cirugia coronaria o CRM, GHPDQWHQLPLHQWR!PJSRGUtDGLVPLQXLUODH-
en quien Clopidogrel y Ticagrelor fueron suspendi- cacia de Ticagrelor, advirti en contra de su uso en
GRVSDUDHOSURFHGLPLHQWRGtDVDQWHVRGHKR- pacientes con hemorragia activa o antecedentes de
ras respectivamente, segn el protocolo de estudio. hemorragia intracraneal y abog por una estrategia
Ticagrelor, sin embargo, se asoci con una mayor de evaluacin y mitigacin de riesgos, en un plan
tasa de hemorragia mayor o relacionada al procedi- SDUDD\XGDUDDVHJXUDUTXHORVEHQHFLRVGH7LFDJUH-
PLHQWR YHUVXV   lor sean mayores que sus riesgos.
(O7LFDJUHORUGHPRVWUyWDPELpQVHUPiVHFD]HQ
la reduccin del end-point primario al compararlo INHIBIDORES DE LA GP IIB-IIIA
con Clopidogrel en pacientes con diabetes, inde- (O XOWLPR XSGDWH \D PHQFLRQDGR   SURGXFH OD VL-
pendientemente del valor de glucemia que presente guiente recomendacin Antes de ingresar a la sala de
el paciente y sin aumentos en la tasa de sangrados +HPRGLQDPLDHOVHJXQGRDQWLSODTXHWDULR OXHJRGHOD
 6LQHPEDUJRHQORVSDFLHQWHVFRQ,QVXFLHQFLD DVSLULQD SXHGHVHUXQRGHORVVLJXLHQWHV&ORSLGRJUHO
UHQDOFUyQLFDVLELHQPRVWURHFDFLDHQODUHVSXHVWD 7LFDJUHORURXQEORTXHDQWH,,E,,,DYtD(9 SUHIHULGRV
teraputica, mostr mayor numero de sangrados no HSWLEDWLGHRWLUREDQ $OPRPHQWRGHODDQJLRSODVWLD
relacionados con los procedimientos cuando se lo el segundo antiplaquetario puede ser Clopidogrel, Pra-
FRPSDUHFRQ&ORSLGRJUHO  /D)'$DSUREyHO7L- sugrel, Ticagrelor, o un bloqueante IIb-IIIa va EV.
FDJUHORUHOGHMXOLRGH6LQHPEDUJRPXFKDV (O ($5/< 6&$ (VWXGLR GHO  XVR WHPSUDQR GH
crticas surgieron desde el principio a los resultados glicoprotena inhibidora de IIb / IIIa en pacientes
del estudio. En particular en lo que hace al anlisis de con sndrome coronario agudo sin elevacin del seg-
los efectos adversos y su consideracin por el comit PHQWR67 SUREDURQODKLSyWHVLVGHTXHXQDHVWUDWH-
de eventos. gia de administracin precoz de rutina de la GP IIb /
La censura realizada por el patrocinador del estudio ,,,D HSWLEDWLGH VHUtDVXSHULRUDODDGPLQLVWUDFLyQ
sobre acontecimientos de las variables clnicas repre- retardada para reducir las complicaciones isqumicas
senta un enfoque polmico ya que los datos reportados en pacientes de alto riesgo con AI / IMSEST. Se in-
SXHGHQ HVWDU VHVJDGRV D IDYRU GH ORV DJHQWHV H[SHUL- FOX\HURQSDFLHQWHVTXHVHSUHVHQWDEDQGHQWUR
PHQWDOHVGHELGRDXQHYLGHQWHFRQLFWRGHLQWHUHVHV GHODVKRUDVGHXQHSLVRGLRLVTXpPLFRHQUHSRVR
La frecuencia de la interrupcin del tratamiento GHXQDGXUDFLyQPtQLPDGHPLQXWRV 
\ODVWDVDVGHUHFKD]RDODUPDGHOFRQVHQWLPLHQWR (O SXQWR QDO SULPDULR FRPSXHVWR TXH LQFOX\H
tambin pdieron afectar los resultados del ensayo. muerte de todas las causas, infarto, isquemia recurrente
/RVSXQWRVQDOHVSULPDULRVUHSRUWDGRVVHGLVWULEX- que requiere revascularizacin urgente, o rescate trom-
yen de manera desigual para Clopidogrel y Ticagre- EyWLFRDODVKRUDVVHSURGXMRHQHOGHORVSD-
lor en el ensayo PLATO. cientes en el grupo de tratamiento temprano versus el
Este patrn sugiere la importancia de cuestionar  GH ORV SDFLHQWHV FRQ WUDWDPLHQWR UHWDUGDGR GHO
el impacto de la censura del patrocinador observada *3,,E,,,D 25,&GHODS 
en caso de informes enviados por los investigado- 0LHQWUDVWDQWRHOSXQWRQDOVHFXQGDULR SRUWR-
res en la bsqueda de eventos adversos serios. En das las causas de mortalidad o infarto de miocardio en


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

ORVGtDV ODWDVDGHHYHQWRVIXHURQXQYHU- cos y los pacientes deben ser advertidos en contra de


VXV 25,&DS  la interrupcin temprana de inhibidores del receptor
/D DGPLQLVWUDFLyQ SUHFR] GH UXWLQD GH HSWLEDWLGH 3< SDUD SURFHGLPLHQWRV QR FDUGLDFRV HOHFWLYRV
se asoci con un mayor riesgo de hemorragia mayor Dado el elevado riesgo de recurrencia de eventos car-
7,0, YHUVXVS (OVDQJUDGRVH- diovasculares por la interrupcin prematura de Inhi-
YHUR R PRGHUDGR WDO FRPR VH GHQH SRU ORV FULWH- ELGRUHV3<\HOULHVJRDXPHQWDGRGHKHPRUUDJLD
ULRV*8672 8WLOL]DFLyQ*OREDOGHHVWUHSWRTXLQDVD en pacientes sometidos a procedimientos con terapia
\ W3$ SDUD 2FOXVLyQ GH DUWHULDV FRURQDULDV  IXH- DQWLDJUHJDQWH SRUHMHPSORODFRORQRVFRSLDFRQELRS-
URQPiVFRPXQHVHQHOJUXSRHSWLEDWLGHWHPSUDQR VLDSURFHGLPLHQWRVGHQWDOHV HVDFRQVHMDEOHFRQVXOWDU
YHUVXVS  a un cardilogo y preferiblemente diferir el procedi-
/DVWDVDVGHWUDQVIXVLyQGHJOyEXORVURMRVIXHURQ miento no cardiaco electivo hasta que el paciente ter-
GHO\HQORVJUXSRVGHHSWLEDWLGHSUHFR] mine el curso de la terapia de inhibicin del receptor
\WDUGtDUHVSHFWLYDPHQWH S 1RKXERLQWH- 3<HVSHFLDOPHQWHHQSDFLHQWHVFRQ$,,06(67
UDFFLRQHVVLJQLFDWLYDVFRQUHVSHFWRDODVFDUDFWHUtV- FRQPHVHVGHWUDWDPLHQWRFRQWHUDSLDDQWLSODTXHWD-
WLFDVLQLFLDOHVSUHGHQLGDVLQFOX\HQGRODDGPLQLVWUD- ria dual en particular despus de la implementacin de
cin precoz del Clopidogrel. XQVWHQWOLEHUDGRUGHIiUPDFRV '(6 
Los resultados sugieren que el uso rutinario de
HSWLEDWLGHHQIRUPDWHPSUDQDFXDQGRVHORFRPSD- ANTICOAGULANTES
ra con el uso retardado, puede estar asociada con
XQDUHGXFFLyQDGtDVGHOULHVJRLVTXpPLFRHQSD- Heparinas
cientes con sndrome coronario agudo sin elevacin (Q  ;LDR \ 7KHURX[  demostraron que el
del segmento ST tambin tratados con Clopidogrel XVRGHKHSDULQDVQRIUDFFLRQDGDV +1) SURGXFtDHQ
DQWHVGHODDQJLRJUDItD/DUHODFLyQULHVJREHQHFLR contra de lo deseado, una disminucin del nmero
de la inhibicin plaquetaria con uso intensivo com- de plaquetas y activacin de las mismas, provocando
binado con otros agentes antiplaquetarios necesita el efecto adverso de un estado inicial protrombtico.
ms evaluacin en ensayos prospectivos aleatoriza- /DKHSDULQDGHEDMRSHVRPROHFXODU +%30 SUR-
GRV   porciona mayor factor de inhibicin Xa, una incidencia
El Aumento de la edad se asoci con un mayor UHGXFLGDGH+,77\QDOPHQWHXQDELRGLVSRQLELOLGDG
riesgo de eventos isqumicos y a un mayor riesgo ms predecible y una eliminacin que la HNF. Una
hemorrgico. A pesar del riesgo isqumico basal ms VHULHGHHQVD\RVTXHFRPSDUDURQODHQR[DSDULQDDOD
alto en pacientes de edad avanzada, no hay ningn +1)GHPRVWUDURQHFDFLDFRPSDUDEOHRVXSHULRUFRQ
EHQHFLRSUHIHUHQFLDOHQHOXVRGHHSWLEDWLGHWHP- UHVSHFWRDORVSXQWRVQDOHVLVTXpPLFRVD~QFXDQGR
SUDQRYHUVXVWDUGtR   PRVWUDURQ XQ SHTXHxR DXPHQWR GH KHPRUUDJLDV FRQ
HQR[DSDULQDHVSHFLDOPHQWHFXDQGRVHHPSOHDQHVWUD-
SUSPENSIN DE LOS ANTIAGREGANTES WHJLDVLQYDVLYDV  /DKHSDULQDDGPLQLVWUDGDHQ
Mas all de las nuevas drogas antiagregantes, los di- dosis teraputicas por va intravenosa ha demostrado
ferentes tiempos de accin, su distinto metabolismo VHU PiV HFD] TXH OD DVSLULQD SDUD UHGXFLU HO ULHVJR
LQWHUPHGLR \ OD LUUHYHUVLELOLGDG R QR GH VX MDFLyQ de muerte o infarto de miocardio en pacientes con an-
se insiste en que la Suspensin de los antiagregantes JLQDLQHVWDEOH/DVKHSDULQDVGHEDMRSHVRPROHFXODU
previo a la realizacin de un procedimiento de revas- +%30  KDQ PHMRUDGR ODV SURSLHGDGHV IDUPDFROy-
FXODUL]DFLyQFRURQDULD &50  gicas y farmacocinticas sobre la heparina estndar
El grupo de anlisis sopes los datos actuales TXHSXHGHUHVXOWDUHQXQDPD\RUHFDFLD\VHJXULGDG
VREUHHOXVRGHLQKLELGRUHVGHOUHFHSWRU3<HQ HBPM puede administrarse por va subcutnea en do-
pacientes que permanecen hospitalizados despus de VLVMDVVLQVXSHUYLVLyQORTXHUHVXOWDHQXQDPD\RU
AI / IMSEST y son candidatos a revascularizacin utilidad clnica y una mayor rentabilidad en compara-
coronaria y mantuvo la recomendacin emprica del cin con la heparina estndar.
GHODVXVSHQVLyQGHOWUDWDPLHQWRFRQ&ORSLGR- El Essence trial marc rumbos en el uso de
JUHOGXUDQWHDOPHQRVGtDV\SURPRYLyXQSHUtRGR (QR[DSDULQD DO FRPSDUDUOD FRQ KHSDULQD FRUULHQWH
de al menos 7 das en pacientes que reciben Prasugrel en Sndromes coronarios agudos sin Supra ST con-
\XQSHUtRGRGHDOPHQRVGtDVHQORVSDFLHQWHVTXH cluyendo que en los pacientes con angina inestable o
recibieron Ticagrelor para su suspensin en forma LQIDUWRGHPLRFDUGLRQR4ODWHUDSLDFRQHQR[DSDUL-
FRUUHVSRQGLHQWHDQWHVGH&$%*SODQLFDGD QDUHGXMRVLJQLFDWLYDPHQWHODVWDVDVGHUHFXUUHQFLD
(VODRSLQLyQGHOJUXSRGHWUDEDMRTXHORVPpGL- clnica y de procedimientos diagnsticos invasivos y


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

WHUDSpXWLFRVHQHOFRUWRSOD]RFRQXQEHQHFLRVRV- tes de diabetes, antecedentes de angina de pecho,


WHQLGR GXUDQWH XQ DxR    &DVL HQ VLPXOWDQHR VH LQVXFLHQFLD FDUGLDFD FRQJHVWLYD FLUXJtD GH UHYDV-
present el grupo TIMI con el trial TIMI 11 b con un cularizacin coronaria, aumento del ritmo cardaco,
plateo similar al Essence y que se caracterizaba por estertores, el aumento de hematocrito, hemoglobina
ser un estudio randomizado, doble ciego, controlado EDMD\DOWRUHFXHQWRGHSODTXHWDV3RURWURODGRORV
FRQSODFHER(VWHHQVD\RHVWDEDGLVHxDGRSDUDFRP- IDFWRUHVTHSUHGLMHURQODPRUWDOLGDGGXUDQWHODKRV-
parar la estrategia de la administracin combinada a SLWDOL]DFLyQ\HOSHUtRGRGHGtDVGHVHJXLPLHQWR
FRUWR\DODUJRSOD]RGHODHQR[DSDULQD KHSDULQDGH IXHURQ OD EULODFLyQ DXULFXODU OD GLVPLQXFLyQ GHO
EDMRSHVRPROHFXODU HQSDFLHQWHVFRQDQJLQDLQHVWD- nmero de plaquetas absoluto, ningn uso de beta-
EOHH,$0QR4IUHQWHDODHVWUDWHJLDHVWiQGDUGH EORTXHDQWHV\HVWDWLQDVKDVWDGtDV\QRUHFLELUXQD
administracin de HNF slo durante la fase aguda. intervencin resolutiva.
Los pacientes eran asignados al azar a recibir 8Q PHWDDQiOLVLV GH  HQVD\RV DOHDWRULRV TXH
HQR[DSDULQD  PJ LY HQ EROR VHJXLGR SRU LQ\HF- FRPSUHQGLy Q  FRPSDUyHQR[DSDULQDFROD
FLRQHVVXEFXWiQHDVGHPJNJFDGDKRUDV  HNF en ACS y lleg a la conclusin de que hubo una
YV+1) 8NJHQERORVHJXLGRGHXQDLQIXVLyQ UHGXFFLyQVLJQLFDWLYDHQODLQFLGHQFLDGHLQIDUWRGH
GH8NJSRUKRUDFRQDMXVWHDXQWLHPSRDFWL- PLRFDUGLR +5,&S DORV
YDGRGHWURPERSODVWLQDSDUFLDOGHDYHFHVHO GtDV FRQ XQ DXPHQWR GH OD KHPRUUDJLD PD\RU +5
FRQWURO /DDGPLQLVWUDFLyQLYGH+1)RSODFHERVH ,&S  (OFULWHULRGHYDORUD-
FRQWLQXy GXUDQWH XQ PtQLPR GH  KRUDV 0LHQWUDV FLyQQHWDPRVWUyXQEHQHFLRFOtQLFR PXHUWHLQIDUWR
TXH OD DGPLQLVWUDFLyQ VF GH HQR[DSDULQDR SODFHER GH PLRFDUGLR R KHPRUUDJLDV JUDYHV  VH DFHUFy LP-
VHPDQWXYRKDVWDHODOWDKRVSLWDODULDRHOYRGtDOR SRUWDQFLDDORVGtDV +5,&S 
TXHRFXUULHUDSULPHUR     2WUDV+%30WDPELpQVHKDQHYDOXDGR
(VWHWULDOTXHLQFOX\ySDFLHQWHVFRQVtQGUR- en ACS pero estn en uso clnico menos frecuentes
mes coronarios agudos sin supra ST, concluyo de una GHELGRDTXHHPSHRUDQHOUHVXOWDGRFOtQLFR WLQ]DSD-
PDQHUDVLPLODUDO(VVHQFH\HQXQFLyTXHODHQR[DSDUL- ULQDGDOWHSDULQD RKDQDPHQWDGRHOVDQJUDGRPD\RU
na fue superior a la HNF en la reduccin de un punto QDGURSDULQD  
QDOFRPSXHVWRGHPXHUWH\JUDYHVHSLVRGLRVLVTXp- Como las HBPM se eliminan por va renal y dado
micos cardiacos durante el tratamiento agudo de la UA TXHODVSUXHEDVGHVHJXLPLHQWRVRQPHQRVDEOHGLV-
140,VLQSURYRFDUXQDXPHQWRVLJQLFDWLYRHQOD ponible, es preferible HNF en los pacientes con en-
tasa de hemorragia mayor. No se observo una dismi- fermedad renal crnica avanzada.
nucin relativa de eventos durante el tratamiento am-
EXODWRULRFRQHQR[DSDULQDSHURKXERVLQHPEDUJRXQ INHIBIDORES DIRECTOS DEL FACTOR XA
DXPHQWRHQODWDVDGHKHPRUUDJLDPD\RU 
4XL]iVHO~OWLPRFDStWXORGHODVDJD(QR[DSDULQD )RQGDSDULQX[
KD\DVLGRHO6<1(5*< 5HQGLPLHQWR6XSHULRUGH Los inhibidores directos del factor Xa bloquean la
OD 1XHYD (VWUDWHJLD GH HQR[DSDULQD UHYDVFXODUL]D- cascada de coagulacin en una etapa anterior y son
cin, y los Inhibidores de la glicoprotena IIb / IIIa capaces de inhibir el factor libre y asociado al co-
  /RV SDFLHQWHV FRQ DOWR ULHVJR GH PXHUWH H LQIDU- gulo-Xa. En la actualidad hay un inhibidor directo
to de miocardio fueron asignados al azar a heparina del factor Xa aprobado por la FDA para su uso en
GHEDMRSHVRPROHFXODU HQR[DSDULQD RKHSDULQDQR $&6 IRQGDSDULQX[ FRQRWUDVWUHVGURJDVTXHVHHQ-
IUDFFLRQDGD +1)  (VWRV SDFLHQWHV IXHURQ WUDWDGRV FXHQWUDQDXQHQHWDSDGHHQVD\RVFOtQLFRV DSL[DEDQ
con una estrategia invasiva precoz. Los resultados ULYDUR[DEDQRWDPL[DEiQ 
FOtQLFRVGHGtDVPHVHV\DxRKDQFRQUPDGR (OIRQGDSDULQX[HVXQSHQWDVDFiULGRVLQWpWLFRTXH
que se trataba de una cohorte de alto riesgo de los imita la parte de AT-III de unin de la heparina y me-
SDFLHQWHVFRQFHUFDGHGHPRUWDOLGDGDDxRGH MRUDODDFWLYLGDGDQWLIDFWRU;DHQPDVGHYHFHV
VHJXLPLHQWR   Se administra por va parenteral, elimina por va re-
(QORV SDFLHQWHVTXHVREUHYLYLHURQ GtDVGHV- nal, con poca variabilidad interindividual y sin nece-
pus de la inclusin, los predictores independientes sidad de monitoreo de rutina.
GHPRUWDOLGDGDDxRLQFOX\HURQIDFWRUHVFRQRFLGRV /D XWLOLGDG GHO IRQGDSDULQX[ HQ SDFLHQWHV FRQ
DOLQLFLRGHOHVWXGLRWDOHVFRPRPD\RUHGDGHOVH[R SCA se evalu por primera vez en un estudio para
masculino, prdida de peso, antecedentes de haber la bsqueda de dosis HQHO3(17$/<6(,QJUHVD-
fumado alguna vez, una disminucin del clearance URQSDFLHQWHVFRQ6&$67(0, Q  VRPHWLGRVD
de creatinina, descenso del segmento ST, anteceden- WURPEROLVLV\TXHIXHURQUDQGRPL]DGRVSRUK


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

a HNF o una de cinco dosis diferentes de fondapari- SDFLHQWHVVRPHWLGRVD,&3SODQLFDGD\DTXHOORVFRQ


