You are on page 1of 450

EJÉRCITO DE TIERRA

MANDO DE ADIESTRAMIENTO Y DOCTRINA

CURSO TIRADOR DEL VCI/C “PIZARRO”

FECHA DE ENTRADA EN VIGOR:


DEROGA: MI6-203 MANUAL DE INSTRUCCIÓN. TRIPULACIÓN VCI/C “PIZARRO”

USO OFICIAL
FICHA DE TEORÍA

1. CÓDIGO: 002-499-001.

2. DESCRIPCIÓN: VEHÍCULOS DE COMBATE. GENERALIDADES.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones, vídeos con distintos modelos, versiones y aspectos de algunos
vehículos de combate, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. DEFINICIÓN DE VEHÍCULO DE COMBATE.

El VCI/C es un sistema de armas capaz de acompañar al carro de combate,


combatir en colaboración con éste y transportar bajo protección acorazada un
Elemento de Combate a Pie, al que puede apoyar con sus armas de a bordo.

Como tal vehículo de combate, reseñar que también puede desarrollar misiones por
si solos, de forma autónoma, formando parte de agrupamientos donde sólo exista el
elemento mecanizado o prevalezca sobre los carros de combate.

Está concebido para potenciar a las unidades acorazadas y mecanizadas de


Infantería y Caballería. Esencialmente apropiado para la acción ofensiva; en
particular en operaciones de reconocimiento, seguridad y combate. Especialmente
diseñado para acompañar a los carros de combate en cualquier situación y de forma
permanente. Posee una gran protección tanto activa como pasiva, gran movilidad,
adecuada potencia de fuego y capacidad de combate pie a tierra proporcionada por
la unidad transportada.

8.2. CARACTERÍSTICAS DE LOS VEHÍCULOS DE COMBATE.

8.2.a. Características tácticas.

Movilidad.

Es la capacidad de moverse por toda clase de terreno en cualquier condición


meteorológica.

1-1
Combina dos facultades: la de trasladarse de un punto a otro con la velocidad
precisa para llegar en el momento oportuno y la de franquear obstáculos.

La movilidad táctica depende de los siguientes factores:

x Aptitud de franqueamiento de obstáculos y de vadeo.


x Grado de maniobrabilidad o facilidad para la conducción.
x De las condiciones técnicas del vehículo.

Potencia de fuego.

Se define como el volumen de fuego proporcionado por un sistema de armas. Se


determina por el número y tipo de proyectiles que se pueden disparar en la unidad
de tiempo.

Puede considerarse que es una magnitud directamente relacionada con el número


de armas, sus calibres y las velocidades de tiro de cada arma.

Autonomía.

Es la distancia que puede ser cubierta sobre la superficie del terreno por un vehículo
terrestre, que está cargado con los depósitos de carburante y bidones adicionales de
dotación al completo, sin repostar.

Depende de la capacidad de los depósitos y del consumo del motor.

Protección acorazada.

Es función de:

x Espesor e inclinación del blindaje.


x Calidad de los materiales que lo componen.
x Perfil general del vehículo.
x Protección adicional pasiva.

Capacidad de choque.

Como consecuencia de las anteriores características las unidades dotadas con estos
medios por su gran potencia de fuego, protección acorazada y gran capacidad de
maniobra poseen una gran capacidad de choque contra las unidades enemigas, bien
acompañando a los carros de combate o bien constituyendo el núcleo principal de
los Agrupamientos tácticos con apoyos de carros de combate facilitan a las unidades
de Infantería y Caballería el cumplimiento de las misiones asignadas.

8.2.b. Servidumbres de los vehículos.

Peso.

El blindaje, el armamento, el grupo motopropulsor, etc., hacen del vehículo un medio


de combate con un peso considerable, de hasta 29 Tn., que puede condicionar e

1-2
incluso impedir el paso por puentes, terrenos pantanosos, vías con limitación de
peso, etc.

Vulnerabilidad.

Es el grado en que el vehículo es susceptible de ser localizado o atacado, así como


de sus posibilidades de supervivencia en caso de ataque.

Depende del grado de protección del vehículo (blindaje, dimensiones, etc.) y de su


velocidad. Las partes más vulnerables de un vehículo, son:

x El suelo.
x Los costados y el tren de rodaje.
x El techo.
x El portón de la cámara de personal.
x La unión de la torre al casco.
x Los órganos de visión y puntería.
x El portón trasero.

Visión limitada.

La visión desde el interior del vehículo es probablemente su mayor servidumbre,


siendo muchos los espacios muertos, así como de gran dificultad el poder realizar
una visión conjunta del terreno, llegando a ser, en condiciones de escasa visibilidad,
motivo de detención de la unidad.

Ruido.

El ruido del motor y de las cadenas hace difícil que un vehículo pueda moverse sin
ser descubierto por el enemigo, incluso a gran distancia. El elevado consumo de
corriente hace necesario tener arrancado el motor para no consumir las baterías,
incluso en periodos de observación, perdiendo la posibilidad de no producir ruido.

Fatiga del personal.

La tripulación de un vehículo está sometida a un gran desgaste físico y psíquico


como consecuencia de las condiciones en las que tiene que actuar: espacio
reducido, sensación de claustrofobia, traqueteos, ruidos, malos olores, etc.

Terreno.

En función de la pendiente, naturaleza del suelo, accidentes del terreno, vegetación,


cultivos, construcciones y obras de toda clase que en él existan, variarán las
posibilidades de actuación de los vehículos.

Como regla general, los terrenos pantanosos, con grandes pendientes y arbolados,
dificultan la utilización de los vehículos.

Las edificaciones de cierta altura con espacios estrechos entre ellas y los puntos de
paso obligado aumentan en gran medida la vulnerabilidad de estos vehículos.

1-3
Apoyo logístico.

Necesidad continua de apoyo logístico, especialmente en lo referente a la reposición


de carburante y munición, y al mantenimiento del material.

Condiciones atmosféricas.

Los agentes atmosféricos pueden hacer variar las condiciones de empleo de los
vehículos, afectando en líneas generales a su rendimiento y, en algunos casos,
aumentando su consumo y su necesidad de mantenimiento. Las temperaturas
extremas llegan a afectar, e incluso anular, determinados elementos principales del
vehículo.

8.3. HISTORIA Y EVOLUCIÓN DEL VEHÍCULO DE COMBATE.

Fue durante la segunda guerra mundial, con el empleo masivo de los carros de
combate en las batallas, cuando los ejércitos sintieron la necesidad de que los
fusileros pudieran acompañar a los carros durante el movimiento, ocupándose el
carro del choque y los fusileros de la protección inmediata del carro y de la
ocupación del terreno si procedía.

Se intentó solucionar el problema empleando unidades de Caballería a caballo como


acompañamiento y montado los fusileros en el mismo carro, métodos muy
empleados por los soviéticos, pero la gran vulnerabilidad al fuego en ambos casos,
desaconsejaba su empleo, mostrando la necesidad de contar con vehículo
específico para realizar éste cometido.

Entre estos vehículos destacaron el vehículo de cadenas BREN CARRIER Inglés y


los semiorugas del ejército Estadounidense y Alemán, la mayoría de los cuales
carecían de coraza en el techo de los vehículos.

De esta forma de pensar surgieron los primeros vehículos con cierta coraza,
dedicados al transporte de personal, cuya misión sería acompañar a los carros de
combate o acercar a los combatientes hasta las líneas enemigas con una cierta
protección, para luego desembarcar en las proximidades y combatir pie a tierra.

En los años sesenta se llegó a la conclusión de que estos vehículos no estaban


preparados para poder acompañar a los carros en la mayoría de las ocasiones,
debido a:

x Escasa protección de coraza.


x Nula protección NBQ.
x Armamento inadecuado para el combate desde el vehículo.
x Escasa evolución de movilidad con respecto a la de los carros.
x Nula capacidad de combate nocturno desde el vehículo.

Como el vehículo estadounidense que dio lugar a la gran familia del M-113 que de
alguna forma es el más claro exponente del vehículo tipo APC (Armoured Personnel
Carrier).

1-4
Existe una importante, aunque a veces poco clara, distinción entre un vehículo de
transporte y un vehículo de combate. La misión del vehículo de transporte es llevar
al soldado de un lugar a otro de la zona de acción, para que desembarque y luche
pie a tierra. Sin embargo el vehículo de combate ha sido diseñado para aumentar la
capacidad de combate de las unidades acorazadas de Infantería y Caballería y
permitir una más eficaz cooperación fusileros-carros.

Se puede decir que el primer vehículo de combate fue el AMX VCI francés que entró
en servicio en él ejercito galo en el 1957, con posterioridad se le sustituyó por el
AMX 10 que presentaba una torre biplaza con cañón de 20 mm, partiendo de este
vehículo el ejército francés diseñó toda una auténtica familia con versiones PC,
Recuperación, transmisiones, etc. Si bien los estadounidenses sintieron la necesidad
de un vehículo de combate antes que los alemanes, fueron estos últimos los
primeros en fabricarlos. En 1970 el Marder completó su primera fase de producción,
con una torre biplaza y un cañón de 20mm.

El ejército americano sintió la necesidad de un vehículo de combate a finales de los


sesenta, el primer prototipo que cumplió los requisitos fue el XM701 que no era mas
que una variante del M110, con un cañón de 20mm pero no pasó de la fase de
prototipo, después se construyó el XM765, que luego más tarde un desarrollo de él
dio lugar al AIFV que se ha constituido en la versión barata del Bradley. Los Estados
Unidos en un principio optaron por la opción de fabricar un solo vehículo para
Infantería y para Caballería, pero con posterioridad decidieron fabricar dos vehículos
distintos, así dieron a luz el Bradley M-2 de Infantería y el Bradley M-3 de
reconocimiento de Caballería, suministrándose las primeras unidades a principio de
los 80.

En la actualidad se encuentran en el mundo muy variados vehículos de combate que


difieren unos de otros, más por las posibilidades económicas del país constructor
que por las necesidades propias del mismo.

La más reciente incorporación a esta gama de vehículos ha sido el VCI/C Pizarro


(1994 1º prototipo y 1999 salieron los primeros vehículos de preserie) de fabricación
española, que por sus características técnicas está llamado a ocupar un lugar
preferente entre esta generación de vehículos.

9. RESUMEN.

El VCI/C es un sistema de armas capaz de acompañar al carro de combate,


combatir en colaboración con éste y transportar bajo protección acorazada a un
Elemento de Combate a Pie, al que puede apoyar con sus armas de a bordo.

Está concebido para potenciar las unidades acorazadas y mecanizadas de Infantería


y Caballería; esencialmente apropiado para la acción ofensiva; en particular en
operaciones de reconocimiento seguridad y combate; especialmente diseñado para
acompañar a los carros de combate en cualquier situación y de forma permanente;
posee una gran protección tanto activa como pasiva, gran movilidad, adecuada
potencia de fuego y capacidad de combate pie a tierra proporcionada por la unidad
transportada.

Las características tácticas de un vehículo de combate son:


1-5
x Movilidad.
x Potencia de fuego.
x Autonomía.
x Protección.

La potencia de fuego depende del número de armas, sus calibres y velocidades de


tiro.

La movilidad y la autonomía dependen de las condiciones técnicas del vehículo de


combate.

La protección depende del blindaje, de la protección adicional pasiva y de la silueta


general del vehículo.

Las servidumbres y limitaciones de estos vehículos son:


x Peso.
x Vulnerabilidad.
x Escasa visión.
x Ruido.
x Fatiga de su tripulación.
x El terreno y las condiciones atmosféricas.
x Apoyo logístico.
x Consumo de corriente con los sistemas encendidos y el motor parado.

La historia de los vehículos de combate pasa desde la fabricación del AMX VCI
francés pasando por el Bradley, Marder, CV90 hasta llegar al vehículo más
avanzado Pizarro.

1-6
FICHA DE TEORÍA

1. CÓDIGO: 002-499-002.

2. DESCRIPCIÓN: VEHÍCULO DE COMBATE VCI/C PIZARRO.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones, vídeos del VCI/C “Pizarro”, CD ayudas a la Instrucción
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II)

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. ANTECEDENTES HISTÓRICOS.

1984: El ejército español, toma la decisión de definir un vehículo de combate que


pueda formar binomio con la nueva generación de carros de combate (Plan META).
1985: Creación de la comisión de estudio para la realización de una definición del
vehículo.
1986: Se aprueban las especificaciones y presentación al GEIP (grupo
independiente de programas europeos) con informe favorable.
1988: Se designa a la Empresa Nacional Santa Bárbara (ENSB) como contratista
principal.
1989: Se vuelve a realizar una definición de requisitos operacionales.
1990: La ENSB, se asocia con STEYR DAIMLER PUCH, creando ASCOD AIE.
1991/93: Intereses del ejército noruego en el vehículo, hacen que el ministerio de
defensa español decida impulsar el programa. Se realizan conversaciones para la
colaboración trilateral (ESPAÑA, AUSTRIA y NORUEGA) para el desarrollo de un
VCI/C.
1994: El ejército español recepciona el primer prototipo de VCI/C y se inicia el
proceso de contratación de 45 VCI/C y se inicia la definición del VCPC.
1994/99: Se hacen pruebas de resistencia y tiro con el primer prototipo, se evalúa el
segundo prototipo, se realizan pruebas de resistencia y tiro con los 4 vehículos de
preserie.
1999: El 12 de octubre de 1999 desfilan 14 VCI/C por las calles de Madrid.
1999: El 29 de Octubre se presenta en Zaragoza el VCI/C PIZARRO a la OSCE.
2001: Hay un Batallón operativo en el RIMZ Córdoba 10 (Córdoba) perteneciente a
la DIMZ “Brunete” 1.
2014: Finaliza la entrega de 121 VCI de combate y 24 VCPC.

8.2. CARACTERÍSTICAS Y POSIBILIDADES DEL VEHÍCULO.

1-7
8.2.a. Características generales del vehículo

Sus características generales son:

x Gran movilidad en todo tipo de terreno.


x Funcionamiento seguro entre -25º y +45º.
x Arranque del motor a temperaturas extremas.
x Aislamiento para reducir la firma térmica1 y los ruidos interiores.
x Instrucción y mantenimiento sencillo.
x Gran potencia de fuego.
x Elevada protección.

8.2.b. Posibilidades generales del vehículo.

Potencia de fuego.

Armamento.

x Cañón de 30 mm modelo Máuser (armamento principal).


x Ametralladora de 7,62 mm coaxial con el cañón (armamento secundario).
x Lanzaingenios (12 tubos) armamento complementario.

Elementos de puntería y Dirección de Tiro.

El VCI/C Pizarro dispone de una Dirección de Tiro estabilizada y con cámara


térmica, lo que le permite a la tripulación realizar el tiro con precisión y rapidez, en
cualquier condición de visibilidad.

Los elementos de los que disponen son los siguientes:

x Dos posibilidades de visión; una diurna en el periscopio del Tirador y Jefe de


Vehículo (periscopio auxiliar no afectado por la dirección de tiro), y otra
nocturna con visión térmica para el Tirador y Jefe de Vehículo.
x Un telémetro láser que proporciona la distancia al objetivo, introduciéndola
automáticamente en la dirección de tiro, metiéndose las correcciones
necesarias en el retículo de punterías del Tirador y en el monitor de la cámara
térmica (Jefe de Vehículo y Tirador).
x Una unidad de control principal que compensa los efectos de las principales
variables que intervienen en el tiro (viento, desgaste del tubo, temperatura,
inclinación del vehículo, etc.).
x Una serie de sensores automáticos que suministran sus datos a la unidad de
control principal.
x Un sistema de estabilización de torre y cañón que permite a éste mantener
una orientación fija a pesar de los giros y oscilaciones del vehículo.

Municiones.

1 Firma térmica: Imagen captada por un sensor térmico, que recoge la energía residual emitida por un

móvil en algún punto de su trayectoria


1-8
El VCI/C, tiene capacidad para transportar las siguientes municiones:

400 disparos para cañón 2 252 HEI, 150 APDS


Cargador derecho 118 HEI
Cargador izquierdo 78 APDS
Contenedor barcaza 134 HEI
Contenedor barcaza 70 APDS
También puede portar y disparar TPT, MP, APDS,
APFSDS
3800 cartuchos de 7,62 mm
Empleo inmediato 400 (1 cargador)
Almacenados 3400 (1 cargador de
400 de respeto + 12
cajas de 250)
2800 cartuchos de 5´56mm
Almacenados en el compartimento de la unidad
transportada
36 Artificios de 76 mm
Empleo inmediato 12
Cajas de la torre 24

Blindaje.

Protege a la tripulación del efecto de proyectiles de hasta 30 mm. (a cierta distancia


y con unos ángulos determinados) y de metralla de proyectiles de artillería. Para las
partes más expuestas del vehículo: Parte frontal, escudo y laterales de la torre
dispone además de un blindaje adicional tipo reactivo (SABLIR) que le protege de
los efectos de la munición de carga hueca.

Su espesor y composición le protegen contra las radiaciones de explosiones


nucleares y polvo radiactivo, lo que unido a la utilización del SCCA (sistema
compacto de control ambiental), que dispone de filtro NBQ, le posibilita el seguir
combatiendo en este tipo de ambiente durante un cierto periodo de tiempo, así como
hacer frente a cualquier ataque con armas biológicas.

Otros dispositivos.

x Doce tubos lanzaingenios, situados en cuatro grupos de tres en ambos lados


de la torre. Posibilitan a la tripulación, crear una barrera de humos que
proporcione al vehículo el grado de protección suficiente para facilitar un
cambio de posición, así como poder lanzar granadas de fragmentación
contrapersonal (los tres tubos de atrás de cada lado).
x Sistema Compacto de Control Ambiental (SCCA) que proporciona al vehículo,
aire acondicionado, calefacción y protección NBQ. Situado en la parte interior
trasera del vehículo se acciona desde el panel de instrumentos del conductor.
x Sistema contraincendios de la cámara del grupo motopropulsor.
x Situado en el interior de la cámara de conducción.
x Sistema antiexplosión de la cámara de personal. Situado en el interior de la
unidad transportada muy cerca del SCCA.

2 HEI: Proyectil alto explosivo incendiario


APDS: Proyectil perforante con capacetes (sabots) desprendibles.
1-9
8.3. PARTES QUE SE CONSIDERAN EN EL VEHÍCULO.

Básicamente el VCI/C “Pizarro se divide en:

x Barcaza.
x Torre.

En la barcaza se encuentran la cámara de personal, la cámara del grupo


motopropulsor y el tren de rodaje y suspensión, y en la torre las cámaras de
combate y de armas.

8.3.a. Barcaza.

Exterior de la barcaza.

Es la parte del vehículo que aloja y protege sus órganos vitales.

Por su parte superior presenta unas aberturas para el alojamiento de la torre, la


escotilla del conductor, el motor, las rejillas para la toma de aire del motor, el acceso
para las tres baterías colocadas en la parte superior, los distintos accesos para el
repostaje, la escotilla para dos tripulantes de la unidad transportada, la escotilla del
jefe de la unidad transportada y el alojamiento del SCCA.

Por su lateral derecho, las rejillas de salida de aire de refrigeración.

Por su lateral izquierdo, el acceso a las tres baterías colocadas en la parte inferior.

A ambos lados se acopla el tren de rodaje y la suspensión del vehículo.

Por su parte inferior están las válvulas de drenaje de la cámara del motor y de la
unidad transportada así como el orificio para vaciado del aceite de motor.

Por su parte trasera está el hueco para el portón trasero y la salida de gases del
motor.

Interior de la barcaza.

Dividido en cámara de personal con (puesto de conducción y compartimento de la


unidad transportada) y cámara del grupo motopropulsor.

Puesto de conducción.

Situado en la parte anterior de la barcaza, está provista de los elementos necesarios


para la puesta en marcha, conducción y control del motor. Se encuentra separada
de la cámara de combate por un mamparo cortafuegos.

Cámara del Elemento de Combate a Pie.

Con capacidad para 7 fusileros/exploradores con su armamento y equipo de


combate, tiene como elementos destacados:
1-10
x Los depósitos de carburantes.
x Alojamientos del armamento individual.
x Cocina.
x Sistema de apertura de los dos portones.
x Sistema contraincendios.
x Sistema antiexplosión.
x Parte del sistema interfónico.
x Parte de la dotación de munición de las armas.
x Extintores, petacas de agua, botiquín, difusores de la calefacción, etc.

Cámara del motor.

En la que se encuentran: el motor, la transmisión y los ventiladores. A ella se puede


acceder por arriba levantando el portón del motor (eléctrico o manual) y desde el
conductor quitando dos tapas, si bien el acceso está limitado a algunas partes del
motor.

Tren de rodaje y suspensión.

Es el conjunto de elementos que facilitan la progresión del vehículo por toda clase
de terreno. Constituido en cada costado por:

x Cadena.
x Ruedas de marcha y rodillos de apoyo.
x Amortiguadores y topes.
x Barras de torsión.

8.3.b. Torre.

El VCI/C PIZARRO monta una torre biplaza de estructura monobloque, en el que


van integrados los componentes principales del sistema de armas, sistemas de
punterías y comunicaciones.

EN EL PLANO HORIZONTAL

Cuerpo de la torre: Aloja los sistemas de punterías, el armamento y el sistema de


comunicaciones.
Cesta de la torre: Aloja el sistema eléctrico, asientos y otros elementos auxiliares.

EN EL PLANO VERTICAL

Cámara de combate: Constituye la cámara de personal de la torre; aloja al JV y al


Tirador, los elementos de control, puntería, comunicaciones, cargadores de munición
de cañón y otros elementos auxiliares.
Cámara de armas: Aloja, en su parte superior las armas y sus afustes, mecanismos
de control y elementos auxiliares. En su parte inferior los alojamientos del cargador
de la AM y el almacén de recogida de vainas

9. RESUMEN.
1-11
Durante el año 1984 el ejército español comienza a madurar la idea de la necesidad
de disponer de un vehículo de combate. En el año 1988 y una vez definidas las
características necesarias del vehículo, se designa contratista principal a la ENSB.
En el año 1991 se realizan conversaciones para la cooperación trilateral de España,
Noruega y Austria en el desarrollo del VCI/C. De los años 1994 a 1999 se realizan
las pruebas de calificación del vehículo, desfilando en Madrid en Octubre del 1999
una compañía de vehículos Pizarro. En 2014 finaliza la entrega de 121 VCI de
combate y 24 VCPC.

Sus características generales son:


x Gran movilidad en todo tipo de terreno.
x Funcionamiento seguro entre -25º y +45º.
x Arranque del motor a temperaturas extremas.
x Aislamiento para reducir la firma térmica y los ruidos interiores.
x Instrucción y mantenimiento sencillo.
x Gran potencia de fuego.
x Elevada protección.
x Entre sus posibilidades más importantes destacan:
x Su armamento: cañón de 30 mm y su ametralladora coaxial de 7,62 mm.
x Doce tubos lanzaartificios posibilitan a la tripulación crear una barrera de
humos para aumentar su protección
x Dirección de Tiro estabilizada, con cámara térmica y telémetro láser.
x Dotación de munición de cañón 402 disparos.
x Dispone de un blindaje adicional tipo reactivo (SABLIR) para las partes más
expuestas.
x Dispone de medios de visión nocturna para el Conductor (intensificador),
Tirador y Jefe de Vehículo (cámara térmica con dos pantallas).
x Sus sistemas especiales más importantes son:
x Sistema Compacto de Control Ambiental (SCCA).
x Sistema contraincendios.
x Sistema antiexplosión.

Exteriormente se divide en: barcaza y torre.

La barcaza, es la parte que aloja a los órganos vitales al conductor y a la unidad


transportada. A ella se acopla el tren de rodaje y la suspensión del vehículo.

El tren de rodaje y suspensión está formado por las cadenas, las ruedas de marcha
y rodillos de apoyo, los amortiguadores, los topes y las barras de torsión.

La torre es la parte donde se alojan el jefe de vehículo y el tirador, el armamento, las


transmisiones, los sistemas de puntería, movimiento y control. Va acoplada la
barcaza con posibilidad de girar horizontalmente 360º, así como permite la elevación
del cañón de -10º hasta +50º, mediante un sistema manual o eléctrico.

1-12
FICHA DE TEORÍA

1. CÓDIGO: 612-400-003.

2. DESCRIPCIÓN: CARACTERÍSTICAS GENERALES Y DATOS TÉCNICOS DE LA


BARCAZA DEL VEHÍCULO.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula / vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones del VCI/C “Pizarro”, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. DESIGNACIÓN DE MATERIAL.

El “Pizarro” es un vehículo de cadenas fabricado por GD Santa Bárbara Sistemas


S.A especialmente diseñado para el combate de Infantería y Caballería. Está
construido íntegramente en acero, de gran hermeticidad, va dotado, como arma
principal, de un cañón de 30 mm y de avanzados sistemas ópticos, electrónicos y de
protección pasiva. Todo ello hace del Pizarro un completo sistema de armas de
notables capacidades de fuego, protección y movilidad en todo tiempo, situación y
ambiente de combate.

)LJXUD9LVWDJHQHUDOGHOYHKtFXOR

1-13
Denominación: Vehículo de Combate de Infantería y Caballería PIZARRO VCI/C

8.2. CARACTERÍSTICAS.

8.2.a. Dotación de personal.

Tripulación total .............................................................................10


Distribución en la cámara de personal:
Cámara de combate.............................................................. 2
Cámara de conducción ......................................................... 1
Cámara del Elemento de Combate a pie .............................. 7

8.2.b. Dimensiones del vehículo

)LJXUD'LPHQVLRQHVGHYHKtFXOR

1-14
)LJXUD'LPHQVLRQHVGHODWRUUH

8.2.c. Masas y presiones.

En orden de combate................................................................28,3 t
En orden de marcha ................................................................. 26,5 t
1-15
Casco...........................................................................................19 t
Torre en orden de combate ........................................................3,7 t
GMP (con líquidos y útil de izado) ..............................................3,5 t
Presión específica............................................................. 0,7 kg/cm2

8.2.d. Movilidad: prestaciones y capacidades

Velocidad máxima en carretera ............................................ 70 km/h


Aceleración de 0 a 50 km/h (aprox.) .......................................... 20 s.
Aceleración de 0 a 60 km/h (aprox.) .......................................... 30 s.
Relación potencia/peso en combate (en vacío) ........21,2 (22,6) CV/t
Diámetro mínimo de giro (pivotaje) sin cajas de almacenaje7.500 mm
Diámetro mínimo de giro (pivotaje) con cajas de almacenaje8.600 mm
Capacidad de franqueamiento de obstáculos:
Pendiente longitudinal superable .....................................60%
Pendiente lateral ..............................................................30%
Anchura superable zanja ........................................2.000 mm
Altura superable obstáculo vertical ............................800 mm
Capacidad de vadeo sin preparación............ ..........1.300 mm
Capacidad de vadeo con preparación.....................1.500 mm
Autonomía en carretera ......................................................... 500 km

1-16
)LJXUD0RYLOLGDG

8.2.e. Lubricantes, carburante y refrigerante: cantidades.