QX[GXUDQWHGtDV SCA de alto riesgo son prometedores. En compara-
/RV SDFLHQWHV WUDWDGRV FRQ IRQGDSDULQX[ WXYLH- FLyQFRQODKHSDULQDQRIUDFFLRQDGDFRQHSWLEDWLGD
URQ PHQRU WDVD D   GtDV GH UHYDVFXODUL]DFLyQ  HORWDPL[DEiQVHKDDVRFLDGRFRQUHGXFFLRQHVHQOD
YV  S    FRQ XQ ULHVJR PD\RU VDQJUDGR WDVDGHPXHUWHRLQIDUWRGHPLRFDUGLRDORVGtDV +5
VLPLODU IUHQWHD   ,&FRQPJNJK FRQWDVDV
(O 2$6,6 LQFOX\R GH  SDFLHQWHV FRQ FRPSDUDEOHVGHVDQJUDGR IUHQWHD&RKHQ
SCA SEST los cuales fueron asignados al azar a fon- HW DO  6DEDWLQH HW DO  $FWXDOPHQWH VH
GDSDULQX[ PJDOGtD RHQR[DSDULQD PJNJ HVWiHYDOXDQGRRWDPL[DEiQYV+1)\HSWLEDWLGHHQ
GRV YHFHV DO GtD  GXUDQWH XQD PHGLD GH  GtDV 1R pacientes con SCA sometidos a una estrategia invasi-
KXER GLIHUHQFLD HQ OD LQFLGHQFLD GHO HQG SRLQW QDO YDSODQLFDGD  
compuesto por muerte, IAM no fatal, o isquemia
UHIUDFWDULD +5&,D HQWUHIRQGDSDUL- RIVAROXABAN Y APIXABAN
QX[\HQR[DSDULQD6LQHPEDUJRODKHPRUUDJLDPD- Dos nuevos por va oral inhibidores sintticos del
\RU IXH VLJQLFDWLYDPHQWH PHQRU FRQ IRQGDSDULQX[ IDFWRU;DVRQ5LYDUR[DEDQ\$SL[DEDQ
DORVGtDV +5,&S \OD El 5LYDUR[DEDQHVXQLQKLELGRUGHOIDFWRU;D ad-
PRUWDOLGDGSRUWRGDVODVFDXVDVIXHLQIHULRUD +5 ministrado por va oral, con una biodisponibilidad alta
,&S  \GtDV +5,& \XQUiSLGRLQLFLRGHDFFLyQ(O$7/$67,0,IXH
S    un ensayo de fase II en los que los pacientes ingresa-
0DVWDUGHHO2$6,6IXHGLVHxDGRSDUDGHWHUPL- dos con SCA y posteriormente estabilizados fueron
QDUVLIRQGDSDULQX[HUDVXSHULRUDOD+1)HQSDFLHQWHV asignados al azar para recibir placebo o dosis crecien-
con SCACEST que fueron sometidos a revasculariza- WHVGHULYDUR[DEDQDVRFLDGRDDVSLULQD\R&ORSLGRJUHO
FLyQPHFiQLFDRWURPEyOLVLVIDUPDFROyJLFD  &RPSDUDGRFRQSODFHERHOULYDUR[DEDQVHDVRFLyFRQ
Los pacientes fueron randomizados a fondapa- XQDGLVPLQXFLyQQRVLJQLFDWLYDHQODHFDFLDSULPD-
ULD QDO PXHUWH ,0 LFWXV LVTXHPLD UHFXUUHQWH TXH
ULQX[  PJ DO GtD GXUDQWH  GtDV R KDVWD HO DOWD 
R+1) GXUDQWHK (QDTXHOORVHQORVTXHOD UHTXLHUHUHYDVFXODUL]DFLyQ DODGRVLVPiVEDMD PJ
+1)VHFRQVLGHUyLQQHFHVDULR VREUHWRGRGHVSXpVGH GRVYHFHVDOGtD+5,& FRQLQFUH-
ODDGPLQLVWUDFLyQGHHVWUHSWRTXLQDVD IXHURQDVLJQD- PHQWRGRVLVGHSHQGLHQWHVHQHOVDQJUDGR +5,&
GRVDOD]DUDIRQGDSDULQX[RSODFHER  FRQPJGRVYHFHVGLDULD  
(O)RQGDSDULQX[VHDVRFLyFRQXQDUHGXFFLyQVLJ- (O$7/$6$&67,0,HVXQHQVD\RGHIDVH,,,
QLFDWLYDHQODLQFLGHQFLDGHPXHUWHRUHLQIDUWRDORV GH\PJGRVYHFHVDOGtDULYDUR[DEiQ  . Es un
GtDV +5,&S  XQHIHFWR estudio internacional, aleatorizado, doble ciego, con-
WURODGRSRUHYHQWRV Q  GHIDVH,,,TXHSDUWLFLSDQ
TXH SHUVLVWLy D  PHVHV 1R KXER GLIHUHQFLD HQ ODV
tasas de hemorragia. PiVGHSDFLHQWHVKRVSLWDOL]DGRVSRU6&$
/D UHGXFFLyQ GH ORV SXQWRV QDOHV FDUGLRYDVFX- Todos los pacientes son tratados con terapia es-
ODUHV FRPELQDGRV FRQ IRQGDSDULQX[ HQ ORV HQVD\RV WiQGDULQFOX\HQGRGRVLVEDMDVGHDVSLULQD\ORVSD-
OASIS se limit a aquellos que se sometieron a tra- FLHQWHV VH HVWUDWLFDQ SRU OD DGPLQLVWUDFLyQ GH XQD
tamiento conservador o tromblisis, mientras que no WLHQRSLULGLQD FORSLGRJUHORWLFORSLGLQDHVWUDWR R
VHREVHUYREHQHFLRHQHOXVRGHIRQGDSDULQX[HQORV QR HVWUDWR 'HQWURGHFDGDHVWUDWRORVSDFLHQWHV
pacientes sometidos a ATC primaria. se asignan al azar en una relacin 1:1:1 para recibir
$GHPiVHOIRQGDSDULQX[VHDVRFLyDXQDXPHQWR ULYDUR[DEDQPJGRVYHFHVDOGtDRPJGHULYD-
de trombosis relacionada al catter, lo que provoc el UR[DEDQGRVYHFHVDOGtDRSODFHERGRVYHFHVDOGtD
XVRSRVWHULRUGHIRQGDSDULQX[LQWUDYHQRVD /D YDULDEOH SULQFLSDO GH HFDFLD HV OD FRPELQDFLyQ
En los pacientes que luego del tratamiento inicial de muerte cardiovascular, infarto de miocardio o ac-
DVRFLDGRDIRQGDSDULQX[HYROXFLRQDQFRQHYHQWRVDO FLGHQWH FHUHEURYDVFXODU (O SXQWR QDO SULPDULR GH
requerir una PCI , las directivas actuales recomien- seguridad es sangrado mayor en pacientes con IAM
dan una transicin a un agente con actividad anti- tratados con trombolisis no asociado con ciruga de
trombina. revascularizacin miocrdica.
En los pacientes con un sndrome coronario agu-
2WDPL[DEiQ GRUHFLHQWHULYDUR[DEDQUHGXMRHOULHVJRGHHYHQWRV
2WDPL[DEiQ HV XQ IDFWRU GH VLQWpWLFR SDUHQWHUDO LQ- compuesto de muerte por causas cardiovasculares,
hibidor Xa con un rpido inicio de accin y elimi- infarto de miocardio o accidente cerebrovascular. Sin
QDFLyQELOLDU 7DEOD /RVHQVD\RVGHIDVH,,HQ HPEDUJRODGURJD5LYDUR[DEDQDXPHQWyHOULHVJRGH


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

hemorragia grave y hemorragia intracraneal, pero no APIXABAN


el riesgo de hemorragia fatal. Esto se observo en par- /RV HQVD\RV HQ )DVH ,, FRQ DSL[DEDQ KDQ DUURMDGR
WLFXODUFRQGRVLVPD\RUHV PJUV[GtD    UHVXOWDGRVVLPLODUHV $OH[DQGHUet al 
Es de destacar que los resultados no pueden ser (QODIDVH,,,GUDQWHHOHVWXGLR$35$,6(ORV
asimilados a las poblaciones de alto riesgo ya que los SDFLHQWHVFRQVtQGURPHFRURQDULRDJXGR Q  
DQFLDQRVODVPXMHUHV\ORVSDFLHQWHVFRQLQVXFLHQ- IXHURQDVLJQDGRVDOD]DUSDUDUHFLELUSODFHERRPJ
cia renal fueron representados en este estudio en un GRVYHFHVDOGtDGHDSL[DEDQDGHPiVGH'$37HVWiQ-
EDMRSRUFHQWDMHTXHQRSHUPLWHODH[WUDSRODFLyQ\ GDU(QXQVHJXLPLHQWRPHGLRGHGtDVHOWUDWD-
ORVSDFLHQWHVFRQ$&9SUHYLRIXHURQH[FOXLGRV$Vt PLHQWRFRQDSL[DEDQQRVHDVRFLyFRQXQDUHGXFFLyQ
y todo los buenos resultados obtenidos en pacientes de la muerte cardiovascular , infarto de miocardio o
MyYHQHVHQODUHGXFFLyQGHHYHQWRVFRURQDULRVOXHJR DFFLGHQWHFHUHEURYDVFXODU +5,&S 
de un SCA se contrapuso con un mayor sagrado gra-   PLHQWUDV TXH UHVXOWy HQ XQ DXPHQWR GH VDQ-
ve aunque no fatal lo que hace que se mantenga en JUDGR PD\RU +5  ,& GHO  S  
suspenso la indicacin de esta droga en el tratamien- $OH[DQGHUHWDO 
WRKDELWXDOGHHVWRVVtQGURPHV  


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

BIBLIOGRAFA

1. %RIID*07DUDQWLQL*$EEDVFLDQR$HWDO,VFKHPLFFDUGLRP\RSDWK\ODFNRIFOLQLFDODSSOLFDELOLW\RIWKH:+2
,6)&FODVVLFDWLRQRIFDUGLRP\RSDWKLHV,WDO+HDUW-
 7K\JHVHQ .$OSHUW -6:KLWH +' -RLQW (6&$&&)$+$:+)7DVN )RUFH IRU WKH 5HGHQLWLRQ RI 0\RFDUGLDO
,QIDUFWLRQ8QLYHUVDOGHQLWLRQRIP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
 $XWKRUV7DVN )RUFH 0HPEHUV &KDLUSHUVRQV .ULVWLDQ  7K\JHVHQ 'HQPDUN  -RVHSK 6 $OSHUW $OODQ 6 -DIIH
Maarten L. Simoons, Bernard R. Chaitman and Harvey D. White: the Writing Group on behalf of the Joint ESC/
$&&)$+$:+)7KLUGXQLYHUVDOGHQLWLRQRIP\RFDUGLDOLQIDUFWLRQ7DVN)RUFHIRUWKH8QLYHUVDO'HQLWLRQRI
0\RFDUGLDO,QIDUFWLRQ(XURSHDQ+HDUW-RXUQDOGRLHXUKHDUWMHKV
 -DIIH$6%DEXLQ/$SSOH)6%LRPDUNHUVLQDFXWHFDUGLDFGLVHDVH-$P&ROO&DUGLRO
 :KLWH+'3DWKRELRORJ\RIWURSRQLQHOHYDWLRQV-$P&ROO&DUGLRO
 &RVWD)0)HUUHLUD-$JXLDU&HWDO,PSDFWRI(6&$&&)$+$:+)XQLYHUVDOGHQLWLRQRIP\RFDUGLDOLQIDUFWLRQ
RQPRUWDOLW\DW\HDUV&XUU2SLQ&ULW&DUH
7. *URDUNH-'%URZQH/0DUJH\5HWDO$PXOWLFHQWUHDQDO\VLVRIWURSRQLQXVHLQFOLQLFDOSUDFWLFH,U-0HG6FL
6HS
 6WLOOPDQ$(2XGNHUN0%OXHPNH'HWDO1RUWK$PHULFDQ6RFLHW\RI&DUGLRYDVFXODU,PDJLQJ(XURSHDQ6RFLHW\
RI&DUGLDF5DGLRORJ\,QW-&DUGLRYDVF,PDJLQJ
9. %RGHQ:(25RXUNH5$&UDZIRUG0+HWDO2XWFRPHVLQSDWLHQWVZLWKDFXWHQRQ4ZDYHP\RFDUGLDOLQIDUFWLRQ
UDQGRPO\DVVLJQHGWRDQLQYDVLYHDVFRPSDUHGZLWKDFRQVHUYDWLYHPDQDJHPHQWVWUDWHJ\9HWHUDQV$IIDLUV1RQ4
:DYH,QIDUFWLRQ6WUDWHJLHVLQ+RVSLWDO 9$14:,6+ 7ULDO,QYHVWLJDWRUV1(QJO-0HG
 7K\JHVHQ .$OSHUW -6 -DIIH$6 HW DO -RLQW (6&$&&)$+$:+)7DVN )RUFH IRU WKH 8QLYHUVDO 'HQLWLRQ RI
0\RFDUGLDO,QIDUFWLRQ7KLUGXQLYHUVDOGHQLWLRQRIP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
11. 6LOYD0$'RQRYDQ-/*DQGKL3-HWDO3ODWHOHWLQKLELWRUVLQQRQ67VHJPHQWHOHYDWLRQDFXWHFRURQDU\V\QGURPHV
DQG SHUFXWDQHRXV FRURQDU\ LQWHUYHQWLRQ JO\FRSURWHLQ ,,E,,,D LQKLELWRUV FORSLGRJUHO RU ERWK" 9DVF +HDOWK 5LVN
0DQDJ
 Robbert J. de Winter, M.D., Ph.D., Fons Windhausen, M.D., Jan Hein Cornel, M.D., Ph.D.et al on behalf for the
,QYDVLYH YHUVXV &RQVHUYDWLYH7UHDWPHQW LQ 8QVWDEOH &RURQDU\ 6\QGURPHV ,&786  ,QYHVWLJDWRUV (DUO\ ,QYDVLYH
YHUVXV6HOHFWLYHO\,QYDVLYH0DQDJHPHQWIRU$FXWH&RURQDU\6\QGURPHV1(QJO-0HG
 Hoenig MR, Aroney CN, Scott IA et al Early invasive versus conservative strategies for unstable angina and non-ST
HOHYDWLRQP\RFDUGLDOLQIDUFWLRQLQWKHVWHQWHUD&RFKUDQH'DWDEDVH6\VW5HY
 +LUVFK $ :LQGKDXVHQ ) 7LMVVHQ -* 9HUKHXJW ): (W DO ,QYDVLYH YHUVXV &RQVHUYDWLYH 7UHDWPHQW LQ 8QVWDEOH
FRURQDU\ 6\QGURPHV ,&786  LQYHVWLJDWRU /RQJWHUP RXWFRPH DIWHU DQ HDUO\ LQYDVLYH YHUVXV VHOHFWLYH LQYDVLYH
WUHDWPHQWVWUDWHJ\LQSDWLHQWVZLWKQRQ67HOHYDWLRQDFXWHFRURQDU\V\QGURPHDQGHOHYDWHGFDUGLDFWURSRQLQ7 WKH
,&786WULDO DIROORZXSVWXG\/DQFHW
 Mehta SR, Granger CB, Boden WE TIMACS Investigators Early versus delayed invasive intervention in acute
FRURQDU\V\QGURPHV1(QJO-0HG0D\
 Granger C B, Goldberg R J, Dabbous O. et al Predictors of hospital mortality in the Global Registry of Acute
&RURQDU\(YHQWV$UFK,QWHUQ0HG
17. 0RQWDOHVFRW*&D\OD*&ROOHW-3HWFRO$%2$5',QYHVWLJDWRUV,PPHGLDWHYVGHOD\HGLQWHUYHQWLRQIRUDFXWH
FRURQDU\V\QGURPHVDUDQGRPL]HGFOLQLFDOWULDO-$P0HG$VVRF
 0HKWD657DQJXD\-)(LNHOERRP-:'RXEOHGRVHYHUVXVVWDQGDUGGRVHFORSLGRJUHODQGKLJKGRVHYHUVXVORZGRVH
DVSLULQLQLQGLYLGXDOVXQGHUJRLQJSHUFXWDQHRXVFRURQDU\LQWHUYHQWLRQIRUDFXWHFRURQDU\V\QGURPHV &855(17
2$6,6 DUDQGRPLVHGIDFWRULDOWULDO/DQFHW
19. Savonitto S, Cavallini C, Petronio AS,et al on behalf Italian Elderly ACS Trial Investigators Early Aggressive Versus
Initially Conservative Treatment in Elderly Patients With Non-ST-Segment Elevation Acute Coronary Syndrome: A
5DQGRPL]HG&RQWUROOHG7ULDO-$&&&DUGLRYDVF,QWHUY
 Damman P, Clayton T, Wallentin L et al Effects of age on long-term outcomes after a routine invasive or selective
invasive strategy in patients presenting with non-ST segment elevation acute coronary syndromes: a collaborative
DQDO\VLVRILQGLYLGXDOGDWDIURPWKH)5,6&,,,&7865,7$ ),5 WULDOV+HDUW
 Price MJ, Berger PB, Teirstein PS.et al on behalf GRAVITAS Investigators Standard- vs high-dose clopidogrel
EDVHG RQ SODWHOHW IXQFWLRQ WHVWLQJ DIWHU SHUFXWDQHRXV FRURQDU\ LQWHUYHQWLRQ WKH *5$9,7$6 UDQGRPL]HG WULDO
-$0$
 +ROPHV'5-U.HUHLDNHV'-/DVNH\:.HWDO7KURPERVLVDQGGUXJHOXWLQJVWHQWVDQREMHFWLYHDSSUDLVDO -$P
&ROO&DUGLRO
 :LYLRWW 6' $QWPDQ (0 *LEVRQ &0 HW DO RQ EHKDOI 75,7217,0,  ,QYHVWLJDWRUV (YDOXDWLRQ RI SUDVXJUHO
compared with clopidogrel in patients with acute coronary syndromes: design and rationale for the TRial to assess
Improvement in Therapeutic Outcomes by optimizing platelet InhibitioN with prasugrel Thrombolysis In Myocardial
,QIDUFWLRQ 75,7217,0, $P+HDUW-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

 :LYLRWW6'%UDXQZDOG(0F&DEH&+HWDORQEHKDOI75,7217,0,,QYHVWLJDWRUV3UDVXJUHOYHUVXVFORSLGRJUHO
LQSDWLHQWVZLWKDFXWHFRURQDU\V\QGURPHV1(QJO-0HG
 0XUSK\ 6$ $QWPDQ (0 :LYLRWW 6' HW DO RQ EHKDOI  75,7217,0,  ,QYHVWLJDWRUV 5HGXFWLRQ LQ UHFXUUHQW
cardiovascular events with prasugrel compared with clopidogrel in patients with acute coronary syndromes from the
75,7217,0,WULDO(XU+HDUW-
 Morrow DA, Wiviott SD, White HD, et al .Effect of the novel thienopyridine prasugrel compared with clopidogrel
on spontaneous and procedural myocardial infarction in the Trial to Assess Improvement in Therapeutic Outcomes
E\2SWLPL]LQJ3ODWHOHW,QKLELWLRQZLWK3UDVXJUHO7KURPERO\VLVLQ0\RFDUGLDO,QIDUFWLRQDQDSSOLFDWLRQRIWKH
FODVVLFDWLRQV\VWHPIURPWKHXQLYHUVDOGHQLWLRQRIP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
 2'RQRJKXH0$QWPDQ(0%UDXQZDOG(HWDO7KHHIFDF\DQGVDIHW\RISUDVXJUHOZLWKDQGZLWKRXWDJO\FRSURWHLQ
IIb/IIIa inhibitor in patients with acute coronary syndromes undergoing percutaneous intervention: a TRITON-
7,0, 7ULDOWR$VVHVV,PSURYHPHQWLQ7KHUDSHXWLF2XWFRPHVE\2SWLPL]LQJ3ODWHOHW,QKLELWLRQ:LWK3UDVXJUHO
7KURPERO\VLV,Q0\RFDUGLDO,QIDUFWLRQ DQDO\VLV-$P&ROO&DUGLRO
 :LYLRWW6'%UDXQZDOG(0F&DEH&+HWDORQEHKDOI75,7217,0,,QYHVWLJDWRUV,QWHQVLYHRUDODQWLSODWHOHW
therapy for reduction of ischaemic events including stent thrombosis in patients with acute coronary syndromes
WUHDWHG ZLWK SHUFXWDQHRXV FRURQDU\ LQWHUYHQWLRQ DQG VWHQWLQJ LQ WKH 75,7217,0,  WULDO D VXEDQDO\VLV RI D
UDQGRPLVHGWULDO /DQFHW
 6FKDIHU-$.MHVER1.*OHDVRQ33  &ULWLFDOUHYLHZRISUDVXJUHOIRUIRUPXODU\GHFLVLRQPDNHUV-0DQDJ&DUH
3KDUP
 0RQWDOHVFRW*:LYLRWW6'%UDXQZDOG(HWDORQEHKDOI75,7217,0,LQYHVWLJDWRUV 3UDVXJUHOFRPSDUHG
with clopidogrel in patients undergoing percutaneous coronary intervention for ST-elevation myocardial infarction
75,7217,0, GRXEOHEOLQGUDQGRPLVHGFRQWUROOHGWULDO/DQFHW
 -DPHV6$NHUEORP$&DQQRQ&3HWDO&RPSDULVRQRIWLFDJUHORUWKHUVWUHYHUVLEOHRUDO3<  UHFHSWRUDQWDJRQLVW
with clopidogrel in patients with acute coronary syndromes: Rationale, design, and baseline characteristics of the
3/$7HOHWLQKLELWLRQDQGSDWLHQW2XWFRPHV 3/$72 WULDO$P+HDUW-
 :DOOHQWLQ/%HFNHU5&%XGDM$HWDORQEHKDOI3/$72,QYHVWLJDWRUV7LFDJUHORUYHUVXVFORSLGRJUHOLQSDWLHQWV
ZLWKDFXWHFRURQDU\V\QGURPHV1(QJO-0HG
 -DPHV6.5RH07&DQQRQ&3HWDORQEHKDOI3/$726WXG\*URXS 7LFDJUHORUYHUVXVFORSLGRJUHOLQSDWLHQWV
with acute coronary syndromes intended for non-invasive management: substudy from prospective randomised
3/$7HOHWLQKLELWLRQDQGSDWLHQW2XWFRPHV 3/$72 WULDO%0-G
 6WHJ3*-DPHV6+DUULQJWRQ5$HWDORQEHKDOI3/$726WXG\*URXS7LFDJUHORUYHUVXVFORSLGRJUHOLQSDWLHQWVZLWK
ST-elevation acute coronary syndromes intended for reperfusion with primary percutaneous coronary intervention: A
3ODWHOHW,QKLELWLRQDQG3DWLHQW2XWFRPHV 3/$72 WULDOVXEJURXSDQDO\VLV&LUFXODWLRQ
 Held C, Asenblad N, Bassand JP et al Ticagrelor versus Clopidogrel in patients with acute coronary syndromes
XQGHUJRLQJ FRURQDU\ DUWHU\ E\SDVV VXUJHU\ UHVXOWV IURP WKH 3/$72 3ODWHOHW ,QKLELWLRQ DQG 3DWLHQW 2XWFRPHV 
WULDO-$P&ROO&DUGLRO
 -DPHV6$QJLROLOOR'-&RUQHO-+HWDORQEHKDOI3/$726WXG\*URXS 7LFDJUHORUYVFORSLGRJUHOLQSDWLHQWVZLWK
DFXWHFRURQDU\V\QGURPHVDQGGLDEHWHVDVXEVWXG\IURPWKH3/$7HOHWLQKLELWLRQDQGSDWLHQW2XWFRPHV 3/$72 
WULDO(XU+HDUW-
 -DPHV6%XGDM$$\OZDUG3HWDO7LFDJUHORUYHUVXVFORSLGRJUHOLQDFXWHFRURQDU\V\QGURPHVLQUHODWLRQWRUHQDO
IXQFWLRQUHVXOWVIURPWKH3ODWHOHW,QKLELWLRQDQG3DWLHQW2XWFRPHV 3/$72 WULDO &LUFXODWLRQ
 6HUHEUXDQ\9/7KH)'$RXWORRNRIHYHQWVUHSRUWLQJDIWHUWLFDJUHORURUFORSLGRJUHOLQWKH3/$727ULDOLPSDFWRI
VSRQVRUFHQVRULQJGDWHVGUXJGLVFRQWLQXDWLRQDQGZLWKGUDZDORIFRQVHQW&DUGLRORJ\
 'LQLFRODQWRQLR--&DQ006HUHEUXDQ\9//RVWLQIROORZXSUDWHVLQ75$&(5$7/$6$&675,721DQG
75$3WULDOV&KDOOHQJLQJ3/$72PRUWDOLW\UDWHV,QW-&DUGLROSLL6  GRLM
LMFDUG
 *LXJOLDQR531HZE\/.+DUULQJWRQ5$HWDORQEHKDOI($5/<$&66WHHULQJ&RPPLWWHH7KHHDUO\JO\FRSURWHLQ
,,E,,,DLQKLELWLRQLQQRQ67VHJPHQWHOHYDWLRQDFXWHFRURQDU\V\QGURPH ($5/<$&6 WULDODUDQGRPL]HGSODFHER
FRQWUROOHGWULDOHYDOXDWLQJWKHFOLQLFDOEHQHWVRIHDUO\IURQWORDGHGHSWLEDWLGHLQWKHWUHDWPHQWRISDWLHQWVZLWKQRQ
67VHJPHQWHOHYDWLRQDFXWHFRURQDU\V\QGURPHVWXG\GHVLJQDQGUDWLRQDOH$P+HDUW-
 :DQJ7<:KLWH-$7ULFRFL3HWDO8SVWUHDPFORSLGRJUHOXVHDQGWKHHIFDF\DQGVDIHW\RIHDUO\HSWLEDWLGHWUHDWPHQW
in patients with acute coronary syndrome: an analysis from the Early Glycoprotein IIb/IIIa Inhibition in Patients with
1RQ676HJPHQW(OHYDWLRQ$FXWH&RURQDU\6\QGURPH ($5/<$&6 WULDO&LUFXODWLRQ
 /RSHV 5':KLWH -$7ULFRFL 3 HW DO$JH WUHDWPHQW DQG RXWFRPHV LQ KLJKULVN QRQ67VHJPHQW HOHYDWLRQ DFXWH
FRURQDU\V\QGURPHSDWLHQWV,QVLJKWVIURPWKH($5/<$&6WULDO,QW-&DUGLRO-XO>(SXEDKHDGRISULQW@
 ;LDR=7KpURX[33ODWHOHWDFWLYDWLRQZLWKXQIUDFWLRQDWHGKHSDULQDWWKHUDSHXWLFFRQFHQWUDWLRQVDQGFRPSDULVRQV
ZLWKDORZPROHFXODUZHLJKWKHSDULQDQGZLWKDGLUHFWWKURPELQLQKLELWRU &LUFXODWLRQ
 $QWPDQ (0 0RUURZ '$ 0F&DEH &+HW DO RQ EHKDOI ([75$&77,0,  ,QYHVWLJDWRUV(QR[DSDULQ YHUVXV
XQIUDFWLRQDWHGKHSDULQZLWKEULQRO\VLVIRU67HOHYDWLRQP\RFDUGLDOLQIDUFWLRQ1(QJO-0HG  
(SXE0DU