8.2.e.(1). LUBRICANTES:
Motor: Cambio de aceite.............................................................27 L
Transmisión:
Primer llenado............................................. .....................95 L

1-17
Cambio de aceite .............................................................70 L
Relleno de MIN a MAX. (aprox.) ........................................6 L
Ventilador: Cambio de aceite......................................................34 L
Pasos finales: Cambio de aceite (por paso) ..............................6,8 L

8.2.e.(2). CARBURANTE
Tipo de carburante.................................... Gasóleo F54 y F34 o F40
Capacidad total del circuito.......................................................610 L
Depósito principal...........................................................420 L
Depósito secundario ......................................................140 L
Depósito nodriza ..............................................................50 L

8.2.e.(3). CIRCUITO DE REFRIGERACIÓN DEL MOTOR


Líquido refrigerante, cambio .......................................................65 L

8.3. CARACTERÍSTICAS GRUPO MOTOPROPULSOR.

8.3.a. Motor.

x Fabricante: MTU. 8V 183 TE 22


x Número de cilindros: 8 V
x Disposición de los cilindros: En V a 90º.
x Sistema de refrigeración: Líquido (circuito cerrado).
x Cilindrada total: 14.62 L.
x Potencia nominal: 600 CV (2.300 rpm).
x Velocidad a ralentí: 750 a 760 rpm
x Tipo de carburante: Gasóleo F54, F34 o F40.

8.3.b. Transmisión.

x Tipo: Hidromecánica automática, con mecanismos integrados de marcha


atrás, dirección y frenos. RENK HSWL 106 C
x Cambio de velocidades: Automático de 6 velocidades adelante.
x Cambio de velocidades de emergencia.
x Frenos: De servicio, Hidrodinámico, Fricción y de aparcamiento

8.3.c. Pasos finales.

Tipo. Reducción por engranajes de dientes rectos.

8.3.d. Sistemas periféricos del GMP.

8.3.d.(1). SISTEMA DE ADMISIÓN DE AIRE DEL MOTOR.


La función de este sistema es proporcionar aire limpio de impurezas al motor. El
sistema de filtrado consta de dos etapas:
a) Filtrado preliminar: filtro ciclónico para partículas superiores a 5 Pm con
extractor de partículas.
b) Filtrado principal: cartuchos de papel para partículas superiores a 2 Pm.

8.3.d.(2). SISTEMA DE ALIMENTACIÓN DE COMBUSTIBLE:


1-18
El sistema de alimentación de combustible es el encargado de alimentar los
siguientes elementos:
a) Motor
b) Calefactor del sistema de control ambiental.

8.3.d.(3). SISTEMA DE ESCAPE DEL MOTOR:


El sistema de escape sirve para conducir los gases de escape del motor al exterior
del vehículo, después de accionar las turbinas de los turbocompresores. La
conducción se efectúa a través de las tuberías de ambos lados del motor hacia el
silencioso y desde éste a través de otra tubería al exterior del vehículo.

8.3.d.(4). SISTEMA DE REFRIGERACIÓN DEL GMP.


El sistema de refrigeración es el responsable de refrigerar los siguientes elementos:
1. Cilindros y culatas del motor
2. Aceite del motor
3. Aceite de la transmisión
4. Aceite del sistema hidráulico de los ventiladores
5. Combustible de retorno
6. Aire de admisión a la salida de los turbocompresores

8.4. SISTEMA DE RODAJE

La composición del tren de rodaje es la siguiente (Fig. 3.5):

)LJXUD(OHPHQWRVGHOWUHQGHURGDMH

1. Rueda tensora (x2).


2. Mecanismo tensor de la cadena (x2)
3. Cadena: Diehl 129 C6, de eje doble, conector final y zapatas de goma.
Eslabones por cadena: 81 (dos zapatas de goma cada uno)
Anchura de la cadena: 500 mm
4. Ruedas de rodaje (7 dobles x2).
5. Rodillos guía de apoyo (4 dobles x2).
6. Rueda propulsora (de doble corona de 11 dientes x2).

8.5. SUSPENSIÓN.

Está formada por (Fig. 3.6):

1-19
a) ELEMENTO ELÁSTICO: Barras de torsión (5) situadas sobre el piso de la
barcaza y transversalmente, limitadas por topes finales hidráulicos (1) o topes
finales de caucho (4) dependiendo de la rueda. Tienen por misión absorber
las irregularidades del terreno.
b) ELEMENTO AMORTIGUADOR: Amortiguadores rotativos hidráulicos (2).
Tienen por misión frenar las oscilaciones de las barras de torsión (rebote).
c) ELEMENTOS DE CONEXIÓN (INTERFASES) CON EL TREN DE RODAJE
x Brazos de suspensión
x Bielas de conexión

)LJXUD(OHPHQWRVGHODVXVSHQVLyQ  

1. Tope hidráulico (3 a cada lado para las ruedas 1ª, 2ª y 7ª).


2. Amortiguador (3 a cada lado para las ruedas 1ª, 2ª y 6ª).
3. Biela de conexión entre amortiguador y brazo de suspensión.
4. Tope elástico (5 a cada lado para las ruedas 2ª, 3ª, 4ª, 5ª y 6ª).
5. Barra de torsión (Fig. 3.7) (Una por rueda/brazo)
6. Brazo de la suspensión

)LJXUD(OHPHQWRVGHODVXVSHQVLyQ  'LVSRVLFLyQGHODVEDUUDVGHWRUVLyQ

8.6. SISTEMA ELÉCTRICO.


1-20
Es el encargado de proporcionar alimentación eléctrica a todos los sistemas tanto
del casco como de la torre.
Su esquema básico responde al convencional de un generador movido por el propio
motor, regulador de voltaje y baterías. El generador es un alternador trifásico
acoplado al propio motor. Las baterías en número de seis por su parte, está
conectadas de modo que cuatro de ellas se encargan del arranque del motor y las
otras dos se encargan de dar servicio a los distintos sistemas a motor parado. En
caso de necesidad es posible conectar las seis baterías para el arranque del motor.
Para accionar determinados sistemas es necesario arrancar el motor. El sistema es
de 24 V y las baterías se recargan a través del alternador.
Las características técnicas de los componentes más importantes de la instalación
eléctrica son las que se exponen en el Manual Técnico correspondiente al vehículo.

)LJXUD(OHPHQWRVSULQFLSDOHVGHODLQVWDODFLyQHOpFWULFD

1. Baterías 4. Generador (alternador motor)


2. Panel de disyuntores 5. Caja de conexiones trasera
térmicos
3. Panel de instrumentos

8.7. SISTEMA COMPACTO DE CONTROL AMBIENTAL (SCCA).

8.7.a. Sistema de ventilación.

Lugar de instalación. Cámara de personal.


Sobrepresión estática máxima. 7,5 mbar.

8.7.b. Sistema N.B.Q.

Sobrepresión. Válvula a 7.5 mbar.


Control de velocidades. 3 velocidades.
Prefiltro. Ciclónico con expulsor individual.
1-21
Filtro N.B.Q. Cilíndrico compuesto.
Control. Medidor de sobrepresión y saturación de filtro.

8.8. SISTEMA EXTRACTOR DE GASES DE LA CÁMARA DE ARMAS.

Lugar de instalación. Torre.


Tipo. Soplador/extractor.

8.9. BOMBAS DE ACHIQUE.

Número. 2
Emplazamiento. 1 en cámara GMP.
1 en cámara de personal.

8.10. SISTEMA CONTRAINCENDIOS Y ANTIEXPLOSIÓN

El vehículo dispone de dos sistemas independientes:


 Sistema de contraincendios de la cámara del motor y
 Sistema antiexplosión de la cámara de personal
Ambos sistemas están complementados por dos extintores portátiles.

8.11. ELEMENTOS DE VISIÓN DEL CASCO.

8.11.a. Conductor.

1 Periscopio central. Mod M27 (sin aumento)


2 Periscopios laterales. Mod. MIC (sin aumento)

8.11.b. Visión nocturna.

Equipo. Periscopio PCN-160 con tubo intensificador de 2ª


generación.
Autonomía con pilas. 60 horas.

8.12. BLINDAJE.

8.12.a. Casco.

8.12.a.(1). BLINDAJE EXTERIOR.


En el exterior de la barcaza se montan 40 placas de blindaje inerte (Fig. 3.9 nº 1)
fijadas a la barcaza mediante tornillos y que pueden ser sustituidas por placas de
blindaje reactivo de las mismas dimensiones y aspecto.

1-22
)LJXUD3ODFDVGHEOLQGDMH

8.12.a.(2). BLINDAJE INTERIOR.


Interiormente dispone de placas de blindaje antiesquirlas (spall liner) para protección
del personal (Fig. 3.9 nº2).

8.12.a.(3). FALDONES (Fig. 3.10).


Los faldones laterales contribuyen a la protección lateral por encima del tren de
rodaje frente a granadas de carga hueca.
Asimismo, junto con los guardabarros delanteros (3) y traseros (5), limitan las
salpicaduras de barro y el polvo cuando se circula por pistas embarradas o
polvorientas. Están divididos en cuatro tramos (4) y van sujetos a unos ejes (2) sobre
los que giran para poderse levantar y facilitar las operaciones de mantenimiento del
tren de rodaje. Dichos ejes están fijados en su posición vertical con pasadores (1).

)LJXUD)DOGRQHVODWHUDOHV

Para poder levantar los faldones (Fig. 3.11) es necesario desenganchar las dos
placas de fijación de faldones (3), y extraer los pernos de fijación (2) de los faldones
a los ejes de giro (1).

1-23
)LJXUD)LMDFLyQGHORVIDOGRQHV

8.12.b. Torre.

El blindaje de la torre está constituido por planchas de acero mecanosoldadas, que


combinando ángulos y espesores, se obtiene la protección adecuada. Además, éste
blindaje se ve reforzado en partes vitales.

8.12.b.(1). ADICIONAL EXTERIOR.


Está formado por PLACAS DE BLINDAJE inerte (Fig. 3.12. nº 1) fijadas a la
estructura de la torre y que pueden ser sustituidas por placas de blindaje reactivo
SABBLIR de las mismas dimensiones y aspecto.

)LJXUD%OLQGDMHH[WHULRU

8.12.b.(2). ADICIONAL INTERIOR.


Interiormente dispone de planchas de blindaje antiesquirlas (spall liner) para
protección del Jefe de Vehículo y Tirador (Fig. 3.13. nº 1).

1-24
)LJXUD3ODFDVGHSURWHFFLyQLQWHULRU

8.13. SISTEMA DE COMUNICACIONES.

El vehículo está dotado de un sistema de comunicaciones compuesto por los


siguientes elementos principales:
 1 Equipo de interfonía ROVIS
 1 Equipo radio:
o Versión MANDO SECCIÓN/COMPAÑÍA: ES/VRC-9502V2
o Versión LÍNEA: ES/VRC-9500V2

9. RESUMEN.

1-25
1-26
FICHA DE TEORÍA

1. CÓDIGO: 612-400-004.

2. DESCRIPCIÓN: DESCRIPCIÓN EXTERIOR DEL CASCO.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones, vídeos y vehículo Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. FRONTAL DEL CASCO.

)LJXUD9LVWDDQWHULRU

1-27
1. Cadena 7. Escotilla del Conductor
2. Guardabarros delanteros 8. Periscopios del Conductor
3. Conjunto faro derecho 9. Conjunto faro izquierdo y claxon
4. Espejos retrovisores 10.Ganchos de remolque
5. Bisagras del portón del GMP 11.Difusor lavaperiscopio
6. Portón de acceso a la cámara del motor 12.Placas de blindaje

8.2. TRASERA DEL CASCO

)LJXUD9LVWDSRVWHULRU

1. Cadena 11.Escotilla de fusileros


2. Cajas de almacenaje 12.Salida tubo de escape
3. Cruz de seguimiento 13.Ganchos de remolque
4. Faldones laterales 14.Toma de aire (schnorkel) para
5. Conjuntos luces traseras vadeo
6. Catadióptricos 15.Bisagra portón trasero
7. Caja teléfono exterior 16.Portón trasero
8. Petacas 17.Periscopio portón trasero
9. Argollas de elevación 18.Rótula de disparo FUSA
10.Escotilla del Jefe del Elemento de 19.Palanca de bloqueo del portón
Combate a Pie. (JECP) 20.Caja exterior control apertura del
portón trasero

1-28
8.3. LATERAL IZQUIERDO DEL CASCO

)LJXUD9LVWDFRVWDGRL]TXLHUGR

1. Conjunto faro izquierdo y claxon 12.Mecanismo tensor de cadena


2. Espejo retrovisor 13.Tope hidráulico
3. Periscopios del Conductor 14.Amortiguador rotativo
4. Escotilla del Conductor. 15. Topes de goma
5. Escotilla del JECP. 16.Rodillo de apoyo
6. Argolla de elevación. 17.Puerta lateral de acceso a las
7. Caja de almacenaje baterías
8. Petaca. 18.Rueda de rodaje
9. Cruz de seguimiento. 19.Pulsador exterior de
10.Cables de remolque emergencia del sistema
11.Rueda tensora contraincendios. Cadena
20.Cadena.
21.Faldón lateral
22.Rueda propulsora

8.4. LATERAL DERECHO DEL CASCO

1-29
)LJXUD9LVWDFRVWDGRGHUHFKR

1. Petaca 13.Amortiguador rotativo


2. Caja de almacenaje 14.Tope hidráulico
3. Argolla de elevación 15.Rueda de rodaje
4. Palanca/diente retenida escotilla fusileros 16.Faldón lateral
5. Tope de goma escotilla fusileros 17.Topes fijos de goma
6. Varilla de sujeción puerta filtros NBQ 18.Rodillo de apoyo
7. Puerta acceso filtros NBQ 19.Cadena
8. Caja utensilios de vadeo 20.Útiles de zapador
9. Rejilla salida de aire de refrigeración 21.Mecanismo tensor de cadena
10.Espejo retrovisor 22.Rueda tensora
11.Conjunto faro derecho 23.Salida tubo de escape
12.Rueda propulsora

8.5. PARTE SUPERIOR DEL CASCO

1-30
)LJXUD9LVWDVXSHULRU

1. Conjunto faros delanteros 17.Toma de aire (schnorkel) para


2. Espejos retrovisores vadeo
3. Bisagras portón GMP 18.Escotilla de fusileros
4. Fijación dispositivo de seguridad 19.Barra de ayuda entrada rápida a
del portón de la cámara del motor la cámara del ECP
5. Portón de la cámara del motor 20.Escotilla JECP
6. Rejilla entrada aire de 21.Maza
refrigeración 22.Eslabones de repuesto
7. Rejilla entrada aire alimentación 23.Tapas acceso a los aforadores
8. Portillo de acceso depósito 24.Bocas de carga de carburante
refrigerante y varilla y tapón de 25.Varilla sujeción puerta sup.
llenado de aceite. baterías
9. Salida bombas de achique 26.Puerta superior acceso a baterías
10.Entrada aire equipo NBQ 27.Periscopio lateral fusileros
11.Puerta acceso filtros NBQ 28.Escotilla del Conductor
12.Varilla sujeción puerta NBQ 29.Periscopios Conductor
13.Palanca retenida escotilla 30.Escobillas limpia-periscopio
fusileros 31.Orejetas sujeción parabrisas
14.Argollas de elevación exterior
15.Cajas de almacenaje 32.Difusor lava periscopio / mampara
16.Petacas 33.Placas blindaje

8.6. ACCESOS DE PERSONAL.

El casco dispone de los siguientes accesos de personal (Fig. 4.6):


1. Escotilla del conductor
2. Portón trasero
3. Escotilla del JECP
4. Escotilla de fusileros
1-31
FICHA DE TEORÍA

1. CÓDIGO: 612-400-005.

2. DESCRIPCIÓN: DESCRIPCIÓN EXTERIOR DE LA TORRE.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula, Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones PC, vídeos y vehículo Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento
de segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. DESCRIPCIÓN EXTERIOR DE LA TORRE.

8.1.a. Vista lateral izquierda.

)LJXUD7RUUH  9LVWDODWHUDOL]TXLHUGD

1. Tubo del cañón 9. Batería lanzaingenios izquierda


2. Manguito guía del tubo del 10.Soporte asiento JV
cañón 11.Protector trasero
3. Placas blindaje adicional 12.Asiento JV
4. Periscopio de puntería del JV 13.Junta rotativa

1-37
5. Periscopios de observación del 14.Protector lateral izquierdo
JV 15.Almacén de vainas
6. Soporte banderas 16.Alojamiento cargador AM
7. Base de antena coaxial
8. Cajas de almacenaje

8.1.b. Vista lateral derecha.

)LJXUD7RUUH  9LVWDODWHUDOGHUHFKD

1. Periscopios de observación del 4. Protector derecho


Tirador 5. Asiento Tirador
2. Periscopio de puntería del 6. Batería lanzaingenios derecha
Tirador
3. Acceso a la cámara de armas

8.1.c. Vista superior.

1-38
)LJXUD7RUUH  9LVWDVXSHULRU

1. Placas de blindaje 9. Cajas de almacenaje


2. Cabeza del periscopio de 10.Base de antena
puntería del Tirador 11.Bandas antideslizantes
3. Periscopios de observación del 12.Periscopios de observación del
Tirador JV
4. Escotilla del Tirador 13.Batería lanzaingenios
5. Baterías lanzaingenios derecha izquierda
6. Válvula de sobrepresión NBQ 14.Escotilla del JV
7. Base de antena 15.Cabeza del periscopio de
8. Banda antideslizante puntería del JV
16.Manguito guía de la
ametralladora

8.1.d. Vista frontal.

1-39
)LJXUD7RUUH  9LVWDIURQWDO

1. Base de antena 11. Cesta de la torre


2. Periscopio del Tirador 12. Acceso a alojamiento del cargador
3. Periscopios de observación del JV de la AM coaxial
4. Periscopio del JV 13. Acceso al almacén de recogida de
5. Protector balístico del JV vainas
6. Base de antena 14. Junta rotativa
7. Periscopio de observación del JV 15. Acceso a mecanismos de la
8. Batería lanzaingenios izquierda cámara de armas
9. Placas de blindaje 16. Cañón
10. AM coaxial 17. Batería lanzaingenios derecha
18. Periscopio de observación del
Tirador

8.1.e. Vista trasera.

1-40
)LJXUD7RUUH  9LVWDWUDVHUD

1. Periscopios de observación del 10. Cesta de la torre


JV 11. Asiento Tirador
2. Base de antena 12. Protector derecho
3. Periscopio del JV 13. Protector trasero
4. Mástil luz giratoria 14. Junta rotativa
5. Argolla de elevación trasera 15. Protector izquierdo
6. Cabeza de periscopio Tirador 16. Asiento JV
7. Base de antena 17. Calas de almacenaje
8. Batería lanzaingenios derecha 18. Batería lanzaingenios derecha
9. Cajas de almacenaje

8.1.f. Vista inferior

1-41
)LJXUD7RUUH  9LVWDLQIHULRU

1. Salida del extractor de gases de 5. Junta rotativa


la cámara de armas derecho 6. Anclaje del pestillo de fijación
2. Sensor de posición (a las 12) de la torre a las 12 (sobre el
para la autoelevación del cañón casco)
3. Salida del extractor de gases de 7. Anclaje del pestillo de fijación
la cámara de armas izquierdo de la torre a las 9 (sobre el
4. Piso de la cesta casco)

8.2. ACCESOS.

8.2.a. Accesos a la cámara de combate. (Fig. 5.7)

8.2.a.(1). DESDE EL EXTERIOR.

La torre dispone de dos escotillas para el acceso al interior de la torre desde el


exterior, una para el Jefe de Vehículo (1) a la izquierda y una segunda para el
Tirador (2) a la derecha. Sus puertas están construidas de acero de blindaje y
proporcionan la misma protección que el techo de la torre. Ambas son idénticas y
con una situación simétrica de sus mandos con respecto al eje longitudinal de la
torre, pudiéndose situar en cuatro posiciones: cerrada, observación protegida,
vertical y abatida hacia atrás. Su manejo se explica en la ficha 612-400-038 de este
manual.

1-42
)LJXUD$FFHVRVDOLQWHULRUGHODWRUUH

8.2.a.(2). DESDE EL CASCO.

La torre dispone de un acceso interior (4), desde la cámara de personal del casco a
través de unas puertas de celosía correderas (3 y 6) sobre raíles (5). A través de
dichas puertas y según la posición de la torre, puede accederse bien a la cámara de
combate, bien a las puertas de acceso a los compartimentos inferiores de la cámara
de armas.
Disponen, como el resto de escotillas de sendos contactores eléctricos de cierre,
con el fin de detectar si no están perfectamente cerradas Su manejo se explica en la
ficha 612-400-038 de este manual.

8.2.b. Accesos a la cámara de armas.

8.2.b.(1). DESDE LA CÁMARA DE COMBATE (Figs. 5.8 y 5.9).

1-43
)LJXUD$FFHVRVDODFiPDUDGHDUPDVGHVGHODFiPDUDGHFRPEDWH  

)LJXUD$FFHVRVDODFiPDUDGHDUPDVGHVGHODFiPDUDGHFRPEDWH  

1. Panel de acceso al doble 4. Acceso a la ametralladora


alimentador coaxial
2. Cerramiento central de acceso 5. Acceso a la guía flexible
al cañón izquierda
3. Acceso al cargador de la AM 6. Acceso a la guía flexible
coaxial derecha
7. Acceso adicional a la guía
flexible derecha

8.2.b.(2). DESDE EL CASCO.

Para acceder a los mismos debe girarse la torre colocando el cañón a las seis.

1-44
)LJXUD$FFHVRVDODFiPDUDGHDUPDVGHVGHODFiPDUDGHO(&3

1. Ventana de acceso al alojamiento del cargador de la AM coaxial


2. Ventana de acceso al almacén de recogida de vainas
3. Registro de acceso a mecanismos de la cámara de armas

9. RESUMEN.

1-45
FICHA DE TEORÍA

1. CÓDIGO: 612-400-008.

2. DESCRIPCIÓN: SISTEMA ELÉCTRICO.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones PC, VCI /C Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. SISTEMA ELÉCTRICO.

Es el encargado de proporcionar alimentación eléctrica a todos los sistemas tanto


del casco como de la torre.

8.1.a. Descripción y elementos principales

Su esquema básico responde al convencional de un generador movido por el propio


motor, regulador de voltaje y baterías. El generador es un alternador trifásico
acoplado al propio motor. Las baterías en número de seis por su parte, está
conectadas de modo que cuatro de ellas se encargan del arranque del motor y las
otras dos se encargan de dar servicio a los distintos sistemas a motor parado. En
caso de necesidad es posible conectar las seis baterías para el arranque del motor.
Para accionar determinados sistemas es necesario arrancar el motor. El sistema es
de 24 V y las baterías se recargan a través del alternador.
Las características técnicas de los componentes de la instalación eléctrica se
describen en el Manual Técnico correspondiente al vehículo.

1-59
)LJXUD(OHPHQWRVSULQFLSDOHVGHODLQVWDODFLyQHOpFWULFD

1. Baterías 4. Generador (alternador motor)


2. Panel de disyuntores 5. Caja de conexiones trasera
térmicos
3. Panel de instrumentos

8.1.a.(1). COMPARTIMENTO DE BATERÍAS

La caja de baterías está situada en el lateral izquierdo del casco y en ella se instalan
las seis baterías que lleva el vehículo. Se accede exteriormente a través de dos
accesos, uno lateral y uno superior (Fig. 8.2)
Las baterías se encuentran conectadas en serie, en grupos de a dos, superior e
inferior. Los dos primeros grupos de 4 baterías, (2+2), están conectados en serie-
paralelo y corresponden a las destinadas al arranque, proporcionando una tensión
de 24 V y una capacidad de 200 A·h.
El tercer grupo de dos baterías (1+1) corresponde a los servicios del vehículo
proporcionando una tensión de 24 V y una capacidad de 100 A·h. (Fig. 8.2).

1-60
)LJXUD9LVWDGHOFRPSDUWLPHQWRGHEDWHUtDV

1. Grupo de baterías de arranque 2. Grupo de baterías de servicios


(2 superiores + 2 inferiores) (1 superior + 1 inferior)

En el interior del compartimento lateral, en la parte superior (Fig. 8.3), se encuentran


dos tomas de corriente para acoplamiento de cable esclavo. La toma delantera se
usa para arranque y la trasera para servicios. Estas tomas sirven tanto para admitir
como proporcionar energía eléctrica y permiten la conexión con un grupo generador
externo.
Además de las tomas de corriente se encuentra una caja para el acoplamiento de un
sistema cargador de baterías.

1-61
)LJXUD6LWXDFLyQGHODVFRQH[LRQHVH[WHUQDV

1. Conexión arranque 4. Conexión cargador de


2. Conexión cargador baterías baterías
3. Conexión servicios 5. Disyuntores baterías

8.1.a.(2). PANEL DE DISYUNTORES TÉRMICOS

En el panel delantero de la caja de baterías, situado en la parte posterior izquierda


del puesto del Conductor, van situados los disyuntores térmicos principales del
vehículo, así como sus respectivos pulsadores de desconexión. Los disyuntores
corresponden a:

1-62
)LJXUD3DQHOGHGLV\XQWRUHVWpUPLFRV

1. Disyuntor principal del 4. Grupo electrohidráulico (160 A)


vehículo (100 A) 5. Interruptor selector de carga
2. Pulsadores de desconexión
3. Disyuntor principal de la torre
(160 A)

PRECAUCIÓN
A temperaturas inferiores a 0º C, el interruptor de tensión de carga de las
baterías debe colocarse en la posición invierno para asegurar una carga
óptima de las baterías.

8.1.a.(3). PANEL DE INSTRUMENTOS DEL CONDUCTOR

1-63
FICHA DE TEORÍA

1. CÓDIGO: 612-400-009.

2. DESCRIPCIÓN: SISTEMA CONTRAINCENDIOS.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Transparencias, diapositivas, VCI /C Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. SISTEMA CONTRAINCENDIOS DE LA CÁMARA GMP

Su función es la detección y extinción automática de incendios que puedan


producirse en la cámara del motor. El sistema posee la capacidad de detectar los
calentamientos anormales o incendios y extinguirlos en todas las condiciones
posibles de empleo del motor y del vehículo. Su manejo se detalla en la ficha 612-
400-015 de este manual.