CAPTULO 11 Tratamiento de los sndromes coronarios agudos

 )HUJXVRQ--&DOLII50$QWPDQ(0HWDORQEHKDOI6<1(5*<7ULDO,QYHVWLJDWRUV(QR[DSDULQYVXQIUDFWLRQDWHG
KHSDULQLQKLJKULVNSDWLHQWVZLWKQRQ67VHJPHQWHOHYDWLRQDFXWHFRURQDU\V\QGURPHVPDQDJHGZLWKDQLQWHQGHG
HDUO\LQYDVLYHVWUDWHJ\SULPDU\UHVXOWVRIWKH6<1(5*<UDQGRPL]HGWULDO-$0$-XO  
 *RRGPDQ6*&RKHQ0%LJRQ]L)HWDO5DQGRPL]HGWULDORIORZPROHFXODUZHLJKWKHSDULQ HQR[DSDULQ YHUVXV
XQIUDFWLRQDWHGKHSDULQIRUXQVWDEOHFRURQDU\DUWHU\GLVHDVHRQH\HDUUHVXOWVRIWKH(66(1&(6WXG\(IFDF\DQG
6DIHW\RI6XEFXWDQHRXV(QR[DSDULQLQ1RQ4:DYH&RURQDU\(YHQWV-$P&ROO&DUGLRO
 7KURPERO\VLVLQ0\RFDUGLDO,QIDUFWLRQ 7,0, %7ULDO,QYHVWLJDWRUV$QWPDQ(07,0,%(QR[DSDULQYHUVXV
XQIUDFWLRQDWHGKHSDULQIRUXQVWDEOHDQJLQDRUQRQ4ZDYHP\RFDUGLDOLQIDUFWLRQDGRXEOHEOLQGSODFHERFRQWUROOHG
SDUDOOHOJURXSPXOWLFHQWHUWULDO5DWLRQDOHVWXG\GHVLJQDQGPHWKRGV$P+HDUW-
 $QWPDQ(00F&DEH&+*XUQNHO(3HWDO(QR[DSDULQSUHYHQWVGHDWKDQGFDUGLDFLVFKHPLFHYHQWVLQXQVWDEOH
DQJLQDQRQ4ZDYHP\RFDUGLDOLQIDUFWLRQ5HVXOWVRIWKHWKURPERO\VLVLQP\RFDUGLDOLQIDUFWLRQ 7,0, %WULDO
&LUFXODWLRQ
 )HUJXVRQ--&DOLII50$QWPDQ(0HWDORQEHKDOI6<1(5*<7ULDO,QYHVWLJDWRUV(QR[DSDULQYVXQIUDFWLRQDWHG
KHSDULQLQKLJKULVNSDWLHQWVZLWKQRQ67VHJPHQWHOHYDWLRQDFXWHFRURQDU\V\QGURPHVPDQDJHGZLWKDQLQWHQGHG
HDUO\LQYDVLYHVWUDWHJ\SULPDU\UHVXOWVRIWKH6<1(5*<UDQGRPL]HGWULDO-$0$
 0XUSK\6$*LEVRQ&00RUURZ'$HWDO(IFDF\DQGVDIHW\RIWKHORZPROHFXODUZHLJKWKHSDULQHQR[DSDULQ
FRPSDUHGZLWKXQIUDFWLRQDWHGKHSDULQDFURVVWKHDFXWHFRURQDU\V\QGURPHVSHFWUXPDPHWDDQDO\VLV (XU+HDUW
-
 Klein W, Buchwald A, Hillis SE et al Comparison of low-molecular-weight heparin with unfractionated heparin
DFXWHO\DQGZLWKSODFHERIRUZHHNVLQWKHPDQDJHPHQWRIXQVWDEOHFRURQDU\DUWHU\GLVHDVH)UDJPLQLQXQVWDEOH
FRURQDU\DUWHU\GLVHDVHVWXG\ )5,& &LUFXODWLRQ
 0LFKDOLV/..DWVRXUDV&63DSDPLFKDHO1HWDO(QR[DSDULQYHUVXVWLQ]DSDULQLQQRQ67VHJPHQWHOHYDWLRQDFXWH
FRURQDU\V\QGURPHVWKH(9(7WULDO$P+HDUW-
 &RXVVHPHQW3.%DVVDQG-3&RQYHQV&HWDORQEHKDOI3(17$/<6(LQYHVWLJDWRUV$V\QWKHWLFIDFWRU;DLQKLELWRU
25*65$ DVDQDGMXQFWWREULQRO\VLVLQDFXWHP\RFDUGLDOLQIDUFWLRQ7KH3(17$/<6(VWXG\(XU
+HDUW-
 <XVXI60HKWD65&KURODYLFLXV6HWDO&RPSDULVRQRIIRQGDSDULQX[DQGHQR[DSDULQLQDFXWHFRURQDU\V\QGURPHV
)LIWK2UJDQL]DWLRQWR$VVHVV6WUDWHJLHVLQ$FXWH,VFKHPLF6\QGURPHV,QYHVWLJDWRUV1(QJO-0HG

 <XVXI60HKWD65&KURODYLFLXV6HWDO2$6,67ULDO*URXS(IIHFWVRIIRQGDSDULQX[RQPRUWDOLW\DQGUHLQIDUFWLRQ
LQ SDWLHQWV ZLWK DFXWH 67VHJPHQW HOHYDWLRQ P\RFDUGLDO LQIDUFWLRQ WKH 2$6,6 UDQGRPL]HG WULDO -$0$

 &RKHQ0%KDWW'/$OH[DQGHU-+HWDORQEHKDOI6(3,$3&,7ULDO,QYHVWLJDWRUV5DQGRPL]HGGRXEOHEOLQGGRVH
UDQJLQJVWXG\RIRWDPL[DEDQDQRYHOSDUHQWHUDOVKRUWDFWLQJGLUHFWIDFWRU;DLQKLELWRULQSHUFXWDQHRXVFRURQDU\
LQWHUYHQWLRQWKH6(3,$3&,WULDO&LUFXODWLRQ
 6DEDWLQH06$QWPDQ(0:LGLPVN\3HWDO2WDPL[DEDQIRUWKHWUHDWPHQWRISDWLHQWVZLWKQRQ67HOHYDWLRQDFXWH
FRURQDU\V\QGURPHV 6(3,$$&67,0, DUDQGRPLVHGGRXEOHEOLQGDFWLYHFRQWUROOHGSKDVHWULDO/DQFHW

 0HJD-/%UDXQZDOG(0RKDQDYHOX6%XUWRQ3HWDORQEHKDOI$7/$6$&67,0,VWXG\JURXS5LYDUR[DEDQ
YHUVXV SODFHER LQ SDWLHQWV ZLWK DFXWH FRURQDU\ V\QGURPHV $7/$6$&67,0,   D UDQGRPLVHG GRXEOHEOLQG
SKDVH,,WULDO/DQFHW
 Gibson CM, Mega JL, Burton P .Rationale and design of the Anti-Xa therapy to lower cardiovascular events in
DGGLWLRQ WR VWDQGDUG WKHUDS\ LQ VXEMHFWV ZLWK DFXWH FRURQDU\ V\QGURPHWKURPERO\VLV LQ P\RFDUGLDO LQIDUFWLRQ 
$7/$6$&67,0, WULDODUDQGRPL]HGGRXEOHEOLQGSODFHERFRQWUROOHGVWXG\WRHYDOXDWHWKHHIFDF\DQG
VDIHW\RIULYDUR[DEDQLQVXEMHFWVZLWKDFXWHFRURQDU\V\QGURPH$P+HDUW-
 0HJD-/%UDXQZDOG(:LYLRWW6'HWDORQEHKDOI$7/$6$&67,0,,QYHVWLJDWRUV5LYDUR[DEDQLQSDWLHQWV
ZLWKDUHFHQWDFXWHFRURQDU\V\QGURPH1(QJO-0HG
 5RH072KPDQ(0$QHZHUDLQVHFRQGDU\SUHYHQWLRQDIWHUDFXWHFRURQDU\V\QGURPH1(QJO-0HG
7


&$3,78/2

INSUFICIENCIA CARDACA
$9$1=$'$<75$163/$17(
CARDACO
HECTOR VENTURA

INTRODUCCIN MANIFESTACIONES CLINICAS


GENERALES DE LA INSUFICIENCIA
CARDACA
Los avances recientes en el tratamiento de la insu-
FLHQFLDFDUGtDFD ,& VHKDQWUDGXFLGRHQPHMRUDV La retencin de lquidos, la disnea y la intolerancia
considerables en la calidad de vida y la supervi- DOHMHUFLFLRVRQORVVtQWRPDVFDUGLQDOHVGHOD,&/D
vencia de los pacientes. Como consecuencia de GLVQHD\ODLQWROHUDQFLDDOHMHUFLFLRVRQGHVHQFDGHQD-
ello, la prevalencia global de la IC y la proporcin dos principalmente durante el esfuerzo en las etapas
de pacientes con IC avanzada est aumentando. A iniciales de la IC. Los pacientes con IC avanzada a
pesar de estos avances, la mortalidad por IC sigue menudo se presentan adems con manifestaciones de
VLHQGRHOHYDGD\VHVLJXHLQFUHPHQWDQGR(O EDMR JDVWR FDUGtDFR WDOHV FRPR LQVXFLHQFLD UHQDO
GHORVKRPEUHV\HOGHODVPXMHUHVDxRV saciedad precoz, falta de apetito, dolores abdomina-
GHHGDGFRQGLDJQyVWLFRGHLQVXFLHQFLDFDUGLDFD les, nuseas, alteraciones cognitivas, etc., que suelen
YDDPRULUGHQWURGHORVDxRV1 ser reversibles con el tratamiento de la IC.

LA POBLACIN DE PACIENTES MANEJO CONVENCIONAL


CON INSUFICIENCIA CARDACA
Programacin Estratgica
+D\ FXDWUR HVWDGLRV GH OD ,& $  '  Los pacien- Se deben hacer todos los esfuerzos posibles para
tes con cardiopata estructural y sntomas previos o LGHQWLFDU \ FRUUHJLU ODV FDXVDV UHYHUVLEOHV WDOHV
actuales de IC entran en el estadio C de IC. Estos como falta de cumplimiento con la dieta y el trata-
pacientes podran ser bien compensados y encontrar- miento farmacolgico, la isquemia del miocardio,
se mnimamente sintomticos o estar hospitalizados taquicarritmias o bradiarritmias, y la enfermedad
con IC descompensada, o tener descompensacio- valvular en pacientes con empeoramiento de la IC,
QHV UHFXUUHQWHV TXH PHMRUDQ FRQ HO WUDWDPLHQWR (O DSHVDUGHWUDWDPLHQWRPpGLFRySWLPR/D7DEOD
estadio D incluye a los pacientes con IC refractaria H[SRQHXQSDQRUDPDJHQHUDOGHORVPHFDQLVPRVGH
TXHUHTXLHUHQLQWHUYHQFLRQHVHVSHFLDOL]DGDV )LJXUD ODLQVXFLHQFLDFDUGLDFD\ODVHVWUDWHJLDVHVSHFLFDV
 (QHVWHFDStWXORVHH[SRQGUDODSUHVHQWDFLyQ del tratamiento de cada uno de ellos.
OD HVWUDWLFDFLyQ GHO ULHVJR \ PDQHMR GH SDFLHQWHV
FRQ LQVXFLHQFLD FDUGtDFD DYDQ]DGD TXH LQFOX\H D Tratamiento farmacolgico
los pacientes con estadio C que requieren hospitali- &RPRHVKDELWXDOHMHUFLFLRUHJXODUODUHVWULFFLyQGH
zaciones frecuentes y el estadio D de la IC. la ingesta de sal y lquidos, los diurticos, los inhi-

* Traducido por Julin Gonzles



J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 12.1. Estadios del desarrollo de la insuciencia cardaca. FHx CM indica historia familiar de miocardiopata. (Modica-
do de Shunt HA et al. J Am Coll Cardiol 2005).

Tabla 12.1. Plan maestro de manejo de la insuciencia cardiaca


Mecanismo Tratamiento especco Tratamiento general
Restauracin quirrgica
de la geometra del
Frmacos inotrpicos,
Depresin severa de la VI, dispositivos de
Dilatacin severa del VI tratamiento del la
FEy contraccin pasiva,
cardiopata isqumica
anuloplasta del anillo
mitral
Sobrecarga del sistema Hipertensin pulmonar Uso juicioso de los B-B para disminuir la FC
derecho con sobrecarga del VD diurticos, TRC y la demanda de O2
Baln de contrapulsacin IECAs-ARBs para revertir
Vasoconstriccin perifrica Sobrecarga del VI
artica la vasoconstriccin
Muerte sbita FV/TV CDI
Bajo gasto DAV izquierdo
Reemplazo del sistema Enfermedad terminal Transplante cardaco
VI, ventrculo izquierdo; Fey, fraccin de eyeccin; VD, ventrculo derecho; TRC, terapia de resincronizacin cardaca; B-B, bloqueantes de los re-
ceptores b-adrenrgicos; FC, frecuencia cardiaca, IECA, inhibidores de la enzima convertidora de angiotensina; ARB, bloqueantes de los receptores
de angiotensina; FV, brilacin ventricular; TV, taquicardia ventricular; CDI, cardiodebrilador implantable; DAV, dispositivo de asistencia ventricular.

bidores de la enzima convertidora de angiotensina ,,\%%PHMRUDQORVVtQWRPDV\GLVPLQX\HQODPRUEL-


,(&$ RORVEORTXHDQWHVGHORVUHFHSWRUHVGHODDQ- lidad y la mortalidad en pacientes con reduccin de la
JLRWHQVLQD $5$,, HQSDFLHQWHVTXHVRQLQWROHUDQWHV funcin sistlica del ventrculo izquierdo. Los diur-
DORV,(&$\ORVEORTXHDQWHV %% FRQVWLWX\HQOD ticos, sobre todo los diurticos de asa, se utilizan para
base del tratamiento de los pacientes con IC. Varios HO WUDWDPLHQWR VLQWRPiWLFR UHWHQFLyQ GH OtTXLGRV 
HQVD\RV FRQWURODGRV FRQ SODFHER GH JUDQ WDPDxR pero no han demostrado disminuir la mortalidad.
han demostrado claramente que los IECA, los ARA El Randomized Aldactone Evaluation Study