8.1.a. Descripción y elementos principales (Fig. 9.1)

1-79
)LJXUD6LVWHPDFRQWUDLQFHQGLRVGHODFiPDUDGHOPRWRU

El sistema se compone de los elementos siguientes:


 Subsistema de detección: basado en el empleo de un cable (8) sensor de
temperatura. El cable detector es lo bastante sensible como para detectar las
condiciones de “calentamiento” o de “fuego”, incluso cuando solamente se
calientan porciones muy pequeñas del cable.
 Subsistema de extinción: formado por un cilindro de extinción (1) con HALÓN
1301, como agente extintor y un conjunto de tuberías (2) y difusores de
dispersión (3).
 Subsistema de lógica y control, constituido por:
o Una caja de control (4), que contiene la lógica del sistema.
o Un zumbador de alarma de fuego (5)
o Un interruptor exterior de emergencia (6)

8.1.b. Caja de Control (Fig. 9.2)

1-80
)LJXUD&DMDGHFRQWURO

Nº DENOMINACIÓN FUNCIÓN
1 Luz testigo CILINDRO. Indica presión del cilindro baja o descargado.
2 Luz testigo AVERIA. Indica cortocircuito en el circuito de detección.
3 Luz testigo ALARMA. Indica sobrecalentamiento o fuego activado por
el subsistema de detección.
4 Luz testigo POTENCIA. Indica que existe suministro de energía al
sistema.
5 Pulsador ACTIVACION Activar manualmente el sistema.
MANUAL.
6 Interruptor PRUEBA. Posición LAMPARAS: Comprueba el estado de
las lámparas de la caja de control.
Posición SISTEMA: comprueba los circuitos de:
 La caja de control.
 Detección.
 Alimentación.

8.1.c. Interruptor exterior de emergencia (Fig. 9.3)

Está situado en la parte exterior del costado izquierdo del vehículo (ver Fig. 9.1 nº 6).
Está conectado a la caja de control y tiene por misión el poder activar manualmente
el sistema desde el exterior del vehículo en un caso de emergencia, actuando sobre
su pulsador (2).
Dicho pulsador se encuentra protegido por una membrana transparente y por una
tapa de acero de blindaje (1) que se abre hacia la izquierda, una vez retirado su
pasador de seguridad (3).

)LJXUD,QWHUUXSWRUH[WHULRUGHHPHUJHQFLD

8.1.d. Zumbador alarma de fuego (Figura 9.4)

Está situado en la parte trasera de la cámara de conducción y tiene la función de


alertar sobre un incendio en la cámara del motor mediante un zumbador (1) y una
lámpara (2)

1-81
)LJXUD=XPEDGRUDODUPDIXHJR

8.1.e. Funcionamiento general

El funcionamiento general del sistema se activa automáticamente, aunque puede


activarse manualmente desde la caja de control en la cámara de conducción o
desde el exterior mediante el interruptor de emergencia. La activación del sistema
provoca la descarga del cilindro extintor a través de los difusores de dispersión de la
cámara del motor.

9. RESUMEN.

a. Sistema automático contraincendios de la cámara GMP, posee la capacidad de


detectar calentamientos anormales e incendios y de extinguir estos en la cámara
GMP.

b. El elemento activo de la detección contraincendios es el cable sensor de


temperatura.

c. El Sistema de extinción está compuesto por:


x Cilindro de extinción de 3,5 Kg. de capacidad.
x Conductos de dispersión.
x Boquillas difusoras.

d. El sistema de control está compuesto por:


x Una caja de control con capacidades de verificación, prueba del sistema y un
pulsador interior de activación manual.
x Un interruptor exterior de emergencia.
x Un zumbador de alarma de fuego.

1-82
FICHA DE TEORÍA

1. CÓDIGO: 612-400-010.

2. DESCRIPCIÓN: SISTEMA ANTI EXPLOSIÓN.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones, VCI /C Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. SISTEMA ANTI EXPLOSIÓN DE LA CÁMARA DE PERSONAL.

La extinción del fuego y supresión de explosiones provocadas por vapores de


hidrocarburos, cualquiera que sea su origen, en un tiempo mínimo.

8.1.a Descripción y elementos principales (Fig. 10.1)

Se trata de un sistema automático cuya rapidez del proceso de extinción/supresión,


limita los daños producidos a la tripulación evitando las quemaduras de segundo
grado en la piel y minimizando la sobrepresión producida por las explosiones y
humos tóxicos.
El sistema opera en todas las condiciones ambientales y de empleo del vehículo. Se
compone de los elementos siguientes:
 Subsistema de detección: basado en el empleo de 3 detectores ópticos (4)
con capacidad de detección UV/IR (Ultravioleta/Infrarrojo).
 Subsistema de extinción: constituido por 4 cilindros de extinción (1) con 3,5 kg
de HALÓN 1301 como agente extintor.
 Subsistema de lógica y control, constituido por:
 Una caja de control (2), que contiene la lógica del sistema y con capacidades
de verificación y prueba del sistema.
 Un interruptor de emergencia (3) situado en la parte interior trasera del
vehículo, junto al puesto del JECP.

1-83
)LJXUD6LVWHPDDQWLH[SORVLyQGHODFiPDUDGHSHUVRQDO

1. Cilindros extintores 3. Interruptor de emergencia


2. Caja de control 4. Detectores ópticos

8.1.a.(1). CAJA DE CONTROL (Fig. 10.2)

)LJXUD&DMDGHFRQWURO

Nº DENOMINACIÓN FUNCIÓN
1 Fusibles. Proteger los detectores ópticos.
2 Testigos CILINDROS Indicar al iluminarse (“ámbar”) que la presión de
algún cilindro es baja o que está descargado.
3 Testigo AVERIA EN Indica si hay fallos en los detectores o en su
DETECCION. circuito.
4 Testigo POTENCIA. Indicar cuando está encendido (“verde”) que existe
suministro de energía al sistema.
5 Interruptor Seleccionar las posiciones de funcionamiento del
NORMAL/COMBATE  NORMAL: El sistema funciona si se
produce una detección en un mínimo de
dos detectores.
 COMBATE: El sistema funciona si se
1-84
produce una detección en un detector como
mínimo.
6 Interruptor Comprobar los circuitos de:
PRUEBA SISTEMA.  La caja de control.
 Los cilindros extintores.
7 Interruptor Comprobar el estado de todas las lámparas de la
PRUEBA LAMPARAS. caja de control.

8.1.a.(2). DETECTORES ÓPTICOS Y CILINDROS DE EXTINCIÓN (Figs. 10.3 y 10.4)

Figura 10.3. Detector óptico Figura 10.4: Cilindro de extinción

1: Sensor de rayos ultravioleta (UV) 1: Cuerpo del cilindro extintor


2: Sensor de rayos infrarrojos (IR) 2: Conector
3: LED testigo de detección 3: Boca de descarga
4: Conector 4: Deflector

8.1.a.(3). INTERRUPTOR DE EMERGENCIA.

1-85
Está situado en el interior del vehículo en su
parte posterior (Fig. 10.1 nº 3) junto al
portón trasero y está conectado a la caja de
control por un cable, a través de un
conector (Figura 10.5. nº 2).
Tiene por misión el poder activar el sistema
de modo manual si, por cualquier causa
extraña, fallara la activación automática.
Dicha activación se lleva a cabo
presionando el pulsador (Figura 10.5. nº 1)
que se encuentra protegido por una
membrana transparente de seguridad.

8.1.b. Funcionamiento general:



)LJXUD,QWHUUXSWRUGHHPHUJHQFLD
8.1.b.(1). SUBSITEMA DE DETECCIÓN.

Los 3 detectores ópticos están dispuestos adecuadamente en la cámara de


personal, de modo que todos sus puntos queden cubiertos por el campo de
detección de al menos dos detectores.
El detector óptico es un dispositivo electrónico, de funcionamiento estático,
alimentado eléctricamente, que al detectar la presencia de llamas, transmite
rápidamente una señal a la caja de control a la que está conectado por un cable que
se conecta a su conector (Fig. 10.3. nº 4).
El detector produce una señal sólo cuando la intensidad de la radiación supera unos
valores preestablecidos, en ambas bandas UV e IR.
La emisión simultánea de una señal en estas dos bandas de frecuencia, es una
característica propia de la combustión de hidrocarburos.
El proceso de detección es extremadamente rápido y se produce en milésimas de
segundo.
El detector incluye un diodo de luz roja (LED) que luce para indicar a la tripulación, la
producción de una detección, al mismo tiempo que envía una señal a la caja de
control.

8.1.b.(2). SUBSITEMA DE EXTINCIÓN.

Está formado por 4 cilindros de extinción dispuestos adecuadamente en la cámara


de personal, donde descargan directamente.
Los cilindros extintores tienen por función almacenar el agente extintor HALON 1301
presurizado con nitrógeno seco para aumentar la eficacia de su descarga a bajas
temperaturas. Su funcionamiento es idéntico al del sistema contraincendios de la
cámara GMP. El cilindro (Fig. 10.4) se conecta a la caja de control a través de un
conector (2), por donde recibe la señal de activación correspondiente.
El agente extintor se distribuye por la cámara de personal directamente desde el
cilindro a través de un deflector (4) situado en su boca de descarga (3) situada en la
parte inferior del mismo.
Posee un presostato y un interruptor accionado por el flujo de gases durante la
descarga del agente extintor. El presostato se activa si la presión cae por debajo de
un valor mínimo necesario para producir una descarga efectiva y el interruptor de
flujo indica si se ha producido efectivamente la descarga del agente extintor. Las
señales de ambos dispositivos son enviadas a la caja de control que verifica el
estado operativo de los cilindros. El proceso de descarga que va desde la recepción
1-86
de la señal de activado hasta la terminación de la dispersión del agente extintor,
dura menos de 200 milisegundos.

8.1.c. Prueba del sistema. (Fig. 10.6)

PRECAUCIÓN
Los cristales de los detectores ópticos deben limpiarse con un paño seco y
suave especial para cristal óptico. Si es necesario, humedecerlo con un
producto de limpieza especial para óptica y secar después con un paño seco.
No utilizar productos grasientos o corrosivos.

Siempre que se vaya a utilizar el vehículo deberá realizarse la revisión del sistema,
para ello:

1) Comprobar previamente que las lentes de los detectores están limpios.

)LJXUD&DMDGHFRQWUROGHOVLVWHPD$(

2) Con el INT. PRIN. BATERIAS desconectado, situar el selector de


funcionamiento de la caja de control (3) en NORMAL.
3) Verificar que el testigo POTENCIA (2) (en verde) está iluminado.
4) Comprobar que no está encendida ninguna otra lámpara en la caja de control.
En caso de que estuviera encendida alguna otra lámpara, significaría que
existe algún problema en el sistema antiexplosión y que el sistema no es
operativo; en este caso se debe suspender la comprobación.
5) Comprobar que el testigo rojo de todos los detectores está apagado. Si algún
testigo se ilumina, debe desconectarse inmediatamente el conector
correspondiente.
6) Presionar hacia arriba el interruptor PRUEBA – LAMPARAS (5): Todas las
lámparas testigo de la caja de control deben iluminarse de modo continuo. Si
algún testigo no se ilumina, debe sustituirse antes de continuar con la prueba.
7) Presionar hacia arriba el interruptor PRUEBA – SISTEMA (4) para comprobar
los circuitos de los 4 cilindros y de la caja de control: Las luces testigo (1)
CILINDROS 1, 2, 3, y 4 deben parpadear durante un segundo
aproximadamente. Manteniendo el interruptor en PRUEBA SISTEMA, la
prueba se efectúa automáticamente cada 5 s (aprox.). Si no se produce el
parpadeo el sistema está averiado.

1-87
8.1.d. Selector de funcionamiento de la caja de control.

Este interruptor (Fig. 10.6 nº 3) selecciona una de las dos modalidades de


funcionamiento de la caja de control, que son:
1) NORMAL:
 En esta posición, el sistema se activa solamente cuando recibe las
señales de detección de dos o más detectores. Las señales de detección
activan inmediatamente el cilindro extintor que el sistema considera más
adecuado
 Se selecciona esta posición siempre que el vehículo realice actividades
de instrucción (excepto tiro con cañón), marchas, maniobras, etc. donde
la probabilidad de explosión sea escasa.
2) COMBATE:
 En esta posición, el sistema se activa al recibir la señal de detección de
uno o más detectores.
 Esta posición se selecciona para condiciones de combate, con alta
probabilidad de que el vehículo pueda ser alcanzado por fuego enemigo.
 Se adopta igualmente siempre que se efectúe tiro de cañón, para
prevenir posibles accidentes.
 La señal de detección activará inmediatamente un cilindro extintor.

8.1.e. Funcionamiento automático.

Durante el funcionamiento del sistema, la caja de control verifica los datos


siguientes:
 Señales de detección de los detectores ópticos.
 Señales de activación del interruptor de emergencia.
 Modalidad de funcionamiento (NORMAL o COMBATE).
 Estado de los cilindros extintores.
Teniendo en cuenta los datos anteriores, la caja de control transmitirá la señal de
activación al cilindro extintor apropiado cuando la reciba del detector o detectores
(COMBATE o NORMAL) que han realizado la detección de la fuente de calor.
Durante la activación, el sistema discrimina el posible cilindro extintor no operativo y,
en su caso, activa el otro. Después de haber enviado la señal de activación, la caja
de control realiza una prueba automática para comprobar si el cilindro extintor al que
se ha enviado la señal ha sido activado. Si el cilindro extintor al que se ha enviado la
señal de activación no se ha activado, la caja de control transmitirá otra señal para la
activación de otro cilindro extintor.

8.1.f. Funcionamiento manual.

PRECAUCIÓN
El pulsador del interruptor de emergencia mantiene su capacidad de descarga
del sistema durante más de media hora después de haber desconectado la
alimentación de corriente del sistema.

1-88
ATENCIÓN
Activar manualmente el sistema, solamente por motivos de extinción
claramente definidos.

La activación manual del sistema se realiza mediante el interruptor de emergencia,


situado en el puesto del JECP (Fig. 10.7 nº 1) presionando su pulsador sin
necesidad de que el interruptor general de baterías esté activado.

)LJXUD,QWHUUXSWRUGHHPHUJHQFLDGHOVLVWHPDDQWLH[SORVLyQ

Después de haber enviado la señal de activación, la caja de control realiza una


prueba automática para comprobar si el cilindro extintor al que se ha enviado la
señal ha sido activado. Si el cilindro extintor al que se ha enviado la señal de
activación no se ha activado, la caja de control transmitirá otra señal para la
activación de otro cilindro extintor.

9. RESUMEN.

Se compone de los elementos siguientes:

x Subsistema de detección: basado en el empleo de 3 detectores ópticos (4) con


capacidad de detección UV/IR (Ultravioleta/Infrarrojo).
x Subsistema de extinción: constituido por 4 cilindros de extinción (1) con 3,5 kg
de HALÓN 1301 como agente extintor.
x Subsistema de lógica y control, constituido por:
x Una caja de control (2), que contiene la lógica del sistema y con capacidades de
verificación y prueba del sistema.
x Un interruptor de emergencia (3) situado en la parte interior trasera del vehículo,
junto al puesto del JECP.

1-89
1-90
FICHA DE TEORÍA

1. CÓDIGO: 612-400-011.

2. DESCRIPCIÓN: SISTEMA COMPACTO DE CONTROL AMBIENTAL (SCCA).

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Transparencias, diapositivas, VCI /C Pizarro, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. GENERALIDADES DEL SISTEMA COMPACTO DE CONTROL AMBIENTAL.

Es el encargado de suministrar aire limpio a la temperatura adecuada a las distintas


cámaras del vehículo, mediante la renovación, filtrado y adecuación de la
temperatura del aire del vehículo, integrando las funciones de ventilación,
calefacción, A/A y protección NBQ por medio de:
 Filtrado del aire tomado desde el exterior a través de:
 Filtros de paz
 Filtros de guerra para NBQ
 Distribución y recirculación del aire

8.1.a. Descripción y elementos principales. (Fig. 11.1)

1-91
)LJXUD6LVWHPDFRPSDFWRGHFRQWURODPELHQWDO6&&$

1. Condensador A/A (sobre radiador 6. Conjunto SCCA cámara limpia


de refrigeración del motor) 7. Toma de aire de la estufa
2. Caja de contactores 8. Salida a la canalización (tubos) de
3. Rejilla/filtro de recirculación de aire ventilación.
4. Válvula de sobrepresión (techo de la 9. Compresor A/A
torre) 10.Caja de conexiones del compresor
5. Caja de manómetros NBQ de A/A

8.1.b. Conjunto SCCA. (Figs. 11.2 y 11.3)

)LJXUD&RQMXQWR6&&$   ODGRL]TXLHUGR 

1-92
)LJXUD&RQMXQWR6&&$   ODGRGHUHFKR 

1. Conjunto evaporador del A/A. 6. Toma de aire del calefactor


2. Conjunto NBQ (filtros y turbina) 7. Rejilla/filtro de recirculación de aire
3. Cuenta horas de funcionamiento 8. Caja de manómetros del sistema
4. Calefactor NBQ
5. Salida de aire a la canalización 9. Salida gases escape estufa (al
(tubos de distribución) escape motor)

8.1.c. Funcionamiento general.

8.1.c.(1). VENTILACIÓN.

La ventilación la proporciona una turbina del SCCA y el sistema de canalización de


aire.
Del SCCA (Fig. 11.4. nº.1) parten los conductos de circulación del aire que reparte el
mismo por todos los orificios de ventilación. Por ellos saldrá aire a temperatura
ambiente, caliente o frío en función de que se activen o no el calefactor y el sistema
de aire acondicionado.
En la cámara de personal, cada tripulante cuenta con un difusor orientable (3). La
torre dispone de dos salidas constantes (8) situadas en el techo del casco,
diametralmente opuestas y a la altura aproximada de sus dos asientos. El conductor
dispone de dos salidas orientables, una situada en el lado izquierdo (6) encima del
panel de instrumentos y otra en la parte frontal (5).
También dispone de una salida (7) situada en la parte inferior de la torre, junto a la
caja de válvulas del sistema electrohidráulico, para proporcionar refrigeración a los
componentes principales del sistema eléctrico de la torre. Esta salida dispone de una
llave (4) con dos posiciones ABRIR/CERRAR con el fin de poder proceder a su
cierre cuando circule aire caliente por el circuito.

1-93
)LJXUD'LVWULEXFLyQGHODLUH

El sistema se controla desde el panel de instrumentos del conductor (Ficha 612-400-


022 de este manual).

8.1.c.(2). CALEFACCIÓN.

La calefacción la proporciona un calefactor de gasóleo alimentado por el sistema de


combustible. El calefactor se controla desde el panel de instrumentos del conductor
(Ficha 612-400-022 de este manual). El sistema de ventilación se encarga de la
distribución del aire caliente.

8.1.c.(3). AIRE ACONDICIONADO

El aire acondicionado lo proporciona:


 Un compresor movido por el motor (Fig. 11.1 nº 9)
 Un condensador situado en la rejilla de entrada de aire de refrigeración y
encima del radiador (Fig. 11.1 nº 1)
 Un evaporador en el propio SCCA (Fig. 11.1 nº 1)
La distribución del aire frío se realiza por las conducciones y difusores del sistema
de ventilación.
Se controla desde el panel de instrumentos del conductor (Ficha 612-400-022 de
este manual).

8.1.c.(4). SISTEMA DE PROTECCIÓN NBQ

El sistema de protección NBQ proporciona una protección eficaz a la tripulación del


vehículo y al ECP sin necesidad de llevar el equipo de protección individual
mediante:

1-94
 La creación de una sobrepresión en la cámara de personal que impide la
penetración al interior del vehículo de aerosoles, gases o vapores cuando se
encuentra en zonas contaminadas.
 El filtrado del aire exterior eliminando agentes biológicos, químicos y
partículas radioactivas.
El sistema, aspira el aire del exterior mediante una turbina (Fig. 11.6 nº 5) a través
de la toma situada sobre la puerta de filtros (Fig. 11.5 nº 2), y lo hace pasar a través
de un prefiltro ciclónico y un filtro ubicado en un alojamiento cilíndrico (Fig. 11.6 nº
4), expulsando el polvo y partículas gruesas al exterior por la salida existente en la
tapa de filtros (Fig. 11.5 nº 1) y el aire limpio por la salida de la turbina (Fig. 11.6 nº
6).Éste caudal de aire filtrado penetra en la cámara de personal a través de la rejilla
de comunicación con la cámara de personal (Fig. 11.1 nº 3), hasta una sobrepresión
de 7 mbar.

 
)LJXUD6LVWHPD1%4   )LJXUD6LVWHPD1%4  

El control de presiones se efectúa mediante el sensor ubicado en la puerta de


acceso (Fig. 11.5 nº 3), el manómetro de sobrepresión (Fig. 11.7 nº 1) de la caja de
manómetros y la válvula de sobrepresión situada en el techo de la torre (Fig. 11.1 nº
4) que libera presión cuando esta excede del máximo indicado. Si el sistema supera
esa presión la válvula de sobrepresión existente en el techo de la torre liberará el
exceso manteniendo la presión en el máximo indicado.
Además del manómetro de sobrepresión de vehículo, se dispone de un manómetro
de presión del filtro (Fig. 11.7 nº 2), que nos indica el estado de colmatación del
mismo.

1-95
)LJXUD&DMDGHPDQyPHWURV

Las características técnicas de del sistema se describen en el Manual Técnico


correspondiente al vehículo.
El sistema se controla desde el panel de instrumentos del conductor (Ficha 612-400-
022 de este manual).

9. RESUMEN.

a. El SCCA aglutina el sistema de ventilación, el aire acondicionado, la calefacción y


el sistema NBQ. El sistema es el responsable de la renovación, filtrado y adecuación
de la temperatura del aire del vehículo.

b. Por los conductos de aireación sale aire a temperatura ambiente, si sólo se pone
en marcha el sistema de ventilación, aire caliente si se pone en marcha la
calefacción, o aire frío si se pone en marcha el aire acondicionado

c. En la cámara de personal, cada tripulante cuenta con un difusor orientable, que


puede situarse en la posición que más le agrade, girándolo en uno u otro sentido.

d. El puesto de conducción dispone de dos salidas orientables, una situada en el


lado izquierdo encima del panel de instrumentos y otra en la parte frontal junto al
tirador de parada de emergencia.

e. El sistema de ventilación lo pone en funcionamiento el conductor desde el panel


de instrumentos.

d. El sistema NBQ aspira el aire del exterior a través de la toma situada sobre la
puerta de filtros y lo hace pasar a través de un prefiltro ciclónico y un filtro cilíndrico,
saliendo el aire limpio a la cámara de personal y expulsando el polvo al exterior por
otro conducto.

e. El sistema se maneja desde el panel de instrumentos del conductor.


1-96
f. El manómetro diferencial del Sistema NBQ nos informa de la sobrepresión en el
interior del vehículo y del estado de colmatación del filtro, para proceder a su
sustitución.

1-97
1-98
FICHA DE TEORÍA

1. CÓDIGO: 612-400-012.

2. DESCRIPCIÓN: COMETIDOS DE LA TRIPULACIÓN.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Transparencias, vídeos y diapositivas y vehículo “Pizarro”, CD ayudas a la
Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento
de segundo escalón. Tomos I y II).

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. LA TRIPULACIÓN DEL VCI/C “PIZARRO”.

8.1.a. Composición.

La dotación de personal del VCI/C. “Pizarro” está formada por: la tripulación (Jefe de
Vehículo, Tirador y Conductor) y el Elemento de Combate a Pie (ECP) integrado por
un máximo de siete componentes. El Jefe de Vehículo y el Tirador se alojan en la
cámara de combate, y el conductor junto con el ECP se alojan en la cámara de
personal.

8.1.b. Cometidos.

DE LA TRIPULACIÓN.

La tripulación debe emplear eficazmente el vehículo en el combate, desembarcando


del mismo, si es preciso, para el cumplimiento de la misión recibida. Para ello es
imprescindible realizar un trabajo conjunto que permita:

x Mantener el vehículo en disposición de ser empleado en todo


momento.
x Manejar adecuadamente el vehículo en el combate, obteniendo el
máximo provecho de sus posibilidades tácticas y técnicas.
x Realizar fuegos potentes rápidos y precisos.
x Desembarcar lo más rápidamente posible en el lugar y momento
oportuno.
x Mantener en la medida de lo posible la cooperación del vehículo con
unidad desembarcada.

1-99
Todo ello, observando en todo momento las correspondientes medidas de
seguridad, tanto las generales de los vehículos de combate, como las particulares
del VCI/C “Pizarro” y de sus sistemas.

DEL JEFE DE VEHÍCULO.

x Conocer perfectamente las características técnicas y posibilidades del


vehículo, y saber en todo momento el estado de sus elementos para poder
obtener su máximo rendimiento.
x Conocer en todo momento su misión y la de la unidad superior a la que
pertenece.
x Indicar la dirección general de marcha.
x Observar el fuego y movimiento de los vehículos.
x Ser el operador de la radio.
x Observar, localizar, seleccionar y designar los objetivos al tirador, así
como las armas y munición a emplear para batirlos.
x Realizar el tiro si con ello se favorece el cumplimiento de la misión.
x Redactar los partes que procedan.
x Ser responsable del grado de instrucción de su tripulación, del
mantenimiento del vehículo y del enlace, y, en general, del empleo del
vehículo en el combate.

DEL TIRADOR.

x Conocer el funcionamiento y manejo de los órganos y elementos de la


cámara de combate, en especial de aquellos que constituyen el puesto de
tirador.
x Conocer el funcionamiento y manejo de las transmisiones y del
armamento del VCI/C “Pizarro”.
x Colaborar en el mantenimiento de los órganos anteriores y en las
tareas de entretenimiento general del vehículo.
x Adquirir objetivos y hacer fuego sobre los mismos, con arreglo a las
órdenes recibidas del jefe de vehículo.
x Colaborar en la observación y corrección del tiro.

DEL CONDUCTOR.

x Conocer el funcionamiento y manejo de los órganos del motor,


transmisión, cámara de conducción, tren de rodaje y suspensión, así como
todo lo relacionado con el panel de instrumentos.
x Mantener los órganos anteriores y colaborar en las tareas de
entretenimiento general del vehículo.
x Conducir el vehículo, atendiendo a las indicaciones del JV., por el
itinerario más conveniente en función de las posibilidades técnicas,
exigencias tácticas y características del terreno, adaptándolas en todo
momento a las condiciones atmosféricas, intentando en todo momento
mantener las mejores condiciones posibles para el tiro y las condiciones de
supervivencia de la unidad transportada.
x Colaborar con el resto de la tripulación en la observación, localización e
identificación de posibles objetivos.

1-100
8.2. SUSTITUCIONES.

Cada tripulante no sólo debe conocer las posibilidades y funcionamiento de los


sistemas correspondientes a su puesto táctico, sino que debe tener además un
conocimiento práctico de los sistemas que pudiera manejar en el caso de tener que
suplir una baja de algún miembro de la tripulación.

9. RESUMEN.

1-101
1-102
FICHA DE TEORÍA

1. CÓDIGO: 612-400-013.

2. DESCRIPCIÓN: NORMAS DE SEGURIDAD.

3. IDENTIFICACIÓN.
NIVEL II: Colectiva. Común.

4. LUGAR. 5. DURACIÓN.
Aula y Vehículo. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Presentaciones vehículo “Pizarro”, CD ayudas a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la tripulación.
MT6-022. Manual Técnico. Vehículo de combate de línea Pizarro. (Mantenimiento de
segundo escalón. Tomos I y II).