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

5$/(6  y el Eplerenone Post Acute Myocardial comitante de beta-bloqueantes con dobutamina puede
,QIDUFWLRQ +HDUW )DLOXUH (IFDF\ DQG 6XUYLYDO 6WX- DWHQXDU HO EHQHFLR GH FXDOTXLHUD GH ORV DJHQWHV /D
G\ ()(62  mostraron que, adems del tratamiento PLOULQRQD XQLQKLELGRUGHODIRVIRGLHVWHUDVD HVSUH-
con IECA, BB y diurticos, la adicin de espirono- ferible a la dobutamina, en pacientes sin hipotensin,
ODFWRQD XQDQWDJRQLVWDGHODDOGRVWHURQDQRVHOHFWL- FRQVLJQRVEDMRJDVWRFDUGtDFRHKLSRSHUIXVLyQ/DIRV-
YD  R HSOHUHQRQD XQ DQWDJRQLVWD GH OD DOGRVWHURQD fodiesterasa es una enzima que descompone el mono-
VHOHFWLYD  UHVSHFWLYDPHQWH PHMRUDQ OD VXSHUYLYHQ- IRVIDWRGHDGHQRVLQDFtFOLFR $03F /DLQKLELFLyQGH
cia y disminuye la frecuencia de hospitalizacin en la misma resulta en un aumento neto en los niveles de
pacientes con sntomas de clase funcional III-IV. AMPc, que a su vez se traduce en los efectos inotr-
La hidralazina y los nitratos deben ser conside- picos positivos. Los efectos de la milrinona son inde-
rados en pacientes con intolerancia a los IECA o los pendientes de los receptores beta-adrenrgicos. Por lo
ARA II, debido a la disfuncin renal o hiperpotase- tanto, el uso de BB no est contraindicado con la mil-
mia, o en pacientes con sntomas persistentes a pesar ULQRQD$PERVDJHQWHV GREXWDPLQD\PLOULQRQD VyOR
del tratamiento con antagonistas del sistema renina- se pueden administrar por va intravenosa y son arrit-
angiotensina-aldosterona y BB en especial en afroa- mognicos. Los inotrpicos positivos han demostrado
mericanos. (O WUDWDPLHQWR FRQ GLJR[LQD VH SXHGH TXHPHMRUDQHOHVWDGRKHPRGLQiPLFR\ORJUDUXQDOLYLR
considerar para el control de la frecuencia cardaca rpido de los sntomas. El uso continuo a largo plazo
HQHOFRQWH[WRGHODEULODFLyQDXULFXODU(QSDFLHQ- produce aumento de la mortalidad, lo que ha generado
WHVFRQLQVXFLHQFLDFDUGLDFDVLVWyOLFDFRQSHUVLVWHQ- cierta alarma. Actualmente slo se considera el uso
FLDGHORVVtQWRPDVDSHVDUGHODWHUDSLDPi[LPDFRQ de la infusin continua inotrpicos como un puente para
,(&$ %% \ GLXUpWLFRV OD GLJR[LQD KD GHPRVWUDGR el trasplante cardaco o tambin pueden ser considera-
reducir los sntomas y disminuir hospitalizaciones. dos para la paliacin de los sntomas en pacientes con
LQVXFLHQFLD FDUGtDFD UHIUDFWDULD TXH QR VRQ HOHJLEOHV
&DUGLRGHVEULODGRULPSODQWDEOH &', \ODWHUDSLD para otros tratamientos.
GHUHVLQFURQL]DFLyQFDUGtDFD 75&
Los pacientes con dilatacin ventricular izquierda e MANEJO AVANZADO
LQVXFLHQFLDFDUGtDFDWLHQHQXQDOWRULHVJRGHPXHU-
te sbita debido a arritmias ventriculares, adems de &LUXJtDGHUHYDVFXODUL]DFLyQPLRFiUGLFD &50
otras causas tales como eventos isqumicos, trastor- La cardiopata isqumica es la causa ms comn de
nos electrolticos y eventos tromboemblicos. Los es- LQVXFLHQFLD FDUGtDFD /D FLUXJtD GH UHYDVFXODUL]D-
tudios MADIT II7, SCD HeFT y COMPANION9 han FLyQ PLRFiUGLFD &50  GHEH VHU FRQVLGHUDGD SDUD
GHPRVWUDGRFODUDPHQWHHOEHQHFLRHQODPRUWDOLGDG ORVSDFLHQWHVFRQHQIHUPHGDGFRURQDULDGHYDVRV\
de un CDI sumado al tratamiento mdico convencio- viabilidad miocrdica demostrable.
nal en pacientes con miocardiopata dilatada isqumi- Medicina Basada en la Evidencia. CRM vs. Trata-
ca y no isqumica con fraccin de eyeccin del ventr- miento Mdico.(O%DQFRGH'DWRVGH'XNHHVXQHVWX-
FXORL]TXLHUGR )(\9, /DVJXtDVDPHULFDQDV\ dio observacional de uni centrico.  Los pacientes que
europeas para el tratamiento de la IC recomiendan un fueron sometidos a cateterismo cardaco por primera
implante de CDI en todos los pacientes con miocar- vez y en los que se observ que tenan una estenosis =
diopata dilatada isqumica o no isqumica con FEyVI HQGHORVSULQFLSDOHVYDVRVHSLFiUGLFRV\)(-
 FX\D VXSHUYLYHQFLD FRQ XQD EXHQD FDSDFLGDG \9, FRQ1<+$FODVH,,RPiVVtQWRPDVIXHURQ
IXQFLRQDOVHHVWLPHPD\RUDDxR FODVLFDGRVHQGRVJUXSRVDFRUGHDOWUDWDPLHQWRUHFLEL-
Todos los pacientes con clase funcional III-IV de GRHQORVGtDVVLJXLHQWHVDOGLDJQyVWLFRDQJLRJUiFR
la IC, con evidencia de asincrona auriculoventricu- WUDWDPLHQWRPpGLFR Q  R&50 Q  'HQWUR
ODU SRU HO HOHFWURFDUGLRJUDPD GXUDFLyQ GHO 456! GHORVSULPHURVGtDVHOWUDWDPLHQWRPpGLFRWXYRXQ
PV GHEHQVHUFRQVLGHUDGRVSDUD75& EHQHFLRGHVXSHUYLYHQFLDVREUHOD&50SDUDHQIHUPH-
GDGGH\YDVRV 3 SDUDYDVR\S SDUD
Tratamiento con inotrpicos por va intravenosa YDVRV 3DUDODHQIHUPHGDGGHYDVRVQRKXERGLIH-
Los agentes inotrpicos positivos se indican en la in- UHQFLDVLJQLFDWLYDHQWUHHOWUDWDPLHQWRPpGLFR\ODFL-
VXFLHQFLDFDUGLDFDDJXGDGHVFRPSHQVDGDFRQFRQJHV- UXJtD S  (QHOSHUtRGRGHVHJXLPLHQWRDPiVGH
WLyQSXOPRQDU\VLJQRVGHKLSRSHUIXVLyQ VKRFNFDUGLR- GtDVGHVGHHOLQLFLRODVXSHUYLYHQFLDJOREDODMXVWDGD
JpQLFR /DGREXWDPLQD XQDJRQLVWDEHWDDGUHQpUJLFR  D YV  YV \ YV 
VHUHFRPLHQGDSDUDHOWUDWDPLHQWRGHSDFLHQWHVFRQEDMR DxRVIDYRUHFLyIXHUWHPHQWH&50VREUHHOWUDWDPLHQWR
gasto cardaco y la presin arterial reducida. El uso con- PpGLFR S 

171
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

La viabilidad miocrdica. La viabilidad del miocar- La restauracin quirrgica de la geometra


dio puede evaluarse utilizando diversas modalida- ventricular izquierda
des como la tomografa por emisin de positrones Se estn estudiando tcnicas quirrgicas que reduzcan
3(7  FRQ XRURGHVR[LJOXFRVD )'*  WRPRJUDItD el volumen del ventrculo izquierdo y restauren la
SRUHPLVLyQGHIRWyQ~QLFR 63(&7 FRQWDOLR forma elptica del mismo. El International Recons-
tecnecio-99m sestamibi o el tecnecio-99m tetrofos- tructive Endoventricular Surgery returning Torsion
mina, la ecocardiografa de estrs con dobutamina Original Radius Elliptical para el ventrculo izquier-
'6(  \ OD UHVRQDQFLD PDJQpWLFD 50  FRQ JDGR- GR 5(6725( PRVWUyTXHODUHVWDXUDFLyQYHQWULFX-
linio. Hay una fuerte asociacin entre la viabilidad ODU TXLU~UJLFD HV DOWDPHQWH HFD] HQ OD PHMRUD GH OD
PLRFiUGLFDHQORVHVWXGLRVQRLQYDVLYRV\ODPHMRUtD IXQFLyQYHQWULFXODUPHMRUDGHODFODVHIXQFLRQDOGHOD
de la sobrevida despus de la revascularizacin en 1<+$\ODGLVPLQXFLyQGHODVKRVSLWDOL]DFLRQHVSRU
los pacientes con enfermedad coronaria y disfuncin LQVXFLHQFLD FDUGLDFD HQ SDFLHQWHV FRQ FDUGLRSDWtD
sistlica del ventrculo izquierdo. Para los pacientes isqumica.19 Sin embargo, el Surgical Treatment for
FRQYLDELOLGDGPLRFiUGLFDGHQLGDODUHYDVFXODUL]D- ,VFKHPLF+HDUW)DLOXUH 67,7&+75,$/ QRPRVWUy
FLyQUHVXOWyHQXQDUHGXFFLyQGHGHOULHVJRGH una diferencia en los sntomas, la tasa de muerte u hos-
muerte en comparacin con el tratamiento mdico. pitalizacin entre los pacientes que fueron tratados con
Para los pacientes sin viabilidad, la mortalidad anual &50VRODIUHQWHDOD&50MXQWRFRQODUHVWDXUDFLyQ
QRIXHVLJQLFDWLYDPHQWHGLIHUHQWHVHJ~QHOPpWRGR ventricular. Estas tcnicas quirrgicas no se reco-
GHWUDWDPLHQWRFRQUHYDVFXODUL]DFLyQIUHQWHDO miendan en forma rutinaria en la actualidad.
FRQWUDWDPLHQWRPpGLFR S QV  Los avances
recientes en resonancia magntica con realce tardo Anuloplastia mitral
KDQKHFKRDpVWHPpWRGRDOWDPHQWHHVSHFtFR\VHQ- La anuloplastia mitral en pacientes con regurgita-
VLEOHVLQHPEDUJRD~QHVXQDWpFQLFDH[SHULPHQWDO FLyQ PLWUDO VLJQLFDWLYD D\XGD D UHYHUWLU HO UHPR-
GHODGRDGYHUVR\VHKDGHPRVWUDGRTXHPHMRUDORV
5HYDVFXODUL]DFLyQWUDQVPLRFiUGLFDFRQOiVHU sntomas en pacientes con miocardiopata dilatada
Otras tcnicas novedosas como la revascularizacin terminal. Un anlisis retrospectivo reciente, sin
transmiocrdica con lser y la implantacin percut- HPEDUJR QR PRVWUy QLQJ~Q EHQHFLR VLJQLFDWLYR
nea intramiocrdica de clulas de mdula sea aut- en la mortalidad a largo plazo en los pacientes con
logas estn siendo investigados en el tratamiento de regurgitacin mitral con disfuncin ventricular iz-
pacientes con enfermedad arterial coronaria refrac- quierda severa. La reparacin de la vlvula mitral
taria o terminal no susceptible de una intervencin QRVHUHFRPLHQGDSDUDORVSDFLHQWHVFRQLQVXFLHQ-
coronaria percutnea o ciruga de revascularizacin cia cardaca avanzada.
coronaria. Los primeros estudios han mostrado una
PHMRUDHQODDQJLQD\ODFDSDFLGDGIXQFLRQDOHQSD- 'LVSRVLWLYRVPHFiQLFRVGHDSR\R )LJXUD
cientes con angina severa. Se deben realizar en- /D LQVXFLHQFLD FDUGtDFD GHVFRPSHQVDGD VHYHUD VH
sayos aleatorios controlados de mayor envergadura FDUDFWHUL]DSRUODVREUHFDUJDGHOtTXLGRVEDMRJDVWR
para establecer la utilidad clnica de estas tcnicas en cardaco, hipotensin y resistencia a los diurticos.
el tratamiento de la enfermedad arterial coronaria. Los dispositivos mecnicos de asistencia circulato-

Tabla 12.2. Diferentes tipos de dispositivos de asistencia ventricular


Dispositivo Ubicacin Mecanismo Conguracin
BBIA Extracoprea Pulstil DAVi
Impella Extracoprea Flujo Continuo DAVi
ABIOMED BVS Extracoprea Pulstil DAVi/DAVd/DAVbi
JARVIK 2000 Intracoprea Flujo Continuo DAVi
De Bakey VAD Intracoprea Flujo Continuo DAVi
Novacor LVAS Intracoprea Pulstil DAVi
Thoratec Intracoprea Pulstil DAVi/DAVd/DAVbi
Heart Mate XVE Intracoprea Pulstil DAVi
Heart Mate II Intracoprea Flujo Continuo DAVi
BBIA, bomba de baln intra-artica; DAVi, dispositivo de asistencia ventricular izquierdo; DAVd, dispositivo de asistencia ventricular derecho;
DAVbi, dispositivo de asistencia ventricular biventricular;


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

ULDFRPRODERPEDGHEDOyQLQWUDDyUWLFR %%,$ R Cundo se indica un dispositivo de asistencia


GLVSRVLWLYRV GH DVLVWHQFLD YHQWULFXODU '$9  VH XWL- YHQWULFXODU\TXHWLSR"/RV'$9L]TXLHUGRVVHXWLOL-
lizan cada vez ms en tales situaciones. La BBIA se zan actualmente como un puente al trasplante car-
KD FRQYHUWLGR HQ HO VLVWHPD FLUFXODWRULR PiV HFD] diaco hasta la aparicin del donante, o como terapia
y ampliamente utilizado dispositivo de asistencia. de reemplazo en pacientes que no son candidatos a
(VWi LQGLFDGR HQ XQ HVWDGR GH EDMR JDVWR FDUGtDFR trasplante cardaco. En la actualidad, el DAV Tho-
en pacientes con IC avanzada, como un puente has- ratec implantable, el HeartMate XVE, el HeartMate
WD HO WUDVSODQWH R HQ OD LQVXFLHQFLD FDUGLDFD DJXGD II y el DAV izquierdo Novacor son los dispositivos
descompensada. El uso de BBIA se ve limitada por aprobados para el puente al trasplante, mientras que el
la naturaleza invasiva del procedimiento, la restric- HeartMate XVE es el nico dispositivo aprobado para
cin de la movilidad de los pacientes, el riesgo de el tratamiento de reemplazo. Las principales compli-
trombo-embolia, sangrado e infeccin. Los DAV son caciones asociadas con los DAV incluyen sangrado,
bombas mecnicas que ayudan al ventrculo que fa- infeccin y mal funcionamiento del dispositivo. El
OOD L]TXLHUGRRGHUHFKR HQHOPDQWHQLPLHQWRGHXQD fallo temporal del ventrculo derecho inmediatamente
FLUFXODFLyQDGHFXDGD  6HGHQHQFRPRSXOViWLOR despus de la colocacin de un DAV izquierdo puede
FRQWLQXREDVDGRHQVXXMR\FRPRH[WUDFRUSyUHD RFXUULUHQHOGHORVSDFLHQWHVTXHVXHOHQUHTXHULU
paracorprea o intracorprea basado en el sitio de frmacos inotrpicos o un DAV derecho.
LPSODQWDFLyQ 7DEOD /RV'$9L]TXLHUGRVVRQ /RV QXHYRV GLVSRVLWLYRV GH XMR FRQWLQXR 'H-
ms comnmente utilizados que los derechos. %DNH\9$'+HDUW0DWH,,\HO-DUYLN RIUHFHQ
XQD YHQWDMD VREUH ORV GLVSRVLWLYRV GH XMR SXOViWLO
SRUVXPHQRUWDPDxRPD\RUGXUDELOLGDG\XQPHQRU
riesgo de infeccin, ya que los ltimos estn limita-
GRVSRUVXJUDQWDPDxRHOULHVJRGHIDOORGHOGLVFR\
ODLQIHFFLyQ(O-DUYLNHVXQDQXHYDERPEDGH
XMR D[LDO GHO LPSXOVRU HQ OD DFWXDOLGDG REMHWR GH
LQYHVWLJDFLyQ TXH HV PiV SHTXHxR WRWDOPHQWH LP-
plantable y silencioso con un riesgo potencialmente
menor de infecciones, trombosis y la hemlisis y, por
ORWDQWRSURPHWHQVHUPHMRUHVGLVSRVLWLYRV
Medicina Basada en la Evidencia. El REMATCH
5DQGRPL]HG (YDOXDWLRQ RI 0HFKDQLFDO $VVLVWDQFH
IRU WKH 7UHDWPHQW RI &RQJHVWLYH +HDUW )DLOXUH  HV
un ensayo aleatorio que compara DAV izquierdo
+HDUW0DWH ;9(  FRQ WUDWDPLHQWR PpGLFR Se
DVLJQDURQ  SDFLHQWHV FRQ VtQWRPDV GH FODVH
1<+$ ,9 TXH VH FRQVLGHUDURQ FDQGLGDWRV SDUD
trasplante cardaco a la implantacin de asistencia
YHQWULFXODUL]TXLHUGD Q  RODQRUPDGHPDQHMR
PpGLFR Q   +XER XQD UHGXFFLyQ VLJQLFDWLYD
GHO  HQ OD PRUWDOLGDG SRU FXDOTXLHU FDXVD HQ
el grupo de asistencia ventricular izquierda en
comparacin con el grupo de tratamiento mdico
ULHVJR UHODWLYR  ,& GHO  LQWHUYDOR GH
Figura 12.2. Un Dispositivo de asistencia Ventricular (DAV)
Izquierdo intracorporal y sus componentes. La cnula de FRQDQ]D >,&@  S    /D FDOLGDG
inujo se inserta en el apex del ventrculo izquierdo, y la GH YLGD PHMRUy VLJQLFDWLYDPHQWH DO DxR HQ HO
cnula de eujo se anastomosa con la aorta ascendente. grupo de dispositivos. La tasa de supervivencia a
La sangre que regresa de los pulmones hacia el corazn iz-
 DxR IXH VLJQLFDWLYDPHQWH PD\RU HQ HO JUXSR GH
quierdo sale a travs del apex del ventrculo izquierdo a travs
de la vlvula de inujo hacia la cmara de bombeo. Luego asistencia ventricular izquierda que en el grupo de
la sangre es activamente impulsada a travs de la vlvula de WUDWDPLHQWR PpGLFR  \  UHVSHFWLYDPHQWH
eujo hacia la aorta ascendente. La cmara de bombeo se 3    /DV WDVDV GH VXSHUYLYHQFLDD  DxRV QR
sita en la pared abdominal. Una lnea percutnea lleva el
IXHURQ VLJQLFDWLYDPHQWH GLIHUHQWHV  \ 
cable electric y la ventilacin a la bacteria y los controles
electrnicos, que se ubican en una funda en el hombro iz- UHVSHFWLYDPHQWH  /DV FRPSOLFDFLRQHV LQIHFFLRQHV
quierdo. (Modicado de Goldstein DJ et al NEJM 1998). VDQJUDGR \  PDO IXQFLRQDPLHQWR GHO GLVSRVLWLYR 


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

IXHURQ  YHFHV PiV IUHFXHQWHV HQ HO JUXSR GH el estiramiento del miocardio y la tensin de la pared
asistencia ventricular izquierda que en el grupo de YHQWULFXODU \HO0\RVSOLQW TXHFRQVWDGHWUHVP\RV-
tratamiento mdico. SOLQWV FRORFDGRV SHUSHQGLFXODUPHQWH DO HMH ODUJR GHO
Los pacientes que reciben el HeartMate como un YHQWUtFXOR L]TXLHUGR KDFLD HO LQWHULRU GLVHxDGDV SDUD
SXHQWHSDUDHOWUDVSODQWHSXHGHWHQHUXQPHMRUUHVXO- UHGXFLUODWHQVLyQGHODSDUHGPLRFiUGLFD (OGLVSR-
tado en comparacin con los pacientes tratados con VLWLYRGH$FRUQKDGHPRVWUDGRPHMRUDUHOWDPDxR\OD
tratamiento mdico.$SHVDUGHODPHMRUDGHUH- funcin sistlica del ventrculo izquierdo, y revierte la
sultados con el HeartMate, el riesgo potencial versus UHPRGHODFLyQHKLSHUWURDFHOXODUHQHVWXGLRVSUHFOt-
ORVEHQHFLRVHQFRPSDUDFLyQFRQVRSRUWHLQRWUySLFR nicos. Se ha demostrado que la implantacin del
debe tenerse en cuenta en el paciente individual. 0\RVSOLQWGLVPLQX\HHOHVWUpVGHOPLRFDUGLR\PHMRUD
la FEyVI en un modelo canino. Su seguridad y la
Dispositivos pasivos de restriccin ventricular utilidad en el ser humano se est evaluando.
Algunos dispositivos menos populares en investiga-
cin en la actualidad incluyen el Dispositivo de Ayuda 8Q'$9L]TXLHUGRPiVIiFLOGHXVDU
&DUGtDFD$FRUQ XQDPDOODGHSROLpVWHUELRFRPSDWLEOH &RQXQSHVRGHJUDPRV\XQYROXPHQPHQRUTXH
GLVHxDGRSDUDHQYROYHUDOUHGHGRUGHORVGRVYHQWUtFX- el del pulgar de un hombre, una bomba basada en un
ORVTXHRIUHFHDSR\RGHQGHGLiVWROHSDUDUHGXFLU URWRU 6LQHUJLD&LUFX/LWH6DGGOH%URRN1- SURSRU-

Tabla 12.3. Criterios de seleccin para transplante cardaco

Miocardiopata Pacientes con enfermedades cardacas que no responden al tratamiento mdico completo (ej:
cardiopata isqumica en pacientes no candidatos a CRM/PTCA, miocardiopata dilatada, enfermedades valvu-
lares en pacientes no candidatos a correccin quirrgica de la misma, cardiopata hipertensiva, miocardiopata
hipertrca, cardiopatas congnitas no pasibles de correccin quirrgica sin hipertensin pulmonar ja.
Arritmias intratables Pacientes con arritmias no controladas con CDI, no pasibles de tratamiento guiado por
estudios electrosiolgicos, no candidatos a terapia de albacin.
Lmite de edad Pacientes = 70 aos deben ser considerados siempre para transplante. Pacientes mayores pue-
den ser considerados si la condicin clnica lo permite.
Lmite de peso Se recomienda que el ndice de Masa Corporal sea < 30 kg/m2 o que el porcentaje del peso
ideal no exceda el 140%. Los pacientes obesos tienen mayor riesgo de cicatrizar mal, desarrollar trombosis
venosas, infecciones y complicaciones pulmonares.
Diabetes Los pacientes con diabetes que presentan dao de rgano blanco diferente de retinopata no proli-
ferativa o que tienen mal control metablico (HbA1c > 7,5%) presentan una contraindicacin relativa.
Insuciencia Renal La presencia de insuciencia renal irreversible (con un ltado glomerular < 40 ml/min es una
contraindicacin relativa. Se puede considerar la posibilidad de un transplante combinado cardaco y renal.
Enfermedad Vascular Cerebral y Perifrica Los pacientes con secuelas severas de accidentes cerebrovascu-
lares representan una contraindicacin relativa. Los pacientes con enfermedad arterial perifrica que limite la
rehabilitacin y no sean pasibles de revascularizacin tambin presentan una contraindicacin relativa.
Neoplasias Las neoplasias malignas activas de cualquier origen excepto la piel son una contraindicacin ab-
soluta para recibir un transplante. Si el paciente se encuentra libre de enfermedad, de acuerdo al tipo de tumor
primario, el paciente puede ser considerado para transplante cardaco. Aquellos pacientes que se encuentran
libres de enfermedad por 5 aos o ms, independientemente del tumor primario pueden ser considerados can-
didatos al transplante.
Otras comorbilidades Otras patologas sistmicas como la amiloidosis, la sarcoidosis, o algunas infecciones
activas como la infeccin por el virus de la inmunodeciencia humana (VIH) son consideradas criterios de
exclusin para recibir un transplante.
Aspectos psicosociales Todos los pacientes candidatos a transplantarse deben ser evaluados en su capacidad
para prestar consentimiento informado, cumplir con las indicaciones. El retraso mental y la demencia son con-
traindicaciones relativas.
Tabaquismo y abuso de sustancias El tabaquismo activo es una contraindicacin relativa. El tabaquismo activo
en los ltimos 6 meses es un factor de riesgo para sufrir malos resultados luego de un transplante. Los pacien-
tes que en el presente presentan adiccin a alguna sustancia (incluido el alcohol) no deben ser considerados
candidatos al transplante.


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

ciona asistencia ventricular parcial y refuerza la he- los corazones de donantes que hay disponibles. El
modinmia en lugar de sobrepasarla. En una primera trasplante cardaco se debe limitar a los pacientes
H[SHULHQFLDKXPDQDFRQSDFLHQWHVFRQLQVXFLHQ- TXH WLHQHQ PiV SUREDELOLGDGHV GH EHQHFLDUVH GH
FLDFDUGtDFDDYDQ]DGD QLYHO,17(50$&6 HQWUD- pO FRQ XQD PHMRUD VLJQLFDWLYD HQ ORV VtQWRPDV \
tamiento ambulatorio y sin tratamiento con inotrpi- la esperanza de vida. Los criterios de inclusin de
cos, que estaban en lista de espera o fueran aptos para la SITCP son una buena gua para los centros de
XQWUDVSODQWHGHFRUD]yQODERPEDGH6LQHUJLDORJUz WUDVSODQWHVDORVHIHFWRVGHHVWUDWLFDUHOULHVJR\
QRWDEOH DOLYLR VXEMHWLYR PHMRUy VX SUHVLyQ DUWHULDO seleccionar los pacientes candidatos a ser trans-
media, su presin de enclavamiento capilar pulmo- plantados. La cardiomiopata no isqumica y la
nar media y el ndice cardaco el primer da de la im- enfermedad coronaria son las indicaciones ms
SODQWDFLyQ/RVEHQHFLRVVHPDQWXYLHURQGXUDQWHXQ frecuentes para el trasplante de corazn. Las indi-
promedio de alrededor de 11 semanas. Los pacientes caciones y contraindicaciones para el trasplante de
con la bomba presentaron una presin arterial media FRUD]yQVHGHWDOODQHQOD7DEOD\HOFDOHQGDULR
PP+JPD\RU S  \XQtQGLFHFDUGtDFR recomendado para la evaluacin y seguimiento en
SRUOPLQPPD\RU S /DSUHVLyQPHGLD OD7DEOD
GH DUWHULD SXOPRQDU GLDVWyOLFD GLVPLQX\y HQ  PP
+J S  /DPHGLDGH92 pico se increment 0pWRGRVSDUDOD(VWUDWLFDFLyQGHORV3DFLHQWHV
GHPONJPLQDPONJPLQ S   Prueba de esfuerzo cardiopulmonar (CPX). La in-
WROHUDQFLDDOHMHUFLFLRHVXQRGHORVSULQFLSDOHVPDU-
TRANSPLANTE CARDACO cadores de gravedad de la enfermedad en pacientes
El trasplante cardaco es el tratamiento de elec- FRQLQVXFLHQFLDFDUGtDFDFUyQLFD/D&3;HVXQD
FLyQSDUDORVSDFLHQWHVFRQLQVXFLHQFLDFDUGtDFD prueba bien establecida para determinar el prons-
refractaria al tratamiento mdico. Los datos del in- WLFRGHORVSDFLHQWHVFRQLQVXFLHQFLDFDUGtDFDFUy-
IRUPHGHOUHJLVWURGHOD6RFLHGDG,QWHUQDFLR- nica y es habitualmente utilizado en la evaluacin
QDO GH 7UDVSODQWH GH &RUD]yQ \ 3XOPyQ 6,7&3  de la aptitud para el trasplante cardaco. La capa-
mostr que la supervivencia de los pacientes a 1 FLGDGGHHMHUFLFLRVHSXHGHFXDQWLFDUFOtQLFDPHQ-
\  DxRV OXHJR GH UHFLELU XQ WUDVSODQWH FDUGtDFR WH PHGLDQWH OD PHGLFLyQ GHO FRQVXPR GH R[tJHQR
IXH GH DSUR[LPDGDPHQWH  \  SRU FLHQWR UHV- 92 ODSURGXFFLyQGHGLy[LGRGHFDUERQR 9&2 
SHFWLYDPHQWH )LJXUD  Los avances recien- \ODYHQWLODFLyQSRUPLQXWRGXUDQWHHOHMHUFLFLRFRQ
tes en el tratamiento mdico y en los dispositivos analizadores de gases de respuesta rpida. El VO
KDQ PHMRUDGR OD VXSHUYLYHQFLD GH ORV SDFLHQWHV medido directamente ha demostrado ser un marca-
FRQLQVXFLHQFLDFDUGtDFDDQLYHOHVFRPSDUDEOHVD GRU UHSURGXFLEOH GH OD WROHUDQFLD DO HMHUFLFLR HQ OD
la de los pacientes que se transplantan. Hay ms LQVXFLHQFLDFDUGtDFDFUyQLFD\SDUDSURSRUFLRQDU
pacientes que necesitan trasplante de corazn que LQIRUPDFLyQ REMHWLYD \ DGLFLRQDO FRQ UHVSHFWR D OD

Figura 12.3. Curva de superviviencia de Kaplan-Meier para pacientes transplantados adultos y peditricos entre Enero de 1982
y Junio de 2006. Vida media condicional = tiempo de superviviencia de la mitad de la cohorte que sobrevivieron al primer ao
post-transplante. (Modicado de Taylor DO et al. J Heart Lung Transplant. 2008;27:943-56).


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

situacin clnica del paciente y los factores que li- mitidos para trasplante cardaco, los pacientes fue-
PLWDQ HO UHQGLPLHQWR GHO HMHUFLFLR 'XUDQWH HO DX- URQ GLYLGLGRV HQ  JUXSRV HQ IXQFLyQ GH ORV GDWRV
PHQWR GH OD FDUJD GH WUDEDMR HO FRQVXPR Pi[LPR GHOHMHUFLFLR(QHOJUXSRVHLQFOX\HURQSDFLHQWHV
GH R[tJHQR 92 PD[  QDOPHQWH OOHJD D XQD PH- con VOSLFR PONJPLQTXHIXHURQDFHSWDGRV
seta en los individuos normales. Los pacientes con FRPR FDQGLGDWRV D WUDVSODQWH HO JUXSR  LQFOX\y D
LQVXFLHQFLDFDUGtDFDUDUDYH]OOHJDQDXQDPHVHWD pacientes con VO SLFR!PONJPLQDTXLHQHV
UHDOGHFRQVXPRGHR[tJHQRFRQODVFDUJDVGHWUDED- se consider en una buena condicin clnica que no
MRFUHFLHQWHV\SRUORWDQWRHOWpUPLQRSLFRGH92 UHTXHUtDWUDVSODQWH\HOJUXSRLQFOX\yDSDFLHQWHV
se utiliza en lugar de la VOPi[8Q92 pico de con pico de VO PONJPLQTXHIXHURQUHFKD-
PONJPLQVHFRQVLGHUDQRUPDO zados para el trasplante por razones no cardacas, ta-
Medicina Basada en la Evidencia, VO2 pico y la les como cncer o enfermedad pulmonar avanzada,
supervivencia despus del trasplante cardaco. En que sirvi como grupo control. Los pacientes con un
XQHVWXGLRTXHLQFOX\yVXMHWRVFRQVHFXWLYRVUH- pico de VO!PONJPLQ *UXSR WHQtDWDVDVGH

Tabla 12.4. Esquema de seguimiento recomendado para la evaluacin del transplante cardiaco
Repetir
Prueba Base 3 meses 6 meses 9 meses 12 meses
Historia y examen fsico completos X
Evaluacin de seguimiento X X X X
Peso/IMC X X X X X
Inmunocompatibilidad
Grupo Sanguneo ABO X
Repetir ABO X
Slo al
Tipicacin HLA momento del
transplante
PAR y citometra de ujo X

> 10 % Cada 2 meses

DAV Cada 2 meses

2 semanas
Transfusiones luego del X X
transplante
Evaluacin de la severidad de la IC
Test de ejercitacin cardiopulmonar (Razn
X X
de intercambio respiratoria)
Ecocardiograma X X
Cateterismo derecho (con prueba de
X X X
vasodilatadores si est indicada)
ECG X X
Evaluacin funcional multiorgnica
Laboratorio de rutina (hemograma,
X X X X X
hepatograma, glucemia, perl lipdico)
Coagulograma (especialmente
X X X X X
anticoagulados y DAV)
Orina completa X X X X X
VFG (por MDER) X X X X X
Proteinuria 24 hs X X X X X
Contina en pgina siguiente


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

Pruebas de Funcin Pulmonar (con gases


X
arteriales)
RxTx FyP X X
Ecografa abdominal X
Doppler carotdeo (en > 50 aos o con
X
indicacin precisa)
ITB (en > 50 aos o con indicacin
X
precisa)
AXED (en > 50 aos o con indicacin
X
precisa)
Examen odontolgico X X
Examen oftalmolgico (diabticos) X X
Serologas y vacunacin
Hepatitis B Ag supercie X
Hepatitis B Atc supercie X
Hepatitis B Atc anti core X
Hepatitis C Atc X
VIH X
RPR X
Virus Hespes Simplex IgG X
Citomegalovirus IgG X
Toxoplasmosis IgG X
Virus Epstein-Barr IgG X
Virus Varicela Zoster IgG X
Reaccin de Mantoux X
Vacuna antigripal (anual) X X
Vacuna antineumocccica (cada 5 aos) X
Vacuna contra Hepatitis B (0; 30 y 180 das) X
6 meses
Hepatitis B Atc supercie (post despus de la
inmunizacin) tercera dosis de
la vacuna
Deteccin de enfermedades oncolgicas X
Sangre oculta en materia fecal (x 3) X
Colonoscopa (en > 50 aos o con
X X
indicacin precisa)
Mamografa (en > 40 aos o con
X X
indicacin precisa)
Gin/PAP (= 18aos o sexualmente activa) X X
APE examen rectal digital (hombres > 50
X X
aos)
Otras evaluaciones
Trabajador social X
Psiquitrica X
Financiera X
Neuropsiquitrica (si se considera
X
apropiado)
IMC, ndice de masa corporal; HLA, human leucocyte antigen; PAR panel de anticuerpos reactivos; DAV, dispositivo de asistencia ventricular;
IC, insuciencia cardaca; ECG, electrocardiograma; VFG, volumen de ltrado glomerular; MDER, modication de la dieta em enfermedad
renal; RxTx, radiografa de trax; FyP, frente y perl; ITB, ndice tobillo brazo; AXED absorbimetra con rayos X de energa dual; Ag, antgeno;
Atc, anticuerpo; VIH, virus de la inmunodeciencia humana; RRP, reactante rpido del plasma; IgG, inmunoglobulina G; APE, antgeno
prosttico especco. Reproducido y traducido con autorizacin de Francis GS et al., Circulation. 2010;122:644-672

177
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

VXSHUYLYHQFLD  DO DxR \ GHO  D ORV  DxRV mente en el criterio de medicin de un pico de VO.
que eran iguales a los niveles de supervivencia des-
pus del trasplante. Por el contrario, los pacientes del La escala Heart Failure Survival Score
JUXSRWHQtDXQDVXSHUYLYHQFLDDDxRGH\ Se han desarrollado varios modelos para predecir la
ORVGHOJUXSRWHQtDQWDVDVGHVXSHUYLYHQFLDGHVyOR VXSHUYLYHQFLDHQSDFLHQWHVFRQLQVXFLHQFLDFDUGtD-
HO\HQ\DxRVUHVSHFWLYDPHQWH(QWUH FD /D (VFDOD +HDUW )DLOXUH 6XUYLYDO 6FRUH +)66 
ORVSDFLHQWHVGHOJUXSRORVSDFLHQWHVFRQSLFRGH 7DEOD  y el Seattle Heart Failure Model XQ
VO PONJPLQWXYLHURQODPHQRUVXSHUYLYHQ- programa interactivo que ayuda a estimar la super-
FLDPLHQWUDVTXHDTXHOORVHQWUH\PONJPLQ YLYHQFLDD\DxRV\HOEHQHFLRGHODDGLFLyQ
tena un resultado que era slo ligeramente peor que de medicamentos o dispositivos para un paciente in-
los pacientes en el grupo 1. dividual, que est disponible en www.SeattleHeart-
La VO pico vara segn el gnero, la edad y el )DLOXUH0RGHORUJ  VRQ ORV PRGHORV PiV XWLOL]DGRV
peso corporal magro. Se ha sugerido que la VO pico para predecir la supervivencia en pacientes ambula-
corregida en funcin de estos factores puede ser aun WRULRV(O(QKDQFHG)HHGEDFNIRU(IIHFWLYH&DUGLDF
ms preciso. La medicin de la VO en pacientes 7UHDWPHQW ()(&72  GLVSRQLEOHHQHOVLWLRZHEGH
con IC, se encuentra limitada por la falta de condi- KWWSZZZFFRUWFD&+)ULVNPRGHODVS  \ HO $FX-
FLyQItVLFDODIDOWDGHPRWLYDFLyQODGLFXOWDGSDUD te Decompensated Heart Failure National Registry
KDFHUHMHUFLFLRFRQDSDUDWRVGHPHGLFLyQ\ODFRP- $'+(5( VRQPRGHORVUDPLFDGRVGHULHVJRSDUD
posicin corporal. Factores tales como la prdida de SUHGHFLUODPRUWDOLGDGDGtDV\XQDxRHQSDFLHQWHV
condicionamiento muscular severo, enfermedad ar- hospitalizados con IC aguda descompensada.
WHULDO SHULIpULFD DUWULWLV DQJLQD GH SHFKR R OD EDMD &XiO HV HO PHMRU PRGHOR GH SUHGLFFLyQ SDUD
PRWLYDFLyQGHOSDFLHQWHGHEHQVHUH[FOXLGRVFRQHO SUHGHFLUODPRUWDOLGDGHQSDFLHQWHVFRQLQVXFLHQ-
Q GH LQWHUSUHWDU FRUUHFWDPHQWH XQ &3; 0HGLGDV FLD FDUGLDFD" /D ,QWHUQDWLRQDO 6RFLHW\ IRU +HDUW
adicionales de CPX como el ndice de intercambio and Lung Transplantation recomienda el uso de
UHVSLUDWRULR 5(5  9&2/VO  OD FXUYD GH YHQWL- la HFSS para determinar el pronstico y la lista de
ODFLyQGLy[LGR GH FDUERQR 9(9&2  SXHGHQ VHU espera para el trasplante en pacientes ambulatorios
~WLOHV \ VRQ PHMRUHV LQGLFDGRUHV GH SURQyVWLFR HQ FRQLQVXFLHQFLDFDUGLDFDVREUHWRGRHQSDFLHQWHV
SDFLHQWHVFRQSUXHEDVGHHMHUFLFLRVXEPi[LPR/DV cuya VOVHHQFXHQWUDHQYDORUHVOLPtWURIHV !\
recomendaciones actuales para el uso de parmetros PONJPO 6LQHPEDUJR+)66VHGHVDUUROOyD
GH&3;SDUDHVWUDWLFDUDORVSDFLHQWHVFDQGLGDWRVD SDUWLUGHXQVXEFRQMXQWRGHSDFLHQWHVWUDWDGRVVyOR
WUDVSODQWHJXUDQHQOD7DEOD/DHVWUDWLFDFLyQ FRQ LQKLELGRUHV GH OD (&$ GLJR[LQD \ GLXUpWLFRV
de los pacientes no se debe realizar basndose nica- En la actual era de los bloqueadores beta, CRT y

Tabla 12.5. Recomendaciones para el test de Ejercicio Cardiopulmonar para guiar la lista de transplante

Una clase CPX mxima se dene como la que tiene un Respiratory Exchange Ratio (RER) > 1.05
y alcanza un umbral anaerobico en tratamiento farmacologico optimo (Nivel de evidencia : B).
En pacientes intolerantes a -bloqueantes, debe emplearse un punto de corte de VO2 pico de =
Clase I
14 ml/kg/min (Nivel de evidencia: B).
En presencia de -bloqueantes, debe emplearse un punto de corte de VO2 pico de = 12 ml/kg/min
(Nivel de evidencia: B).
En pacientes jovenes (<50 aos) y mujeres, es rasonable considerer el uso de criterios alternativos
Clase IIa
en conjunto con el VO2 pico para guiar la lista, incluyendo el porcentaje del VO2 pico previsto
(Nivel de evidencia: B).
En presencia de una prueba de CPX submaxima (RER < 1.05), el empleo del la pendiente del equi-
valente ventilatorio del dioxido de carbono (VE/VCO2) > 35 puede considerarse como determi-
nante en el listado para transplante cardiaco (Level of Evidence: B).
Clase IIb
En pacientes obesos (indice de masa corporal > 30 kg/m2), una masa corporal magra ajustada
para el VO2 pico < 19 ml/kg/min puede servir como un umbral optimo para guiar el pronostico
(Nivel de evidencia: B).
No se debe elaborar una lista de pacientes basada solamente en el critario de la medicion del
Class III
VO2 pico (Nivel de evidencia: C).


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

Tabla 12.6. Calculo del Seattle Heart Failure Survival Score


Valor (c) Coeciente (b) Producto
Cardiopata isqumica 1 + 0,6931 + 0,6931
Frecuencia cardaca en reposo 90 + 0,0216 + 1,9440
FEy VI 17 - 0,0464 - 0,7888
TA media 80 - 0,0255 - 2,0400
RCIV 0 + 0,6083 0
VO2 pico 16,2 - 0,0546 - 0,8845
Sodio srico 132 - 0,0470 - 6,2040
La escala HFSS se compone de 7 variables indenticadas y validadas en forma independiente como predictoras de pronstico.
A cada componente se le asigna un coeciente basado en un modelo de regresin. Se calcula tomando el valor absoluto de
la suma de los productos del valor de cada variable y sus coecientes del modelo. Los pacientes se estratican en riesgo bajo
(= 8,10), medio (7,20 - 8,09) y alto (< 7,20). Entre los pacientes de la muestra de validacin, la superviviencia a un ao sin
transplante para esos estratos fue del 88, 60 y 35% respectivamente. FEy VI, fraccin de eyeccin del ventrculo izquierdo; TA,
tensin arterial; RCIV, retraso de la conduccin intraventricular; VO2, consumo mximo de oxgeno.

DAI, la validez de HFSS ha sido cuestionada. El Gestin de datos. Listado de trasplante cardiaco
PRGHORGH6HDWWOHGHULYDGRGHXQDFRKRUWHGH 8QLWHG1HWZRUNIRU2UJDQ6KDULQJ 8126 
SDFLHQWHV FRQ LQVXFLHQFLD FDUGLDFD GH ORV TXH VH Una vez que se completa la evaluacin, los pacientes
obtuvieron datos clnicos, farmacolgicos, disposi- adecuados se incluyen en la lista trasplante cardaco. La
tivos y las caractersticas de laboratorio, y que fue obtencin de rganos de donantes y distribucin est re-
YDOLGDGRHQFRKRUWHVDGLFLRQDOHVLQFOX\HQGRPDV gulada por la UNOS en los Estados Unidos. Normal-
GH  SDFLHQWHV \ FHUFD GH  SHUVRQDV mente hay cuatro categoras de listado de UNOS sobre
DxRV GH VHJXLPLHQWR KD GHPRVWUDGR SURYHHU XQD la base de la severidad de la enfermedad cardaca.
HVWLPDFLyQPiVSUHFLVDGHODVXSHUYLYHQFLDD\ UNOS Estadio 1A: Esta es la categora de ms
DxRV U D  alta prioridad. Los pacientes en ventilacin mecnica
SRUQRPiVGHGtDV RVRSRUWHPHFiQLFRFDUGtDFR
Cateterismo cardaco derecho y Hemodinamia como BBIA o dispositivos de asistencia ventricular,
No se recomienda el estudio hemodinmico rutinario altas dosis de inotrpicos y/o monitorizacin hemo-
del corazn derecho para evaluar la gravedad de la insu- dinmica continua, se incluyen en esta categora.
FLHQFLDFDUGtDFD(OFDWHWHULVPRFDUGtDFRGHUHFKR\OD UNOS Estadio 1B: Los pacientes con dispositivo
evaluacin hemodinmica son tiles en la adaptacin de GH DVLVWHQFLD YHQWULFXODU LPSODQWDGR SRU PiV GH 
ODWHUDSLDHQODLQVXFLHQFLDFDUGtDFDDYDQ]DGD\HQORV das, paciente hospitalizado o domiciliario con infu-
SDFLHQWHVFRQVKRFNFDUGLRJpQLFR La preparacin para VLyQFRQWLQXDGHDJHQWHLQRWUySLFRDGRVLVEDMDV
la lista de espera para un trasplante cardaco, requiere 8126(VWDGLR7RGRVORVGHPiVDFWLYRVGHOD
un cateterismo cardaco derecho en todos los candidatos lista de trasplante.
para evaluar la hipertensin pulmonar y el gasto carda- 8126(VWDGLR3DFLHQWHVWHPSRUDOPHQWHLQDF-
FR8QDSUHVLyQVLVWyOLFDGHODDUWHULDSXOPRQDU 36$3  tivos en la lista
GH+J!PPRJUDGLHQWHWUDQVSXOPRQDU *73 !R Todos los pacientes en la lista deberan ser re-
ODUHVLVWHQFLDYDVFXODUSXOPRQDU 395 PiVGHyUGH- evaluados en tres a seis meses, para evaluar la me-
QHVUHTXLHUHGHXQDSUXHEDFRQy[LGRQtWULFRLQKDODGR MRUtDRHOGHWHULRUR\DFWXDOL]DUVXHVWDGLRHQODOLVWD
o nitratos por va intravenosa para determinar la reacti-
YLGDGYDVFXODU6LODSUXHEDQRWLHQHp[LWRHOSDFLHQWH Ciruga de Trasplante y cuidado postoperatorio
debe hospitalizarse con monitorizacin hemodinmica /RVSDFLHQWHVSRUORJHQHUDOPHQRUHVGHDxRVGH
continua, ya que frecuentemente la PVR se reducir edad con muerte cerebral son potenciales donantes
GHVSXpVGHDKRUDVGHWUDWDPLHQWR/DKLSHUWHQ- cardiacos. Las contraindicaciones para la donacin
sin pulmonar irreversible a pesar del tratamiento ade- GHFRUD]yQLQFOX\HQGLVIXQFLyQFDUGtDFDVLJQLFDWL-
cuado con diurticos, vasodilatadores y/o dispositivos va, las cardiopatas congnitas, neoplasias malignas
PHFiQLFRV GH DVLVWHQFLD FDUGLDFD %,$ /9$'  HV XQ FRQH[FHSFLyQGHFpOXODVEDVDOHV\HOFDUFLQRPDGH
factor pronstico desfavorable en pacientes con insu- clulas escamosas de la piel, tumores primarios del
FLHQFLD FDUGLDFD DYDQ]DGD \ HV XQD FRQWUDLQGLFDFLyQ sistema nervioso central con potencial metastsico
relativa para la lista de trasplante cardaco. EDMR  R ODV HQIHUPHGDGHV WUDQVPLVLEOHV 8QD YH]
que la muerte cerebral es declarada, la organizacin