8. DESARROLLO DEL CONTENIDO.

8.1. NORMAS GENERALES DE SEGURIDAD.

El vehículo, por sus dimensiones, peso, potencia y escasa visibilidad, ha de ser


utilizado con precaución para evitar posibles accidentes. La familiaridad y la rutina
en el trato con el material pueden hacer que el personal se confíe y se descuide el
cumplimiento de las normas de seguridad. Estas tienen por objeto reducir al mínimo
los daños que puedan sufrir el personal, el vehículo y las instalaciones, así como la
población civil y sus propiedades. A continuación se relacionan aquellas de carácter
más general.

8.1.a. Relativas al personal.

x Evitar la caída de objetos de los bolsillos. Tener cuidado con anillos, relojes,
cadenas y en general con llevar objetos que se puedan enganchar.
x Subir por la parte delantera del vehículo para ser vistos por el conductor.
x No agarrarse a cables, faros o elementos que puedan deteriorarse.
x Tener precaución con los resbalones especialmente cuando el vehículo esté
mojado.
x Manejar con precaución las escotillas, rejillas, tapas registro y portones.
Asegurar siempre las escotillas y portones. (toda escotilla que se abre, en ese
momento queda asegurada).
x Durante la ejecución de tareas de mantenimiento, emplear las herramientas
adecuadas y guantes de protección.
x El Conductor deberá avisar al resto de personal antes de arrancar el motor y
cuando vaya a poner el vehículo en movimiento. Una vez arrancado no
deberá abandonar su puesto.
x Asegurarse de que no hay personal sobre el vehículo ni en sus alrededores
antes de girar la torre, comprobando que están todas las escotillas y portones

1-103
cerrados, así como la cesta de la torre. En aparcamientos, girar la torre
siempre utilizando el sistema manual.
x Al repostar el vehículo cuidar que el interruptor general (INT. PRIN.
BATERÍAS) esté desconectado.
x Como norma general no tocar ningún cable que se encuentre dañado, se
deberá notificar inmediatamente al 2º escalón.
x El uso de munición HEI está prohibido con tormentas de granizo o lluvias
fuertes debido al peligro que existe de que se produzca una explosión
prematura.
x No arrancar el motor ni poner en marcha la estufa de personal en lugares
poco ventilados.
x En acuartelamientos, operaciones de embarque o siempre que la situación lo
requiera, el vehículo llevará un guía pie a tierra para dirigir al conductor. Este
dejará, con el vehículo, un espacio de seguridad mínimo de 10 metros,
siempre se colocará de forma que no esté en la trayectoria del vehículo y
nunca lo guiará caminando de espaldas.
x Durante la marcha del vehículo el personal que esté en el interior ocupará su
puesto y llevara su casco puesto.
x El rayo láser es peligroso y puede causar ceguera si se apunta directamente
al ojo humano o si se refleja sobre él en una superficie pulida.
x Tan solo se utilizara el láser en los campos para ellos dispuesto y se
adoptarán las medidas necesarias para no dañar al personal.
x En el caso de que personal no autorizado aparezca en el campo de seguridad
del láser, se interrumpirá inmediatamente el funcionamiento de éste.
x Antes de desconectar el cable del periscopio de conducción nocturna, deberá
estar previamente apagado durante, al menos, 1 minuto.
x Ante la caída de rayos no permitir que haya personal sobre o en las
proximidades del vehículo, la tripulación permanecerá dentro del vehículo.
x No intentar salir o entrar del puesto de conducción hasta que el Jefe de
vehículo no haya puesto el servo en OFF. El personal corre grave peligro si
no está en sus puestos cuando gire la torre.
x Nadie deberá ponerse delante de los tubos lanzaingenios durante la carga y
descarga de los mismos.
x Cables de alta tensión. Existe peligro de muerte al entrar en contacto con
ellos, en este caso se deberán tomar las siguientes precauciones:
o No debe abandonarse el vehículo.
o Si es posible mover el vehículo y sacarlo de la zona de peligro.
o Si el vehículo esta inmovilizado y hay que abandonar el mismo, saltar lo
más lejos posible y caer con los dos pies juntos.

8.1.b. Normas relativas al equipo y armamento.

x No dejar herramientas u otros objetos sobre el vehículo. Hacer recuento de la


herramienta al acabar las tareas de mantenimiento.
x El conductor debe observar continuamente la posición relativa de la torre con
respecto a la barcaza para evitar de accidentes con la torre.
x El conductor deberá tocar el claxon inmediatamente antes de arrancar el
vehículo y previamente a realizar cualquier movimiento hacia delante o hacia
atrás.
x No abrir los bidones de carburante golpeándolos con objetos metálicos para
evitar deformaciones de los tapones.
1-104
x Siempre que se vayan a utilizar componentes electrónicos es conveniente
tener arrancado el motor para que no se descarguen las baterías en especial
la torre en eléctrico.
x Procurar que las antenas no choquen con ramas o cables, no cruzar las
antenas al abatirlas.
x No manipular aquellos elementos que no se conozcan perfectamente (armas,
elementos de visión nocturna, láser, etc.).
x Antes de arrancar y parar el motor se deben apagar los equipos del vehículo,
en especial la radio y la Dirección de Tiro.
x Manejar con precaución el telémetro láser, usándolo en zonas despejadas y
con autorización. En ningún caso se debe disparar contra seres vivos. Usar
siempre el filtro de protección.
x Antes de la colocación de un filtro de amortiguación se deberá comprobar que
se encuentra en buenas condiciones y no presenta deformaciones.
x Antes de utilizar el láser comprobar que todos los visores ópticos han sido
equipados con su filtro de seguridad.
x Antes de utilizar el láser comprobar que el escudo balístico del Tirador está
abierto.
x Una vez que el vehículo está municionado no pasar jamás por delante de las
armas ni de los tubos lanzaartificios.

8.1.c. Normas relativas a la detección y extinción de incendios.

El fuego es por lo general uno de los mayores peligros que pueden amenazar al
vehículo. Se deben tener en cuenta las siguientes normas:

x Un vehículo sin su sistema de extinción de incendios en perfectas condiciones


no debe ponerse en marcha. Se comprobarán con frecuencia sus pesos,
precintos y fechas de revisión. Los extintores portátiles se comprueban
pesándolos cada seis meses.
x No se debe fumar dentro del vehículo ni en sus inmediaciones.
x Para el repostaje del vehículo parar el motor y desconectar el interruptor de
baterías, así como las luces del vehículo. Tener siempre preparado un extintor
portátil.
x Mantener el contacto entre la boquilla de la manguera y la boca de llenado del
depósito haciendo masa entre ambos para evitar chispas debidas a la
electricidad estática.
x En ejercicios o maniobras se observarán en todo momento las normas dadas
por sus mandos correspondientes, sobre el tiro en el periodo estival y cuantas
medidas sobre el fuego tenga que cumplimentar. Nunca abandonará un fuego
sin orden expresa de sus superiores.
x En caso de incendio, mantener siempre la calma e intentar, en la medida de lo
posible sacar la munición lo antes posible.

8.1.d. Normas de seguridad en relación con el monóxido de carbono.

Durante el tiro se acumulan en la cámara de armas una gran cantidad de gases,


entre ellos monóxido de carbono e hidrógeno en concentraciones peligrosas, que
podrían dar lugar a intoxicaciones o deflagraciones por lo que se debe comprobar la
hermeticidad de los mamparos de separación entre la cámara de armas y la de
combate, y mantenerlos cerrados durante el tiro.
1-105
- Para dejar tiempo suficiente para ventilar la cámara de armas, si la situación táctica
lo permite, evitar las ráfagas largas consecutivas.
- En caso de necesitar realizar tiro manual, se evitará efectuar ráfagas largas o muy
seguidas y manteniendo el vehículo todo lo ventilado posible, especialmente la
cámara de combate”

El monóxido de carbono (CO) es un gas incoloro e inodoro, mortalmente venenoso,


que al ser respirado, priva al cuerpo de oxígeno y produce asfixia. La exposición al
aire contaminado por CO produce síntomas tales como: dolor de cabeza, mareo,
pérdida del dominio de los músculos, aparente somnolencia y coma. Una exposición
prolongada puede producir daños permanentes en el cerebro o incluso la muerte.

Este gas se encuentra en los humos de escape de los motores de combustión


interna y en las estufas que emplean gasóleo, llegando a ser peligroso cuando las
condiciones de ventilación son inadecuadas. Por este motivo, siempre que se ponga
en funcionamiento el motor o la calefacción del vehículo, deben observarse las
siguientes normas:

x No poner en marcha el motor del vehículo en un recinto cerrado que no tenga


la adecuada ventilación.
x No mantener el motor en funcionamiento durante prolongados periodos de
tiempo sin activar el ventilador de la torre y el aire acondicionado. Si la
situación táctica lo permite abrir las escotillas.
x Durante el funcionamiento del vehículo se debe prestar atención a la posible
aparición de olores de escape y síntomas de exposición al monóxido de
carbono, si esto ocurre ventilar inmediatamente las cámaras de personal y de
combate, y, si los síntomas persisten, evacuar al personal del vehículo,
exponerlos al aire libre y mantenerlos abrigados, impidiendo que realicen
ejercicios físicos y si fuera necesario, aplicarles la respiración artificial.
x Las máscaras de gas no protegen del envenenamiento por monóxido de
carbono. La mejor defensa contra ello es una ventilación adecuada.

8.2. EL SISTEMA DE EXTINCIÓN DE INCENDIOS DEL VCI/C PIZARRO.

El VCI/C “Pizarro”, cuenta con un sistema de extinción de incendios compuesto por


un dispositivo fijo y dos extintores portátiles.

8.2.a. Dispositivo fijo.

Está formado por un sistema de detección automático de fuego y una botella de gas
“HALON 1301” súper presurizado con nitrógeno seco:

Sistema automático. Al ser detectado el fuego por un cable sensor de temperatura


colocado en la cámara del motor se dispara automáticamente la botella de HALON.

Sistema manual. Si el conductor detectara fuego y por lo que fuera no se hubiese


producido la descarga, la caja de control del sistema contraincendios tiene un
pulsador para su activación manual, el cual está al alcance del Conductor. También
existe un disparador manual en el costado exterior del vehículo (al lado del
conductor) por si el fuego se produjera cuando el vehículo esté aparcado y sin nadie
en el interior.
1-106
8.2.b. Extintores portátiles.

El vehículo dispone de dos extintores portátiles situados, uno (de 6 kg) en el suelo,
junto al primer asiento derecho y el otro (de 2 kg) en un soporte vertical junto al
portón trasero. En el caso de tener que utilizar un extintor portátil se seguirán los
siguientes pasos:

x Coger el extintor, romper el precinto y sacar el pasador.


x Poner la boquilla dispersora horizontal.
x Situar el extintor a metro y medio del fuego y dirigir la boquilla dispersora a la
base del fuego.
x Oprimir y mantener el disparador para dirigir un chorro de agente extintor al
fuego evitando el contacto del cuerpo con el agente extintor ya que puede
irritar los ojos y la garganta.
x Señalizar el extintor con la palabra VACÍO.
x Dar parte al Jefe del Vehículo de la utilización del mismo.
x Cambiar el extintor vacío por uno lleno en cuanto sea posible.

8.3. EL SISTEMA ANTI EXPLOSIÓN DEL VCI/C PIZARRO.

PARA EVITAR POSIBLES DAÑOS A LA TRIPULACIÓN DEBEN CUMPLIRSE


LAS SIGUIENTES NORMAS:

NO FUMAR NI ENCENDER FUEGO (MECHEROS, CERILLAS, ETC.) EN LA


CÁMARA DE PERSONAL.

COMPROBAR LA CORRECTA SUJECIÓN DE LOS CILINDROS EXTINTORES.

El sistema dispone, de modo automático, de la capacidad necesaria para la extinción


del fuego y supresión de explosiones provocadas por vapores de hidrocarburos,
cualquiera que sea su origen en un tiempo mínimo.

8.3.a. Sistema automático.

Al ser detectada la explosión por uno de los tres detectores, inmediatamente manda
el sistema que se descargue la más próxima de las botellas al lugar de la detección.

8.3.b. Sistema manual.

Si algún tripulante detectara la situación podría descargar las botellas apretando el


interruptor de emergencia del dispositivo y como es HALON lo descargado, puede
efectuar también labores de extinción de incendios (Este interruptor se encuentra en
la parte interior trasera del vehículo, junto al puesto del jefe unidad transportada).