179
J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

de la obtencin de rganos debe estar involucrada YHQWULFXODU6HUHFRPLHQGDHOXVRSUROiFWLFRGHXQD


SDUDODJHVWLyQGHORVGRQDQWHVFX\RSULQFLSDOREMH- cefalosporina de primera generacin o vancomicina
tivo es mantener la funcin de los rganos para ser en los pacientes alrgicos a la penicilina durante las
transplantados. El receptor ms adecuado basado en SULPHUDVKRUDV
la compatibilidad ABO, la compatibilidad de tama- /D GLVIXQFLyQ DJXGD GHO LQMHUWR OD LQVXFLHQFLD
xR GHO FXHUSR D PHQRV GH  GH GLIHUHQFLD GH FDUGtDFD GHUHFKD FRP~QPHQWH RFXUUH HQ SDFLHQWHV
HVWDWXUD\SHVR \TXHVHHQFXHQWUHDKRUDVGHO con hipertensin pulmonar, cuando hay discrepancia
hospital donde el donante est disponible, se iden- HQHOWDPDxRHQWUHGRQDQWH\ UHFHSWRUR HQSDFLHQ-
WLFD\VHSUHSDUDSDUDUHFLELUHOFRUD]yQ/RVWLHP- tes que reciben mltiples transfusiones de hemode-
pos de isquemia del corazn del donante ms largos ULYDGRV DOHWHREULODFLyQDXULFXODU TXHVRQDPH-
se asocian con un mayor riesgo de muerte despus QXGR VLJQRV GH UHFKD]R GHO LQMHUWR  WDTXLDUULWPLDV
del trasplante. Por lo tanto no se deben escatimar YHQWULFXODUHV VXJHVWLYD GH LVTXHPLD PLRFiUGLFD 
esfuerzos para limitar el tiempo de isquemia a un LQVXFLHQFLDUHQDO VHFXQGDULDDODOHVLyQLVTXpPLFD
Pi[LPRGHKRUDV por el clampeo artico, despus de la operacin o hi-
El corazn del donante se trasplanta a un recep- potensin inducida al iniciar inhibidores de la calci-
tor adecuado por un mtodo quirrgico ortotrpi- QHXULQD SXHGHFRPSOLFDUHOSRVRSHUDWRULRLQPHGLDWR
FR HOFRUD]yQGHOGRQDQWHVHLPSODQWDHQOXJDUGHO ORTXHMXVWLFDHOVRVWpQFRQIiUPDFRVLRQRWUySLFRV
corazn nativo por una anastomosis bi-auricular de dispositivos mecnicos de asistencia circulatoria y
6KXPZD\/RZHURXQDDQDVWRPRVLVELFDYD RKHWH- terapias de reemplazo renal temporales.
URWySLFR HOFRUD]yQGRQDQWHVHLPSODQWDDOODGRGHO
FRUD]yQQDWLYR /DDQDVWRPRVLVELFDYDHVODWpFQLFD Inmunosupresin
ms comnmente utilizada y se preserva la aurcula Las dosis altas de esteroides, la azatioprina y timog-
donante. Se asocia con la reduccin de las necesi- lobulina fueron el pilar de la terapia inmunosupreso-
GDGHV HSLQHIULQD SRVWRSHUDWRULD GH LQVXFLHQFLD ra en los primeros das del trasplante. La introduc-
WULFXVStGHD TXHHVPiVFRP~QFRQODWpFQLFDELDX- cin de la ciclosporina, inhibidor de la calcineurina,
ULFXODU  GH ORV UHTXLVLWRV GH PDUFDSDVHR WHPSRUDO ha revolucionado la terapia inmunosupresora y la
\GHODIUHFXHQFLDGHDUULWPLDV/DVGHVYHQWDMDVVRQ VXSHUYLYHQFLD SRVW WUDVSODQWH KD PHMRUDGR QRWD-
el tiempo prolongado isqumico, y la probabiliad, blemente. La prctica actual es utilizar un rgimen
DXQTXHEDMDGHGHVDUUROODUXQDHVWHQRVLVHQODVDQDV- de tres medicamentos que incluye un inhibidor de
tomosis de las venas cava superior e inferior. El tras- OD FDOFLQHXULQD FLFORVSRULQD R WDFUROLPXV). 
plante heterotpico rara vez se realiza en el da de HVWHURLGHV JHQHUDOPHQWH SUHGQLVRQD  \ XQ DJHQWH
hoy, pero puede estar indicado en pacientes con hi- DQWLSUROLIHUDWLYR D]DWLRSULQD PLFRIHQRODWR PRIH-
SHUWHQVLyQSXOPRQDUVHYHUDFRQHOQGHSUHYHQLUOD WLO /DVGRVLVDOWDVGHFRUWLFRLGHV PHWLOSUHGQLVROR-
LQVXFLHQFLDFDUGtDFDGHUHFKDGHOFRUD]yQGHOGRQDQ- QD PiV D PHQXGR  VH LQLFLDQ GXUDQWH OD FLUXJtD (O
WHRHQFDVRGHQRFRLQFLGLUHOWDPDxRVLJQLFDWLYR LQKLELGRU GH OD FDOFLQHXULQD WDFUROLPXV SRU OR JH-
GRQDQWHUHFHSWRUUHODFLyQGHSHVR  QHUDO  \ ORV DJHQWHV DQWLSUROLIHUDWLYRV FRP~QPHQWH
'XUDQWH HO SHUtRGR SRVWRSHUDWRULR LQPHGLDWR D PLFRIHQRODWR PRIHWLO  VH LQLFLDQ  KRUDV GHV-
PHQXGR KDVWD  KRUDV  SXHGHQ UHTXHULUVH YDVR- pus de la ciruga. La iniciacin de los inhibidores
constrictores para mantener una presin arterial ade- de la calcineurina puede retrasarse si se produce un
cuada y el apoyo con frmacos inotrpicos y, ocasio- deterioro perioperatorio de la funcin renal. Aunque
nalmente, un BBIA. Se utiliza un marcapasos tem- controvertido, algunos centros de trasplante utilizan
SRUDO HSLFiUGLFR DXULFXODU \ YHQWULFXODU  KDVWD TXH la terapia de induccin con anticuerpos anti-clulas
la frecuencia cardaca del corazn transplantado es 7PRQRFORQDOHV 2.7 JOREXOLQDFRQWUDWLPRFLWRV
VXFLHQWHFRPRSDUDWRPDUHOFRQWURO/DIUHFXHQFLD WLPRJOREXOLQD  GDFOL]XPDE =HQDSD[  R EDVLOL[L-
FDUGtDFDGHOLQMHUWRGHEHFKHTXHDUVHGLDULDPHQWHDSD- PDE 6LPXOHFW HQORVSULPHURVGtDVGHVSXpVGH
JDQGRHOPDUFDSDVRV1RUPDOPHQWHHOLQMHUWRWDUGD la operacin en pacientes de alto riesgo de rechazo
HQWUH\KRUDVHQPDQWHQHUXQULWPRDGHFXDGR precoz o para retrasar la iniciacin de inhibidor de la
(QFDVRGHLQVXFLHQFLDGHODIUHFXHQFLDLQWUtQVHFD FDOFLQHXULQDHQORVSDFLHQWHVFRQLQVXFLHQFLDUHQDO
frmacos cronotrpicos positivos como el isoprotere- /DPD\RULQFLGHQFLDGHLQIHFFLRQHV HVSHFtFDPHQWH
QRORODWHROLQDSXHGHQHVWDULQGLFDGRVSDUDD\XGDU FLWRPHJDORYLUXV HOUHFKD]RSRUUHERWH\ORVWUDVWRU-
a controlar la frecuencia cardiaca. En pocos casos nos linfoproliferativos son complicaciones del uso de
SXHGHUHTXHULUVHGHXQPDUFDSDVRVGHQLWLYRGHELGR la terapia de induccin.
a la disfuncin del nodo sinusal o ndulo auriculo-


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

Rechazo de aloinjertos para prevenir estas infecciones se deben considerar y


El sistema inmune del destinatario reconoce los aloan- utilizar en todos los pacientes despus del trasplante.
WtJHQRV GHO GRQDQWH FRPR H[WUDxRV \ FRQVWDQWHPHQ- /DFRPELQDFLyQGHWULPHWRSULPD\VXOIDPHWR[D]ROVH
WH WUDWD GH OLEUDU DO FXHUSR GHO WHMLGR H[WUDxR OR TXH administra universalmente a todos los receptores de
se evita mediante el tratamiento inmunosupresor. El trasplante que no sean alrgicos a las sulfonamidas y
UHFKD]RGHODORLQMHUWRSXHGHRFXUULUHQFXDOTXLHUPR- HVSDUWLFXODUPHQWHHFD]HQODSUHYHQFLyQGHODVLQ-
mento despus del trasplante y puede ser el resultado IHFFLRQHVSRU3QHXPRF\VWLVFDULQLLOLVWHULRVLVWR[R-
GHXQRGHWUHVPHFDQLVPRV KLSHUDJXGR VHSURGXFH SODVPRVLV\QRFDUGLRVLV/DSUROD[LVGHUXWLQDFRQ
en cuestin de minutos a horas y es causado por anti- agentes antimicticos no se ha demostrado utilidad
cuerpos preformados en el receptor y se puede evitar para reducir la mortalidad en los pacientes con tras-
detectando estos anticuerpos anti-donante utilizando plante de rgano slido, pero dada la alta incidencia
XQSDQHOGHDQWLFXHUSRVUHDFWLYRV 3$5  KXPRUDO y la mortalidad asociada con las micosis invasivas
PHGLDGRSRUDQWLFXHUSRV R PHGLDGRSRUFpOXODV en la poblacin post-trasplante de rganos slidos, la
El rechazo celular agudo es la forma ms comn y se SUROD[LVHVSHFtFDSDUDODVLQIHFFLRQHVI~QJLFDVHQ
produce en un tercio a la mitad de los receptores de pacientes de alto riesgo para estas infecciones es ra-
trasplantes de corazn que pueden ser diagnosticadas zonable. El ganciclovir y el valganciclovir son agen-
SRUELRSVLDHQGRPLRFiUGLFD\FODVLFDGRSRUHOVLVWH- WHVSUHIHULGRVSDUDODSUROD[LVGH&09(ODFLFORYLU
PDGHFODVLFDFLyQ,6+/7FRPRVLJXH \ HO YDODFLFORYLU VRQ WDPELpQ HFDFHV \ VH SXHGHQ
 *UDGR5QRUHFKD]R XVDUHQSDFLHQWHVGHEDMRULHVJR
 *UDGR5UHFKD]ROHYH LQOWUDGRLQWHUVWLFLDO Las infecciones son muy comunes despus de un
\RSHULYDVFXODUFRQKDVWDXQIRFRGHGDxRPLR- transplante de rgano slido en particular en el primer
citario DxR6HUHFRPLHQGDLQYHVWLJDUDJUHVLYDPHQWHLQFOXVR
 *UDGR5UHFKD]RPRGHUDGR GRVRPiVIRFRV FDVRV GH  HEUH GH EDMR JUDGR GH ORV SDFLHQWHV WUDV-
GHLQOWUDGRFRQGDxRPLRFLWDULRDVRFLDGR SODQWDGRVHVSHFLDOPHQWHHQORVSULPHURVGtDV\D
 *UDGR5UHFKD]RVHYHUR LQOWUDGRGLIXVRFRQ que estos pacientes no siempre son capaces de desa-
GDxRPLRFLWDULRPXOWLIRFDOFRQRVLQHGHPDKH- UUROODUXQDUHVSXHVWDLQPXQHVXFLHQWHSDUDGHVDUUR-
PRUUDJLDRYDVFXOLWLV  llar los signos y sntomas clnicos de infeccin debido
El rechazo hiperagudo es a menudo mortal, requiere a la inmunospresin crnica. Las infecciones ms co-
un nuevo trasplante o uso de la ayuda de un cora- munes en funcin del tiempo despus del trasplante se
]yQDUWLFLDO(QFDVRGHUHFKD]RKXPRUDORFHOXODU PXHVWUDQHQOD)LJXUD/RVSDFLHQWHVGHEHQVHU
HOUHFKD]ROHYHVLQGHWHULRURFOtQLFRVLJQLFDWLYRQR tratados con antimicrobianos apropiados elegidos en
requiere cambios en la terapia mientras que el re- base a la sospecha clnica y adaptados de acuerdo con
chazo moderado a severo requiere tratamiento con los estudios microbiolgicos y serolgicos.
independencia de los cambios clnicos. El tratamien-
to es generalmente con esteroides a dosis altas o en Complicaciones a largo plazo del trasplante cardaco
caso de rechazo con compromiso hemodinmico, la /D HQIHUPHGDG DUWHULDO FRURQDULD GHO DORLQMHUWR R
WHUDSLDGHDQWLOLQIRFLWRV 2.7ODLQPXQRJOREXOLQD YDVFXORSDWtD GHO LQMHUWR TXH HV XQD HQIHUPHGDG DU-
DQWLOLQIRFLWRV $7*$0  ODV JOREXOLQDV GH FRQHMR terial coronaria difusa obliterante, es la principal
DQWLWLPRFLWR 5$7* \RGRVLVDOWDVGHHVWHURLGHVLQ- complicacin a largo plazo del trasplante cardaco.
travenosos. La incidencia de rechazo es mayor en el Como con cualquier trasplante de rgano slido, la
primer mes despus del trasplante y posteriormente hipertensin, la diabetes y la osteoporosis son co-
VH SURGXFH D XQD WDVD EDMD SHUR FRQVWDQWH 'XUDQWH munes, atribuibles al uso crnico de esteroides. La
HOSULPHUDxRODVELRSVLDVUXWLQDULDVGHYLJLODQFLDVH inmunosupresin crnica tambin aumenta el riesgo
realizan a intervalos regulares, que pueden variar en de enfermedades malignas, comnmente trastornos
diferentes centros de trasplante. linfoproliferativos.

Infecciones postransplante )LQDOGHODYLGD FXLGDGRVSDOLDWLYRV


Los inmunosupresores, mientras que disminuye la in- (QWRGRVORVSDFLHQWHVFRQLQVXFLHQFLDFDUGtDFDVH
cidencia de rechazo, aumentan el riesgo de infeccio- deben tener en cuenta sus deseos en cuanto a la resu-
nes oportunistas. Las infecciones por citomegalovirus citacin y sus deseos deben constar en un documento
&09 3QHXPRF\VWLVMLURYHFL\KRQJRVRSRUWXQLVWDV realizado en vida. Las medidas paliativas, incluyendo
son comunes en los pacientes post trasplante de r- agentes inotrpicos deben considerarse y ofrecerse
JDQRVVyOLGRV\SRUORWDQWRORVDJHQWHVSUROiFWLFRV D ORV SDFLHQWHV FRQ LQVXFLHQFLD FDUGtDFD DYDQ]D-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

GD TXH QR FDOLFDQ SDUD HO WUDVSODQWH GH FRUD]yQ \


deterioro cognitivo, etc., incluso en ausencia de re-
que no responden a la terapia mdica. Los cuidados tencin de lquidos o disnea.
paliativos domiciliarios, en el hospital o en centros /RVSDFLHQWHVTXHVHSUHVHQWDQFRQLQVXFLHQFLD
especializados pueden ser considerados para los pa- cardaca y empeoran a pesar del tratamiento mdi-
FLHQWHVFRQGLVQHDFODVH,9GHOD1<+$ORVTXHWLH- co ptimo, deben ser evaluados cuidadosamente y
QHQXQDHVSHUDQ]DGHYLGDGHPHVHVRPHQRU\ORV UHSHWLGDPHQWH SDUD LGHQWLFDU \ FRUUHJLU ODV FDXVDV
TXHWLHQHQLQVXFLHQFLDFDUGtDFDUHIUDFWDULDGHVSXpV reversibles, como el incumplimiento de la dieta y los
de haber agotado todas las opciones de tratamiento medicamentos, la isquemia de miocardio, la taquicar-
estndar. Los hospicios proporcionan generalmente dia o bradiarritmias y la enfermedad valvular.
los medicamentos orales y la gestin de los sntomas. (OWUDVSODQWHFDUGtDFRPHMRUDODFDOLGDGGHYLGD\
Algunos hospicios pueden proporcionar tratamientos ODVXSHUYLYHQFLDHQSDFLHQWHVFRQLQVXFLHQFLDFDUGtDFD
FRPSOHMRVFRPRLQRWUySLFRVSRUYtDLQWUDYHQRVDOD avanzada y es el tratamiento de eleccin para los pacien-
SUHVLyQ SRVLWLYD FRQWLQXD HQ YtD DpUHD &3$3  HWF
WHVFRQLQVXFLHQFLDFDUGtDFDUHIUDFWDULDDOWUDWDPLHQWR
/DSDUWLFLSDFLyQFRQWLQXDGHOFOtQLFR\HOPDQHMRPH- mdico. Sin embargo, hay ms pacientes que necesitan
ticuloso del la retencin de lquidos es esencial para trasplante de corazn que los donantes disponibles y el
PD[LPL]DUODFDOLGDGGHYLGDLQFOXVRGHVSXpVGHTXH trasplante se asocia con un compromiso de por vida a
el paciente se inscribe en el hospicio. la inmunosupresin y complicaciones relacionadas. Si
a pesar de todos los esfuerzos anteriores, los pacientes
Conclusin continan deteriorndose, pueden ser considerados para
/RV SDFLHQWHV FRQ LQVXFLHQFLD FDUGtDFD DYDQ]DGD trasplante cardaco. Los frmacos inotrpicos cardacos
pueden presentar sntomas de hipoperfusin como \GLVSRVLWLYRVGHDVLVWHQFLDPHFiQLFD %%,$'$9L]-
LQWROHUDQFLDDOHMHUFLFLRIDWLJDGLVPLQXFLyQGHODSH- TXLHUGRV SXHGHQVHUFRQVLGHUDGRVFRPRXQSXHQWHSDUD
WLWRFDODPEUHVDEGRPLQDOHVDQRUH[LDLQVXFLHQFLD HOWUDVSODQWHRWHUDSLDQDO/RVSDFLHQWHVFRQVtQWRPDV
UHQDOLQVXFLHQFLDKHSiWLFDSUREOHPDVGHPHPRULD GHFODVHIXQFLRQDO,9\XQDHVSHUDQ]DGHYLGDGHPH-

Figura 12.4. Lnea de Tiempo de las Infecciones luego de un Transplante de rgano Slido
SAMR, staphylococcus aureus meticilina-resistente; EVR, enterococcus faecalis vancomicina resistente; VHS, virus herpes sim-
plex; VCML, virus coriomeningitis linfocitaria; VIH, virus de la inmunodeciencia humana; NPJ, neumona por pneumocystis
jiroveci; VHB, virus hepatitis B; VVZ, varicella virus zoster; SARS, severe acute respiratory syndrome; LeMP, leucoencefalo-
pata multifocal progresiva; TLPPT, trastorno linfoproliferativo postransplante. (Modicado Fishman JA et al. N Engl J Med.
2007;357:2601-14).


CAPTULO 12 ,QVXFLHQFLDFDUGtDFDDYDQ]DGD\WUDQVSODQWHFDUGtDFR

ses o menos, si no son candidatos para cualquiera de las SDUDPHMRUDUHOFXPSOLPLHQWRFRQODGLHWDHOHMHUFL-


WHUDSLDVGHQLWLYDVFRPRHOWUDVSODQWHGHFRUD]yQRGH cio, la medicacin, las visitas al consultorio, etc., con
un DAV, deben considerarse para cuidados paliativos. HO Q GH JDUDQWL]DU OD FRQWLQXLGDG GH OD DWHQFLyQ \
Se debe involucrar a los pacientes para que, den- PHMRUDUVXFDOLGDGGHYLGD
WURGHVXSURSLRHVWLORGHYLGDKDJDQPRGLFDFLRQHV

BIBLIOGRAFA
1. 5RVDPRQG:)OHJDO.)XULH.HWDO+HDUWGLVHDVHDQGVWURNHVWDWLVWLFVXSGDWHDUHSRUWIURPWKH$PHULFDQ
+HDUW$VVRFLDWLRQ6WDWLVWLFV&RPPLWWHHDQG6WURNH6WDWLVWLFV6XEFRPPLWWHH&LUFXODWLRQH
 -HVVXS 0$EUDKDP :7 &DVH\ '( HW DO  )RFXVHG 8SGDWH$&&)$+$ *XLGHOLQHV IRU WKH GLDJQRVLV DQG
management of heart failure in the adults: A report of the American College of Cardiology Foundation/American
+HDUW$VVRFLDWLRQ7DVN)RUFHRQ3UDFWLFH*XLGHOLQHVGHYHORSHGLQFROODERUDWLRQZLWKWKH,QWHUQDWLRQDO6RFLHW\IRU
+HDUWDQG/XQJ7UDQVSODQWDWLRQ-$P&ROO&DUGLRO
 Pitt B, Zannad F, Remme WJ, et al. The effect spironolactone on morbidity and mortality in patients with severe heart
IDLOXUH5DQGRPL]HG$OGDFWRQH(YDOXDWLRQ6WXG\,QYHVWLJDWRUV1(QJO-0HG
 3LWW % 5HPPH : =DQQDG HW DO (SOHUHQRQH D VHOHFWLYH DOGRVWHURQH EORFNHU LQ SDWLHQWV ZLWK OHIW YHQWULFXODU
G\VIXQFWLRQDIWHUP\RFDUGLDOLQIDUFWLRQ1(QJO-0HG
 7D\ORU$/ =LHVFKH 6<DQF\ & HW DO &RPELQDWLRQ RI LVRVRUELGH GLQLWUDWH DQG K\GUDOD]LQH LQ EODFNV ZLWK KHDUW
IDLOXUH1(QJO-0HG
 7KHHIIHFWRIGLJR[LQRQPRUWDOLW\DQGPRUELGLW\LQSDWLHQWVZLWKKHDUWIDLOXUH7KH'LJLWDOLV,QYHVWLJDWLRQ*URXS1
(QJO-0HG
7. 0RVV$-=DUHED:+DOO:-HWDO3URSK\ODFWLFLPSODQWDWLRQRIDGHEULOODWRULQSDWLHQWVZLWKP\RFDUGLDOLQIDUFWLRQ
DQGUHGXFHGHMHFWLRQIUDFWLRQ1(QJO-0HG
 %DUG\*+/HH./0DUN'%HWDO$PLRGDURQHRUDQLPSODQWDEOHFDUGLRYHUWHUGHEULOODWRUIRUFRQJHVWLYHKHDUW
IDLOXUH1(QJO-0HG
9. %ULVWRZ 05 6D[RQ /$ %RHKPHU - HW DO &DUGLDFUHV\QFKURQL]DWLRQ WKHUDS\ ZLWK RU ZLWKRXW DQ LPSODQWDEOH
GHEULOODWRULQDGYDQFHGFKURQLFKHDUWIDLOXUH1(QJO-0HG
 Cleland JGF, Daubert J, Erdmann E, et al. The effect of cardiac resynchronization on mortality and morbidity in heart
IDLOXUH1(QJO-0HG
11. $QGHUVRQ-/+HPRG\QDPLFDQGFOLQLFDOEHQHWVZLWKLQWUDYHQRXVPLOULQRQHLQVHYHUHFKURQLFKHDUWIDLOXUHUHVXOWV
RIDPXOWLFHQWHUVWXG\LQWKH8QLWHG6WDWHV$P+HDUW-
 Mehra MR, Ventura HO, Kapoor C, et al. Safety and clinical utility of long-term intravenous milrinone in advanced
KHDUWIDLOXUH$P-&DUGLRO
 &XIIH06&DOLII50$GDPV.)HWDO6KRUWWHUPLQWUDYHQRXVPLOULQRQHIRUDFXWHH[DFHUEDWLRQRIFKURQLFKHDUW
IDLOXUH$UDQGRPL]HGFRQWUROOHGWULDO-$0$
 Upadya S, Lee FA, Saldarriaga C, et al. Home continuous positive inotropic infusion as a bridge to cardiac
WUDQVSODQWDWLRQLQSDWLHQWVZLWKHQGVWDJHKHDUWIDLOXUH-+HDUW/XQJ7UDQVSODQW
 OConnor MC, Velazquez EJ, Gardner LH, et al. Comparison of coronary artery bypass grafting versus medical
WKHUDS\ RQ ORQJWHUP RXWFRPH LQ SDWLHQWV ZLWK LVFKHPLF FDUGLRP\RSDWK\ D  \HDU H[SHULHQFH IURP 'XNH
FDUGLRYDVFXODUGLVHDVHGDWDEDQN $P-&DUGLRO
 Pagano D, Townend JN, Littler WA, et al. Coronary artery bypass surgery as treatment for ischemic heart failure:
the predictive value of viability assessment with quantitative positron emission tomography for symptomatic and
IXQFWLRQDORXWFRPH-7KRUDF&DUGLRYDVF6XUJ
17. Oesterle SN, Sanborn TA, Ali N, et al. Percutaneous transmyocardial laser revascularization for severe angina: the
3$&,),&UDQGRPL]HGWULDO3RWHQWLDO&ODVV,PSURYHPHQW)URP,QWUDP\RFDUGLDO&KDQQHOV/DQFHW

 7VH+)7KDPEDU6.ZRQJ</HWDO&RPSDUDWLYHHYDOXDWLRQRIORQJWHUPFOLQLFDOHIFDF\ZLWKFDWKHWHUEDVHG
percutaneous intramyocardial autologous bone marrow cell implantation versus laser myocardial revascularization
LQSDWLHQWVZLWKVHYHUHFRURQDU\DUWHU\GLVHDVH$P+HDUW-H
19. $WKDQDVXOHDV&/%XFNEHUJ*'6WDQOH\$:+HWDO6XUJLFDOYHQWULFXODUUHVWRUDWLRQLQWKHWUHDWPHQWRIFRQJHVWLYH
KHDUWIDLOXUHGXHWRSRVWLQIDUFWLRQYHQWULFXODUGLODWLRQ-$P&ROO&DUGLRO
 Jones RH, Velazquez EJ, Michler RE, et al. Coronary bypass surgery with or without surgical ventricular
UHFRQVWUXFWLRQ1(QJO-0HG
 6PROHQV,$3DJDQL)'%ROOLQJ6)0LWUDOYDOYHUHSDLULQKHDUWIDLOXUH(XU-+HDUW)DLO
 :X$+$DURQVRQ.'%ROOLQJ6)HWDO,PSDFWRIPLWUDOYDOYHDQQXORSODVW\RQPRUWDOLW\ULVNLQSDWLHQWVZLWKPLWUDO


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

UHJXUJLWDWLRQDQGOHIWYHQWULFXODUV\VWROLFG\VIXQFWLRQ-$0&ROO&DUGLRO
 5RVH ($ *HOLMQV$& 0RVNRZLW]$- HW DO /RQJWHUPXVH RI D OHIW YHQWULFXODUDVVLVW GHYLFHIRU HQGVWDJH KHDUW
IDLOXUH1(QJO-0HG
 %DQN$-0LU6+1JX\HQ'4HWDO(IIHFWVRIOHIWYHQWULFXODUDVVLVWGHYLFHVRQRXWFRPHVLQSDWLHQWVXQGHUJRLQJ
KHDUWWUDQVSODQWDWLRQ$QQ7KRUDF6XUJ
 $DURQVRQ.'(SSLQJHU0-'\NH'%HWDO/HIWYHQWULFXODUDVVLVWGHYLFHWKHUDS\LPSURYHVXWLOL]DWLRQRIGRQRU
KHDUWV-$P&ROO&DUGLRO
 %ORP$60XNKHUMHH53LOOD--/RZU\$6HWDO&DUGLDFVXSSRUWGHYLFHPRGLHVOHIWYHQWULFXODUJHRPHWU\DQG
P\RFDUGLDOVWUXFWXUHDIWHUP\RFDUGLDOLQIDUFWLRQ&LUFXODWLRQ
 &KHQJ$1JX\HQ7&0DOLQRZVNL0HWDO3DVVLYHYHQWULFXODUFRQVWUDLQWSUHYHQWVWUDQVPXUDOVKHDUVWUDLQSURJUHVVLRQ
LQOHIWYHQWULFXODUUHPRGHOLQJ&LUFXODWLRQ 6XSSO ,
 7DNDJDNL 0 5RWWHQEHUJ ' 0F&DUWK\ 30 HW DO$ QRYHO PLQLDWXUH YHQWULFXODU DVVLVW GHYLFH IRU KHPRG\QDPLF
VXSSRUW$6$,2
 Meyns B, Klotz S, Simon A, et al. Proof of concept: hemodynamic response to long-term partial ventricular support
ZLWKWKHV\QHUJ\SRFNHWPLFURSXPS-$P&ROO&DUGLRO
 Taylor DO, Edwards LB, Aurora P, et al. Registry of the International Society for Heart and Lung Transplantation:
WZHQW\IWKRIFLDODGXOWKHDUWWUDQVSODQWUHSRUW-+HDUW/XQJ7UDQVSODQW
 Butler J, Khadim G, Paul KM, et al. Selection of patients for heart transplantation in the current era of heart failure
WKHUDS\-$P&ROO&DUGLRO
 0DQFLQL'0(LVHQ+.XVVPDXO:HWDO9DOXHRISHDNH[HUFLVHR[\JHQFRQVXPSWLRQIRURSWLPDOWLPLQJRIFDUGLDF
IRURSWLPDOWLPLQJRIFDUGLDFWUDQVSODQWDWLRQLQDPEXODWRU\SDWLHQWVZLWKKHDUWIDLOXUH&LUFXODWLRQ
 6WHONHQ$0<RXQLV /7 -HQQLVRQ 6+ HW DO 3URJQRVWLF YDOXH RI FDUGLRSXOPRQDU\ H[HUFLVH WHVWLQJ XVLQJ SHUFHQW
DFKLHYHGRUSUHGLFWHGSHDNR[\JHQXSWDNHIRUSDWLHQWVZLWKLVFKHPLFDQGGLODWHGFDUGLRP\RSDWK\-$0&ROO&DUGLRO

 2VPDQ$)0HKUD05/DYLH&-HWDO7KHLQFUHPHQWDOSURJQRVWLFLPSRUWDQFHRIERG\IDWDGMXVWHGSHDNR[\JHQ
FRQVXPSWLRQLQFKURQLFKHDUWIDLOXUH-$P&ROO&DUGLRO
 $DURQVRQ.'6FKZDUW]-6&KHQ70HWDO'HYHORSPHQWDQGSURVSHFWLYHYDOLGDWLRQRIDFOLQLFDOLQGH[WRSUHGLFW
VXUYLYDOLQDPEXODWRU\SDWLHQWVUHIHUUHGIRUFDUGLDFWUDQVSODQWHYDOXDWLRQ&LUFXODWLRQ
 /HY\:&0R]DIIDULDQ'/LQNHU'7HWDO7KH6HDWWOH+HDUW)DLOXUHPRGHOSUHGLFWLRQRIVXUYLYDOLQKHDUWIDLOXUH
&LUFXODWLRQ
 Mehra M, Kobashigawa J, Starling R, et al. Listing criteria for heart transplantation: International Society for
+HDUWDQG/XQJ7UDQVSODQWDWLRQJXLGHOLQHVIRUWKHFDUHRIWUDQVSODQWFDQGLGDWHV-+HDUW/XQJ7UDQVSODQW

 6WHZDUW 6:LQWHUV */ )LVKEHLQ 0& HW DO 5HYLVRQ RI WKH  ZRUNLQJ IRUPXODWLRQ IRU WKH VWDQGDUGL]DWLRQ RI
QRPHQFODWXUHLQWKHGLDJQRVLVRIKHDUWUHMHFWLRQ-+HDUW/XQJ7UDQVSODQW
 Goodlin SJ, Hauptman PJ, Arnold R, et al. Consensus statement: Palliative and supportive care in advanced heart
IDLOXUH-&DUG)DLO


&$3,78/2

EL CORAZN DEL DEPORTISTA

ROBERTO M. PEIDRO

El concepto de corazn del deportista involucra las contra otros, desarrollan un entrenamiento regular e
DGDSWDFLRQHVFDUGtDFDVVLROyJLFDVJHQHUDGDVDSDUWLU intenso para lograr superar sus propias marcas y en-
de incrementos crnicos en pre y post carga produci- contrar satisfacciones personales y sociales.
dos por el entrenamiento fsico regular y prolongado. /D FODVLFDFLyQ GHO HMHUFLFLR ItVLFR SXHGH UHD-
Estas condiciones resultan en un remodelamiento re- lizarse a partir de la actividad mecnica requerida
YHUVLEOHTXHLQFOX\HKLSHUWURDGLODWDFLyQDXPHQWRV SDUDVXGHVDUUROOR\GHORVPHFDQLVPRVVLROyJLFRV
GHO OOHQDGR YHQWULFXODU \ PRGLFDFLRQHV HOpFWULFDV GHSURGXFFLyQGHHQHUJtD  
Por otra parte, adaptaciones hormonales y del siste- /RV HMHUFLFLRV GLQiPLFRV LPSOLFDQ FDPELRV HQ
ma nervioso autnomo contribuyen a las manifesta- la longitud del msculo y movimientos articulares
ciones clnicas del as llamado sndrome del cora- causados por contracciones rtmicas que desarrollan
zn de atleta. HVFDVDWHQVLyQ HVWD~OWLPDFDUDFWHUtVWLFDKDOOHYDGR
/DSULPHUDGHVFULSFLyQIXHSXEOLFDGDDQHVGHO DGHQRPLQDUORVLVRWyQLFRV /RVHVIXHU]RVHVWiWLFRV
siglo XIX por Henschen al estudiar a esquiadores involucran incrementos en la tensin muscular con
mediante percusin torcica. El autor observ un escasos cambios en la longitud del msculo y la mo-
aumento del rea de matidez torcica correspondien- vilidad articular. Las carreras de largas distancias
WH DO PLRFDUGLR H LQULy XQ LQFUHPHQWR GHO WDPDxR VRQHMHPSORGHGHSRUWHIXQGDPHQWDOPHQWHGLQiPL-
FDUGtDFRTXHVHUtDVLROyJLFR\EHQLJQR\SHUPLWLUtD co y el levantamiento de pesas involucra activida-
HIHFWXDUPiVWUDEDMRGXUDQWHXQWLHPSRPD\RU   des con alto componente esttico. Sin embargo, en
$SDUWLUGHWDOHVREVHUYDFLRQHVP~OWLSOHVWUDEDMRV la mayor parte de los deportes se desarrollan ambos
sugirieron criterios enfrentados con relacin a la be- tipos de esfuerzo con proporciones variables de uno
QLJQLGDG R QR GH ODV PRGLFDFLRQHV FDUGtDFDV SRU u otro segn la actividad.
HOHMHUFLFLR Desde el punto de vista metablico se distinguen
/DVPRGLFDFLRQHVPRUIROyJLFDVGHOFRUD]yQGHO ORV HMHUFLFLRV DHUyELFRV FX\D HQHUJtD  SURYLHQH GH
GHSRUWLVWD VH PDQLHVWDQ HQ OD PD\RUtD GH ORV FD- SURFHVRVR[LGDWLYRV\DQDHUyELFRVFRQSURGXFFLyQ
VRV HQ VXMHWRV FRQ DOWRV QLYHOHV GH HQWUHQDPLHQWR energtica a partir de los fosfgenos o la gluclisis
Se debe considerar como atleta competitivo aque- citoplasmtica. La mayor parte de los deportes tienen
lla persona que participa en un deporte individual o IRUPDVPL[WDVGHREWHQFLyQGHHQHUJtDFRQSUHGRPL-
HTXLSR RUJDQL]DGR \ TXH WLHQH FRPR REMHWLYR IXQ- nancias de una u otra segn la actividad principal.
damental y prioritario el enfrentamiento frecuente Los deportes con mayor componente dinmico
FRQWUD RWURV VXMHWRV GH VLPLODU FRQGLFLyQ HQ SRV GH generan mayores sobrecargas de volumen con in-
un premio al triunfo, requiriendo un intenso entrena- FUHPHQWRGHODVPLREULOODVHQVHULH\DXPHQWRGHO
PLHQWRUHJXODUSDUDORJUDUHVWRVQHV   WDPDxR GH OD FDYLGDG 8Q YHQWUtFXOR L]TXLHUGR FRQ
(VWD GHQLFLyQ SXHGH VHU SRFR DEDUFDWLYD FXDQ- mayor dimetro diastlico facilita un mayor volu-
do se piensa en deportistas que, si bien no compiten men sistlico con menores acortamiento y prdida de


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

energa por tensin y friccin. La frecuencia cardaca DxRV GH GHFRQGLFLRQDPLHQWR REVHUYiQGRVH XQD UH-
PiVEDMDVHVXPDDOPHFDQLVPRDQWHULRUSDUDKDFHU YHUVLyQLQFRPSOHWDGHODVGLPHQVLRQHVFDUGtDFDV  
PiV HFLHQWH DO FRUD]yQ GHO GHSRUWLVWD 6LQ HPEDU- (Q  DWOHWDV GH DOWR UHQGLPLHQWR HYDOXDGRV
go, un incremento del radio de la cavidad aumenta HQ /RQGUHV VH GHPRVWUy TXH VyOR HO  SUHVHQ-
la tensin intramiocrdica y, como consecuencia, su WDEDQ KLSHUWURD YHQWULFXODU L]TXLHUGD FRQFpQWUL-
FRQVXPR GH R[tJHQR 3DUD HTXLSDUDU OD WHQVLyQ VH FDFRQHVSHVRUVHSWDOVXSHULRUDPP PHGLDGH
generan crecimientos proporcionales del espesor del HQWUH\PP   6yORGHORVDWOHWDV
septum y la pared libre ventricular izquierda.  WXYLHURQFDYLGDGHVQRGLODWDGDV\HQXQRGH
/RV GHSRUWHV FRQ DOWR FRPSRQHQWH GH HMHUFLFLRV HOORVVHGHPRVWUyUHVROXFLyQGHODKLSHUWURDFRQ
isomtricos provocan incrementos constantes de semanas de desentrenamiento. El resto de los depor-
la poscarga con tendencia a aumentar el espesor de WLVWDVFRQKLSHUWURDWHQtDQGLODWDFLyQGHODFDYLGDG
la pared ventricular. Esto ocurre para compensar la ventricular izquierda con funciones sistlica y dias-
elevacin de la tensin parietal que surge como con- tlica normales.
secuencia del aumento de la presin intraventricular A diferencia de condiciones patolgicas en que
/H\GH/DSODFHWHQVLyQ SUHVLyQ[UDGLRHVSHVRU  ODVREUHFDUJDFDUGtDFDHVSHUPDQHQWH KLSHUWHQVLyQ
Debido a que los diferentes deportes tienen com- DUWHULDO YDOYXORSDWtDV  GXUDQWH OD SUiFWLFD GHSRU-
ponentes de entrenamiento que incluyen resistencia WLYD WDOHV FRQGLFLRQHV QR VRQ FRQVWDQWHV \ H[LVWHQ
aerbica, velocidad y fuerza muscular, los cambios perodos de descanso prolongados entre los entre-
morfolgicos observados en muchos de ellos suelen namientos. Es factible, entonces, que en la hiper-
VHUPL[WRV WURD VLROyJLFD GHO GHSRUWLVWD HVWpQ LQYROXFUDGRV
La mayora de los estudios publicados demues- RWURVPHFDQLVPRVUHODFLRQDGRVFRQPRGLFDFLRQHV
tran una masa ventricular mayor en individuos que HQGRFULQDV WHVWRVWHURQD WLUR[LQD FDWHFRODPLQDV
SUDFWLFDQHMHUFLFLRVGLQiPLFRV\GHSRUWHVGHUHVLVWHQ- KRUPRQDGHFUHFLPLHQWR TXHSRGUtDQLQXLUVREUH
FLDDHUyELFDFRQUHODFLyQDVXMHWRVWHVWLJRV   HOJUDGRGHKLSHUWURD  
8QPHWDDQiOLVLVTXHLQFOX\yHVWXGLRV\ /DDFWLYLGDGItVLFDDFW~DFRPRUHJXODGRUGHODH[-
DWOHWDV FRPSUREy TXH H[LVWHQ GLIHUHQFLDV HQWUH ODV presin de protenas metablicas y estructurales en el
adaptaciones morfolgicas a los entrenamientos est- miocardio y el msculo esqueltico a partir de efec-
WLFRVGLQiPLFRV\PL[WRVFRQUHVSHFWRDOGLiPHWURGH tos directos sobre la carga volumtrica y de presin
la cavidad y el espesor septal, aunque los promedios \SRUPHGLRGHPRGLFDFLRQHVHQIDFWRUHVGHFUHFL-
no superaron las dimensiones consideradas normales PLHQWR\HQHOQLYHOGHFDWHFRODPLQDV  
SDUDODSREODFLyQJHQHUDO  2WURKDOOD]JRGHHVWH No todos los atletas de un mismo grupo etreo,
estudio fue la normalidad de las funciones sistlica y con el mismo nivel de entrenamiento e involucra-
diastlica ventricular izquierda. GRVHQHOPLVPRGHSRUWHSUHVHQWDQPRGLFDFLRQHV
Hemos evaluado el ecocardiograma de futbolistas HVWUXFWXUDOHV\HOpFWULFDVPDQLIHVWDGDVHQHOH[DPHQ
profesionales en perodos de entrenamiento activo y cardiovascular. Es posible pensar en otras variables,
los comparamos con sedentarios del mismo grupo PiVDOOiGHOGHSRUWHTXHSXHGDQLQXLUHQODPDQL-
HWiUHR   /D PDVD YHQWULFXODU L]TXLHUGD IXH VLJQL- festacin del corazn de atleta. /DH[SUHVLyQIHQRWt-
FDWLYDPHQWHPD\RUHQORVGHSRUWLVWDVDXQTXHQLQ- SLFDGHXQSHUOJHQpWLFRGHWHUPLQDGRSRGUtDLQXLU
JXQRVXSHUyORVPPGHGLiPHWURGLDVWyOLFR6LQ en los cambios estructurales cardacos encontrados.
embargo, no se hallaron diferencias en los espesores (OGHSRUWHDFWXDUtDFRPRHOHVWtPXORH[WHUQRSDUDOD
de septum ni de pared posterior. aparicin de tales cambios. En atletas entrenados en
Los cambios en las dimensiones cardacas suelen resistencia aerbica fue posible demostrar que po-
producirse en forma rpida con el entrenamiento. En OLPRUVPRVHQHOJHQ07GHDQJLRWHQVLQyJHQR
nadadores de alta competencia se observaron incre- HVWDEDQDVRFLDGRVFRQODYDULDELOLGDGGHKLSHUWURD
PHQWRVGHPPHQHOGLiPHWURGLDVWyOLFRYHQWULFX- ventricular izquierda que presentaban. Los depor-
ODUL]TXLHUGR\GHPPHQHOHVSHVRUGHODSDUHG tistas homocigotas para el alelo T tenan corazones
GHVSXpVGHVHPDQDVGHHQWUHQDPLHQWR  +DVLGR PiVKLSHUWURDGRV  
GHVFULSWDODUHYHUVLELOLGDGGHODVPRGLFDFLRQHVFDU- En otros estudios que compararon deportistas
dacas generadas por el deporte en perodos relativa- de alto rendimiento con individuos sanos y seden-
mente cortos. Los cambios en las dimensiones de la WDULRVVHVXJLULyTXHHOSROLPRUVPRSDUDHO$'1
cavidad fueron ms rpidos que los producidos en el de la enzima convertidora de angiotensina I repre-
espesor parietal. Sin embargo, se han realizado estu- senta un factor gentico fuertemente asociado a los
GLRV HQ FLFOLVWDV GH DOWR UHQGLPLHQWR GHVSXpV GH  DWOHWDVGHHOLWH  


CAPTULO 13 El corazn del deportista

(O VLVWHPD QHUYLRVR DXWyQRPR MXHJD XQ SDSHO HALLAZGOS ELECTROCARDIOGRFICOS


LPSRUWDQWHHQODVPRGLFDFLRQHVGHOFRUD]yQGHOGH- El remodelamiento cardaco generado en el atleta por
portista. El entrenamiento sistemtico incrementa el su entrenamiento sistemtico est frecuentemente
tono vagal de reposo y disminuye el nivel de cate- DVRFLDGRFRQPRGLFDFLRQHVHOHFWURFDUGLRJUiFDV
colaminas plasmticas. Los estudios de variabilidad Resulta de vital importancia reconocer las anor-
de frecuencia cardaca en deportistas han demostrado malidades que puedan indicar una cardiopata subya-
correlaciones entre la masa ventricular izquierda y el cente de aquellas secundarias a la prctica deportiva.
incremento de los parmetros de variabilidad en los Los cambios generados en el electrocardogra-
GRPLQLRVGHOWLHPSR\ODIUHFXHQFLD   PD (&* GHODWOHWDIXHURQGHVFULSWRVHQP~OWLSOHV
(Q GHSRUWLVWDV DxRVRV IXH SRVLEOH GHPRVWUDU LQ- publicaciones. Antonio Pelliccia y col evaluaron
crementos de la variabilidad especialmente en los  LQGLYLGXRV MyYHQHV DQWHV GH LQJUHVDU D OD
FRPSRQHQWHVGHEDMD\PX\EDMDIUHFXHQFLD   SUiFWLFD GH GHSRUWHV GH DOWR UHQGLPLHQWR   /RV
(QMXJDGRUHVGHI~WEROSURIHVLRQDOHVKHPRVREVHU- WUD]DGRV DQRUPDOHV DSDUHFLHURQ  HQ  VXMHWRV
vado una mayor variabilidad de frecuencia con incre-  HLQFOX\HURQEORTXHRLQFRPSOHWRGHUDPD
mentos en el desvo estndar de los RR y la raz cuadra- derecha, repolarizacin precoz, prolongacin del
da de las diferencias de los intervalos RR con respecto a PR y ondas T negativas como hallazgos ms fre-
VXMHWRVVHGHQWDULRVVDQRVGHODPLVPDHGDG   cuentes. Las anormalidades fueron ms prevalentes
/DV PRGLFDFLRQHV REVHUYDGDV SRU HO HQWUHQD- HQKRPEUHVTXHHQPXMHUHV
PLHQWR VLVWHPiWLFR JHQHUDQ XQ FRQMXQWR GH VLJQRV En un estudio anterior, el mismo grupo haba
que constituyen el sndrome del corazn de atleta. PRVWUDGR HQ  GHSRUWLVWDV GH DOWR UHQGLPLHQWR
La importancia de su compresin radica en el hecho TXH HO  SUHVHQWDEDQ HOHFWURFDUGLRJUDPDV PX\
de poder distinguirlo de la presencia de una cardio- DQRUPDOHVPHGLDQDPHQWHDQRUPDOHV\
pata en un atleta. Estas diferencias no son siempre WUD]DGRV QRUPDOHV   7DPELpQ HQ HVWD VHULH ORV
claras y someten al mdico a la dura decisin de pro- hombres tuvieron mayores anormalidades que las
hibir o no la prctica deportiva. PXMHUHVDWOHWDV(VWDREVHUYDFLyQDOHUWDVREUHODVGH-
(OH[DPHQFDUGLRYDVFXODUGHOGHSRUWLVWDSHUPLWH portistas con hallazgos patolgicos, ya que se debera
REVHUYDU PRGLFDFLRQHV FRQ UHVSHFWR DO VXMHWR VH- tener en cuenta la posibilidad de patologa cardaca
dentario de un mismo grupo etreo. Tales hallazgos asociada a los cambios elctricos.
SXHGHQPDQLIHVWDUVHHQHOH[DPHQItVLFR\HQORVGL- /RV HUURUHV GH LQWHUSUHWDFLyQ HQWUH FDPELRV -
ferentes estudios complementarios de diagnstico. siolgicos o patolgicos pueden tener consecuencias
VHULDV /D GHVFDOLFDFLyQ LQQHFHVDULD GH DWOHWDV SRU
EXAMEN FSICO sospecha de cardiopata suele asociarse a problemas
psicosociales y econmicos de importancia. Por otro
Los pulsos perifricos suelen ser amplios y la pre- lado, la interpretacin como normal de un electrocar-
sin arterial sistmica normal en reposo. La palpa- diograma que podra llevar al diagnstico de una car-
cin torcica suele detectar un choque de punta am- diopata puede poner en riesgo la vida del deportista
SOLR\GHVSOD]DGRDODL]TXLHUGDSRUIXHUDGHOWR  Figura 13.1.
espacio intercostal. Este hallazgo es ms frecuente /DVPRGLFDFLRQHVFRPXQHVHQHO(&*GHODWOHWD
en deportistas delgados. incluyen a la bradicardia sinusal, bloqueo A-V de
La auscultacin cardaca demuestra ruidos nor- JUDGRUHSRODUL]DFLyQSUHFR]\FULWHULRVGHYROWDMH
PDOHVPLHQWUDVTXHODSUHVHQFLDGHHU\WRUXLGRV SDUDKLSHUWURDYHQWULFXODUL]TXLHUGD  
HVPiVIUHFXHQWHDXQTXHGHEDMDSUHYDOHQFLDHQWUH ([LVWHQRWUDVPRGLFDFLRQHVTXHVHREVHUYDQFRQ
los atletas. una frecuencia menor y que deberan llevar a evalua-
(QGHSRUWLVWDVMyYHQHVVHSXHGHQGHWHFWDUVRSORVVLV- ciones con otros estudios complementarios. El con-
WyOLFRVQRSDWROyJLFRVHQWUHHO\GHORVFDVRV senso de la Sociedad Europea de Cardiologa consi-
Son protosistlicos, localizados en focos pulmonar y der que tales cambios incluyen a las ondas T nega-
PHVRFDUGLRVHPRGLFDQFRQORVFDPELRVGHGHF~ELWR WLYDVHQRPiVGHULYDFLRQHVFRQWLJXDVODSUHVHQFLD
VXHOHQGHVDSDUHFHUHQSRVLFLyQGHSLH RPRYLPLHQWRV GHRQGDV4DQRUPDOHVODGHVYLDFLyQGHOHMHHOpFWULFR
respiratorios y pueden incrementarse en la fase de post GHO456DODL]TXLHUGDORVGHIHFWRVGHFRQGXFFLyQ
presin en la maniobra de valsalva. En chequeos pre intraventriculares y la patente smil Brugada en
participativos aplicados a grupos amplios de atletas se SUHFRUGLDOHVGHUHFKDV  
recomienda la auscultacin en posicin de pie para tra- 2WURV KDOOD]JRV HOHFWURFDUGLRJUiFRV QR JHQHUD-
tar de disminuir los falsos positivosGHOH[DPHQ dos por el deporte y que determinan estudios posterio-


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

Figura 13.1: ECG de futbolista profesional asintomtico y sin antecedentes personales ni familiares. Se observa bradicardia
sinusal, QRS mellado en V1 y V2, onda R de alto voltaje, evidencias de repolarizacin precoz con ondas J en derivaciones
inferiores y laterales y ondas T +- en V5 y V6. Se efectuaron ergometra de 12 derivaciones, monitoreo Holter de 24 horas, eco-
cardiograma Doppler de reposo y esfuerzo, resonancia magntica nuclear y coronariografa por TAC multicorte a raz de una
transferencia a un club europeo que solicit los estudios para llevarla a cabo. Todos los estudios fueron normales no demostrn-
dose cardiopata estructural ni arritmias. A 5 aos de seguimiento el futbolista contina con su carrera sin sntomas ni eventos.

UHVLQFOX\HQDODVSDWHQWHVGHSUHH[FLWDFLyQYHQWULFXODU bres. Esto podra atribuirse a varios factores, entre


47SURORQJDGRRFRUWRLQIUDGHVQLYHOGHOVHJPHQWR67 los que se incluyen la menor participacin en depor-
y bloqueos completos de rama. (Tabla 13.1) tes de muy alta intensidad esttica y dinmica, que
/DVPXMHUHVDWOHWDVWLHQHQXQDPD\RUSURSRUFLyQ VRQORVTXHSURYRFDQODVPD\RUHVPRGLFDFLRQHVHQ
GH(&*VLQPRGLFDFLRQHVDQRUPDOHVTXHORVKRP- el ECG y los menores cambios morfolgicos carda-
FRVKDOODGRVHQODPXMHUGHSRUWLVWD
Tabla 13.1: anormalidades en el ECG del atleta (27, 28).
En los deportistas de raza negra se han encontrado
Comunes No comunes ORVFDPELRVHOHFWURFDUGLRJUiFRVGHPD\RUPDJQLWXG
 Agrandamiento A I El tipo de deporte y la intensidad y duracin de
 Infradesnivel del ST ORV HQWUHQDPLHQWRV SXHGHQ LQXLU HQ ORV FDPELRV
 Bradicardia sinusal
 Q patolgicas HOHFWURFDUGLRJUiFRV3RUHMHPSORDTXHOORVGHSRUWHV
 Bloqueo A-V 1er.
 Ondas T invertidas 2 ms TXH UHTXLHUHQ XQD HOHYDGD UHVLVWHQFLD DHUyELFD FL-
Grado
derivaciones consecutivas
 QRS mellado en FOLVPRUHPRFDUUHUDVGHHVTXtPDUDWyQ VHDVRFLDQ
 BCRD y BCRI
V1
 Desviacin del eje QRS a la
DIUHFXHQFLDVFDUGtDFDVPiVEDMDVHQ(&*GHUHSR-
 Repolarizacin VRDVtFRPRDPD\RULQFUHPHQWRGHYROWDMHGHO456
izquierda
precoz con respecto a deportes con mayores componentes de
 HBAI HBPI
 Criterios de HVI fuerza y velocidad.
 QT largo o corto
por voltaje
 Brugada like
 Arritmias HALLAZGOS MS FRECUENTES EN
HVI: hipertroa ventricular izquierda EL ECG DEL ATLETA
AI: aurcula izquierda
BCRD: bloqueo completo rama derecha
BCRI: bloqueo completo rama izquierda
BRADICARDIA SINUSAL
HBAI: hemibloqueo anterior izquierdo Debera ser considerada como una variable normal.
HBPI: hemibloqueo posterior izquierdo 'LIHUHQWHV HVWXGLRV KDQ GHVFULSWR KDVWD XQ  GH


CAPTULO 13 El corazn del deportista

bradicardia sinusal en electrocardiogramas de atletas TRASTORNOS DE LA CONDUCCIN A-V


GHDOWRUHQGLPLHQWR\KDVWDFXDQGRVHHYDOXD- A.- Bloqueo A-V de 1er. grado:
URQ PRQLWRUHRV +ROWHU GH  KRUDV   6L ELHQ VH Diferentes series han descripto prolongacin del in-
KDOODURQIUHFXHQFLDVFDUGtDFDVGHKDVWDODWLGRVSRU WHUYDOR35VXSHULRUDPVHJHQWUHHODGH
minuto, ante la presencia de pausas superiores a los VXMHWRVHQWUHQDGRVPLHQWUDVTXHORSUHVHQWDEDQVyORHO
 PLOLVHJXQGRV HQ HVWXGLRV +ROWHU HV QHFHVDULR GHVXMHWRVVHGHQWDULRVQRUPDOHV  7DOYH]ODV
descartar trastornos asociados de la funcin sinusal. series que encontraron mayores frecuencias de bloqueo
/DV SDXVDV PD\RUHV VH SURGXFHQ GXUDQWH HO VXHxR A-V de 1er. grado puedan corresponder a poblaciones
PLHQWUDVTXHGXUDQWHODDFWLYLGDGGLDULDVRQH[WUHPD- GH GHSRUWLVWDV GHULYDGDV HVSHFtFDPHQWH SDUD VX HYD-
damente raras. Si bien la bradicardia puede atribuirse luacin. La frecuencia de su aparicin, tal como la brdi-
a hipertona vagal y disminucin del tono simpti- cardia sinusal, depende de las circunstancias en que se
FR H[SHULHQFLDV FRQ FRUD]RQHV IDUPDFROyJLFDPHQ- realiz el electrocardiograma, el nivel de ansiedad del
te denervados permitieron observar disminucin de VXMHWR\VXHVWDGRGHUHODMDFLyQ\DTXHPtQLPRVDXPHQ-
la frecuencia cardaca en reposo como respuesta al tos en el tono simptico normalizan la conduccin. Por
entrenamiento y esto ha sugerido un componente RWUD SDUWH HO LQWHUYDOR 35 VH DFRUWD DO LQLFLDU HO HMHU-
cardaco intrnseco envuelto en el mecanismo de la cicio. El retardo de la conduccin A-V desencadenado
EUDGLFDUGLD  (VWXGLRVHOHFWURVLROzJLFRVUHDOL]D- por el esfuerzo debe ser considerado patolgico.
da en atletas y sedentarios con bloqueo simptico y B.- Bloqueo A-V de 2do. grado tipo Mobitz I (con
SDUDVLPSiWLFRGHPRVWUDURQODH[LVWHQFLDGHLQXHQ- perodos de Wenckebach):
cias no autonmicas responsables de la bradicardia 6X SUHYDOHQFLD IXH GHVFULSWD HQWUH HO  DO  HQ
GHUHSRVRGHOGHSRUWLVWD   JUXSRVGHDWOHWDVGHGLVWLQWDVGLVFLSOLQDV  6HREVHU-
Tambin se ha propuesto a la disminucin de la va en mayor proporcin en individuos entrenados en
VHQVLELOLGDGDODVFDWHFRODPLQDV\DPRGLFDFLRQHVHQ deportes de resistencia aerbica. En un mismo deportis-
el impulso neural al ndulo sinusal como mecanismos ta puede aparecer en forma espordica, ya que ante una
DGLFLRQDOHVHQODSURGXFFLyQGHEUDGLFDUGLDVLQXVDO   frecuencia sinusal elevada desaparece. Ante su presen-
La arritmia sinusal de reposo tambin es ms fre- FLDVHUHFRPLHQGDODUHDOL]DFLyQGHXQHMHUFLFLR SXHGH
FXHQWHHQHODWOHWD\GHVDSDUHFHFRQHOHMHUFLFLR6H VHUXQDSUXHEDHUJRPpWULFD SDUDREVHUYDUODUHVSXHVWD
KDGHWHFWDGRHQWUHXQDXQGHORVGHSRUWLVWDV de la conduccin A-V. Figuras 13.2 A y 13.2 B.

Figura 13.2 A: ECG de reposo de deportista de alto rendimiento varn de 21 aos realizado 4 das antes de competencia nacio-
nal. Bloqueo A V de 2 grado tipo Mobitz I. Prolongacin progresiva del PR y P bloqueadas. Perodo 4:3 y un episodio 2:1.
Pausas de hasta 2400 mseg.


J. MILEI & J. LERMAN - TEMAS DE ACTUALIDAD EN CARDIOLOGA

C.- Bloqueo A-V de 2do. grado tipo Mobitz II: TRASTORNOS DE CONDUCCIN
Sugiere alteracin orgnica de la conduccin, INTRAVENTRICULARES
aunque se han publicado casos aislados con pausas La imagen de bloqueo incompleto de rama derecha
QRFWXUQDVGHKDVWDVHJXQGRVFRQDUWHULDVFRURQDULDV HQHO(&*GHVXSHUFLHHVXQRGHORVKDOOD]JRVPiV
normales y conduccin normal al abandonar la prc- IUHFXHQWHV(OFRPSOHMR456PHOODGRHQ9KDVLGR
WLFDGHSRUWLYD  (OHQWUHQDPLHQWRSRGUtDDFWXDU DWULEXLGR D PRGLFDFLRQHV YHFWRULDOHV VHFXQGDULDV
FRPR HVWtPXOR SDUD SRQHU GH PDQLHVWR SDWRORJtDV a un aumento de la masa muscular del ventrculo
TXHQRVHGHWHFWDEDQHQUHSRVR   derecho ms que a un verdadero trastorno de con-
D.- Bloqueo A-V completo: duccin. Ha sido descripta esta morfologa entre el
Debe considerrselo como un proceso patol- DOGHORVDWOHWDV  (QXQDVHULHGHIXWER-
JLFR RUJiQLFR \ FRQWLQXDU FRQ ORV H[iPHQHV FR- listas profesionales hemos encontrado una frecuen-
rrespondientes para su estudio. En una serie de FLDGHO%  
 DWOHWDV VH HQFRQWUDURQ GRV EORTXHRV $9 La presencia de bloqueo completo de rama dere-
completos con normalizacin de la conduccin cha o izquierda, as como los hemibloqueos, no son
DQWHODHVWLPXODFLyQVLPSiWLFD  (QHVWRVFDVRV consecuencia de la prctica deportiva y debe descar-
se restaur el ritmo normal al abandonar el entre- WDUVHDOJ~QHYHQWXDOFDUGLRSDWtDDVRFLDGD  
namiento y no hubo progresin del bloqueo en un
VHJXLPLHQWRDQXHYHDxRV(VIDFWLEOHTXHODSUiF- RITMOS DE LA UNIN AURICULO-
tica deportiva haya sido el estmulo para poner de VENTRICULAR
PDQLHVWRXQDSDWRORJtDVXE\DFHQWHHQHOVLVWHPD Su frecuencia de aparicin en monitoreos Holter de
de conduccin. KRUDVIXHUHIHULGDHQXQGHDWOHWDVGHDOWR
Es necesario recalcar que todas las alteraciones rendimiento mientras su presencia en ECG se des-
GHODFRQGXFFLyQGHVFULSWDVGHVDSDUHFHQFRQHOHMHU- FULELyHQWUHXQDXQGHWDOHVGHSRUWLVWDV  
cicio si el trastorno es secundario al entrenamiento. Por lo general son ritmos intermitentes que apare-
La prueba de esfuerzo es un elemento de inestimable FHQFRQIUHFXHQFLDVVLQXVDOHVLQIHULRUHVDODWLGRV
valor en el diagnstico diferencial con los estados por minuto.
patolgicos.

Figura 13.2 B: Prueba de ejercicio realizada al mismo deportista donde se observa la normalizacin de la conduccin A-V con el
esfuerzo. Sigui compitiendo y en un seguimiento prolongado no present eventos ni trastornos permanentes de la conduccin A-V.


CAPTULO 13 El corazn del deportista

VOLTAJE DE LAS ONDAS En atletas de raza negra la inversin de ondas T


ELECTROCARDIOGRFICAS Y REPOLARIZACIN en precordiales derechas suele ser ms frecuente que
VENTRICULAR HQORVGHSRUWLVWDVEODQFRV(QXQHVWXGLRVREUH
(OLQFUHPHQWRGHYROWDMHGHOFRPSOHMR456\ODVRQ- DWOHWDVQHJURV\EODQFRVHQWUHDDxRVGH
das P con mayor duracin y amplitud son hallazgos diferentes disciplinas deportivas se demostr que las
IUHFXHQWHV HQ HO (&* (O FULWHULR GH YROWDMH FRPR RQGDV7QHJDWLYDVHVWXYLHURQSUHVHQWHVHQHO
GLDJQyVWLFRGHKLSHUWURDHQHODWOHWDQRWLHQHVLJQL- GHORVDWOHWDVQHJURV GH9D9\HQGH-
FDFLyQFOtQLFD'LIHUHQWHVVHULHVHVWXGLDURQDWOHWDVGH ULYDFLRQHVODWHUDOHV \HQGHORVEODQFRV  
YDULDVGLVFLSOLQDVREVHUYDQGRLQFUHPHQWRVGHYROWDMH Las inversiones de la onda T fueron, por lo general,
superiores en aquellos involucrados en deportes de re- asimtricas o bifsicas precedidas por elevacin del
sistencia aerbica. Sharma y col. estudiaron los ECG VHJPHQWR67FRQFRQYH[LGDGVXSHULRU/DVRQGDV7
GHDWOHWDVGHDxRVGHHGDG\GHVFULELHURQFUL- negativas en atletas negros nunca fueron precedi-
WHULRVGHYROWDMH 6RNRORZ SDUDKLSHUWURDYHQWULFX- das por infradesnivel del ST. En evaluaciones con
ODUHQHOPLHQWUDVTXHORVVHGHQWDULRVGHVLPLODU ecocardiografa, pruebas ergomtricas y re