9. RESUMEN.

a. Normas de seguridad personal:

1-107
x Tener cuidado con anillos, relojes, cadenas y en general con los objetos que
se puedan enganchar.
x Subir por la parte delantera del vehículo para ser vistos por el conductor.
x No agarrarse a cables, faros o elementos que puedan deteriorarse.
x Tener precaución con los resbalones especialmente cuando el vehículo esté
mojado.
x Asegurar siempre las escotillas y portones.
x El Conductor deberá avisar al resto de personal antes de arrancar el motor y
cuando vaya a poner el vehículo en movimiento. Una vez arrancado no
deberá abandonar su puesto.
x Asegurarse de que no hay personal sobre el vehículo ni en sus alrededores
antes de girar la torre, comprobando que están todas las escotillas y portones
cerrados, así como la cesta de la torre.
x Al repostar el vehículo cuidar que el interruptor general (INT. PRIN.
BATERÍAS) esté desconectado.
x No arrancar el motor ni poner en marcha la estufa de personal en lugares
poco ventilados.
x En acuartelamientos, operaciones de embarque o siempre que la situación lo
requiera, el vehículo llevará un guía pie a tierra para dirigir al conductor. Este
dejará, con el vehículo, un espacio de seguridad mínimo de 10 metros,
siempre se colocará de forma que no esté en la trayectoria del vehículo y
nunca lo guiará caminando de espaldas.
x Durante la marcha del vehículo el personal que esté en el interior ocupará su
puesto y llevara su casco puesto.
x El rayo láser es peligroso y puede causar ceguera si se apunta directamente
al ojo humano o si se refleja sobre él en una superficie pulida.
x Antes de desconectar el cable del periscopio de conducción nocturna, deberá
estar previamente apagado durante, al menos, 1 minuto.
x Ante la caída de rayos no permitir que haya personal sobre o en las
proximidades del vehículo, la tripulación permanecerá dentro del vehículo.
x No intentar salir o entrar del puesto de conducción hasta que el Jefe de
vehículo no haya puesto el servo en OFF.
x Nadie deberá ponerse delante de los tubos lanzaartificios durante la carga y
descarga de los mismos.
x Existe peligro de muerte al entrar en contacto con cables de alta tensión, en
este caso se deberán tomar las siguientes precauciones:

b. Normas de seguridad con respecto al equipo y armamento:


x No dejar herramientas u otros objetos sobre el vehículo. Hacer recuento de la
herramienta al acabar las tareas de mantenimiento.
x El Conductor debe observar continuamente la posición relativa de la torre con
respecto a la barcaza para evitar de accidentes con la torre.
x El Conductor deberá tocar el claxon inmediatamente antes de arrancar el
vehículo y previamente a realizar cualquier movimiento hacia delante o hacia
atrás.
x No abrir los bidones de carburante golpeándolos con objetos metálicos para
evitar deformaciones de los tapones.
x Siempre que se vayan a utilizar componentes electrónicos es conveniente
tener arrancado el motor para que no se descarguen las baterías en especial
la torre en eléctrico.

1-108
x No manipular aquellos elementos que no se conozcan perfectamente (armas,
elementos de visión nocturna, láser, etc.).
x Antes de arrancar y parar el motor se deben apagar los equipos del vehículo,
en especial la radio y la Dirección de Tiro.
x Manejar con precaución el telémetro láser, usándolo en zonas despejadas y
con autorización. En ningún caso se debe disparar contra seres vivos. Usar
siempre el filtro de protección.
x Antes de la colocación de un filtro de amortiguación se deberá comprobar que
se encuentra en buenas condiciones y no presenta deformaciones.
x Antes de utilizar el láser comprobar que todos los visores ópticos han sido
equipados con su filtro de seguridad.
x Antes de utilizar el láser comprobar que el escudo balístico del Tirador está
abierto.
x Una vez que el vehículo está municionado no pasar jamás por delante de las
armas ni de los tubos lanzaartificios.
x
c. Normas de seguridad contraincendios:
x Un vehículo sin su sistema de extinción de incendios en perfectas condiciones
no debe ponerse en marcha.
x No se debe fumar dentro del vehículo ni en sus inmediaciones.
x Para el repostaje del vehículo parar el motor y desconectar el interruptor de
baterías, así como las luces del vehículo. Tener siempre preparado un extintor
portátil.
x Mantener el contacto entre la boquilla de la manguera y la boca de llenado del
depósito haciendo masa entre ambos para evitar chispas debidas a la
electricidad estática.
x En ejercicios o maniobras se observarán en todo momento las normas dadas
por sus mandos correspondientes, sobre el tiro en el periodo estival y cuantas
medidas sobre el fuego tenga que cumplimentar. Nunca abandonará un fuego
sin orden expresa de sus superiores.

d. El monóxido de carbono (CO) es un gas incoloro e inodoro, mortalmente


venenoso, que al ser respirado, priva al cuerpo de oxígeno y produce asfixia. La
exposición al aire contaminado por CO produce síntomas tales como: dolor de
cabeza, mareo, pérdida del dominio de los músculos, aparente somnolencia y coma.
Una exposición prolongada puede producir daños permanentes en el cerebro o
incluso la muerte.

x No poner en marcha el motor del vehículo en un recinto cerrado que no tenga


la adecuada ventilación.
x No mantener el motor en funcionamiento durante prolongados periodos de
tiempo sin activar el ventilador de la torre y el aire acondicionado. Si la
situación táctica lo permite abrir las escotillas.
x Durante el funcionamiento del vehículo se debe prestar atención a la posible
aparición de olores de escape y síntomas de exposición al monóxido de
carbono, si esto ocurre ventilar inmediatamente las cámaras de personal y de
combate, y, si los síntomas persisten, evacuar al personal del vehículo,
exponerlos al aire libre y mantenerlos abrigados, impidiendo que realicen
ejercicios físicos y si fuera necesario, aplicarles la respiración artificial.
x Las máscaras de gas no protegen del envenenamiento por monóxido de
carbono. La mejor defensa contra ello es una ventilación adecuada.
1-109
),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1(6758&785$<'(6&5,3&,Ï1'(/$7255(

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
 3UiFWLFDPLQXWRV
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&SRUFDGD7ULSPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/D SDUWH WHyULFD VH UHDOL]DUi HQ HO DXOD FRQ WRGRV ORV WULSXODQWHV UHXQLGRV \  FRQ OD
D\XGDGHOSUR\HFWRUSDUDUHDOL]DUODVGHVFULSFLRQHV
3DUDODSDUWHSUiFWLFDVHFRORFDUiXQYHKtFXORHQHOSDWLRRKDQJDU(OWULSXODQWHVH
VLWXDUi HQ ORV SXHVWRV GH OD WRUUH \ HO LQVWUXFWRU OH LUi GHVFULELHQGR HO LQWHULRU GH OD
WRUUH


5(48,6,726$$/&$1=$5

(O WULSXODQWH GHEH VHU FDSD] GH UHFRQRFHU ORFDOL]DU \ PDQLSXODU ORV HOHPHQWRV
GHVFULWRVHQHOLQWHULRUGHODWRUUH

6HFRQVLGHUDUDTXHHOHYDOXDGRKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

/D WRUUH HVWi PRQWDGD VREUH XQD FRURQD GHQWDGD VREUH OD TXH VH GHVSOD]D SDUD
HIHFWXDU HO JLUR ž  'LVSRQH GH XQ DQLOOR FROHFWRU SRU GRQGH VH WUDQVPLWH OD
FRUULHQWHHOpFWULFDGHOFDVFRDODWRUUH
7LHQHXQDFHVWDGHSURWHFFLyQSDUDHYLWDUDFFLGHQWHVFXDQGRODWRUUHHVWpJLUDQGR
(Q VX LQWHULRU VH HQFXHQWUD ORV HOHPHQWRV QHFHVDULRV SDUD OD REVHUYDFLyQ OD
UHDOL]DFLyQGHOIXHJRDVtFRPRODVWUDQVPLVLRQHVGHOPLVPRHVWDQGRGLYLGDHQGRV
FRPSDUWLPHQWRVXQRSDUDHOWLUDGRU\RWURSDUDHOMHIHGHYHKtFXOR




(6758&785$'(/$7255(

9HUILFKDGHHVWHPDQXDO

D %OLQGDMH

9HUILFKDGHHVWHPDQXDO

E 'LVWULEXFLyQLQWHUQD

E  (1(/3/$12+25,=217$/



)LJXUD(VWUXFWXUDGHODWRUUHHQHOSODQRKRUL]RQWDO

 &8(532'(/$7255($ORMDORVVLVWHPDVGHSXQWHUtDVHODUPDPHQWR\HO
VLVWHPDGHFRPXQLFDFLRQHV
 &(67$'(/$7255($ORMDHOVLVWHPDHOpFWULFRDVLHQWRV\RWURVHOHPHQWRV
DX[LOLDUHV

E  (1(/3/$129(57,&$/







)LJXUD(VWUXFWXUDGHODWRUUHHQHOSODQRYHUWLFDO

 &È0$5$'(&20%$7(&RQVWLWX\HODFiPDUDGHSHUVRQDOGHODWRUUHDORMD
DO -9 \ DO 7LUDGRU ORV HOHPHQWRV GH FRQWURO SXQWHUtD FRPXQLFDFLRQHV
FDUJDGRUHVGHPXQLFLyQGHFDxyQ\RWURVHOHPHQWRVDX[LOLDUHV
 &È0$5$ '( $50$6 $ORMD HQ VX SDUWH VXSHULRU ODV DUPDV \ VXV DIXVWHV
PHFDQLVPRV GH FRQWURO \ HOHPHQWRV DX[LOLDUHV (Q VX SDUWH LQIHULRU ORV
DORMDPLHQWRVGHOFDUJDGRUGHOD$0\HODOPDFpQGHUHFRJLGDGHYDLQDV

F 'HVFULSFLyQH[WHULRU

9HUILFKDGHHVWHPDQXDO

G $FFHVRVDODWRUUH

9HUILFKDGHHVWHPDQXDO

'(6&5,3&,Ï1,17(5,25

D&iPDUDGHDUPDV




)LJXUD&iPDUDGHDUPDV  3DUWHVXSHULRUGHUHFKD

127$$/$),*85$/DJXtDIOH[LEOHGHPXQLFLyQDSDUHFHFRUWDGDSDUDPD\RU
FODULGDG



 *XtDIOH[LEOHGHUHFKD LQLFLR   *LUyVFRSRGHGRVHMHV
 9DULOODMH GHO PDQGR PDQXDO GHO  ([WUDFWRUGHJDVHVGHUHFKR
GREOHDOLPHQWDGRU  &DMDGHGLVWULEXFLyQHOpFWULFDGH
 7ROYDGHH[SXOVLyQGHYDLQDV ODFiPDUDGHDUPDV
 *XtDIOH[LEOHGHUHFKD ILQ   9HQWDQDUHJLVWUR
 0RWRUGHOGREOHDOLPHQWDGRU




)LJXUD&iPDUDGHDUPDV  3DUWHVXSHULRUL]TXLHUGD

127$$/$),*85$/DJXtDIOH[LEOHGHPXQLFLyQDSDUHFHFRUWDGDSDUDPD\RU
FODULGDG


 *XtDIOH[LEOHL]TXLHUGD ILQ   9DULOODGHPDQGRGHODWULQFDGH
 7ROYDH[SXOVLyQGHYDLQDV HOHYDFLyQGHOFDxyQ
 9HQWDQDUHJLVWUR  ([WUDFWRUGHJDVHVL]TXLHUGR
 *XtDIOH[LEOHL]TXLHUGD LQLFLR   7ULQFDGHHOHYDFLyQGHOFDxyQ
 (MHGHPXxRQHV









)LJXUD&iPDUDGHDUPDV  3DUWHLQIHULRU


 &DUJDGRUGHODDPHWUDOODGRUD  6HUYR GH DFFLRQDPLHQWR GH
 $ORMDPLHQWR GHO FDUJDGRU GH OD HOHYDFLyQGHOFDxyQ
DPHWUDOODGRUD  (TXLOLEUDGRUPHFDQLVPRPDQXDO
 $OPDFpQGHYDLQDV\JUDSDV GHHOHYDFLyQGHOFDxyQ

E&iPDUDGHFRPEDWH

E  3$57($17(5,25





)LJXUD(OHPHQWRVVLWXDGRVHQODSDUWHDQWHULRUGHODFiPDUDGHFRPEDWH


 3HULVFRSLRGHREVHUYDFLyQGHO-9
 &RQWDGRUGHGLVSDURV
 3ODIyQGHOX]GHO-9
 &DMDGHFRQWUROGHODVEDWHUtDVODQ]DLQJHQLRV
 0DQGR GHO HVFXGR GH SURWHFFLyQ EDOtVWLFD SHULVFRSLR
-9
 $MXVWH GH DSR\DIUHQWH GHO SHULVFRSLR GH SXQWHUtD GHO
-9
 &DEH]DGHOSHULVFRSLRGHSXQWHUtDGHO-9
 3DQHOGH&RQWURO3ULQFLSDO
 3DQHOGHFRQWUROGHPRQLWRUHVGHYLVLyQWpUPLFD
&DEH]DGHOSHULVFRSLRGHSXQWHUtDGHO7LUDGRU
0RQLWRUGHYLVLyQWpUPLFDGHO7LUDGRU
0DQGR GHO HVFXGR GH SURWHFFLyQ EDOtVWLFD SHULVFRSLR
GHO7LUDGRU
3ODIyQGHOX]GHO7LUDGRU
3HULVFRSLRGHREVHUYDFLyQGHO7LUDGRU



9HQWDQDGHFDUJDGHOFDUJDGRUGHUHFKRGHOFDxyQ
9HQWDQDGHDFFHVRDODJXtDIOH[LEOHFDUJDGRUGHUHFKR

3DQHOGHFRQWUROGHO7LUDGRU
8QLGDGHOHFWUyQLFDGHFiPDUDWpUPLFD
0DQGRPHFiQLFRGHOFDxyQHQHOHYDFLyQ
0DQGRHPSXxDGXUDGHO7LUDGRU
8QLGDGGH&RQWURO3ULQFLSDOGHOD'7
9HQWDQDUHJLVWURDFFHVRDOFDxyQ 
3DQHOGHDFFHVRDODFXQDGHOFDxyQ 
9HQWDQDUHJLVWURDFFHVRDODDPHWUDOODGRUD 
0DQGRHPSXxDGXUDGHO-9
3DQHOGH&RQWUROGHDUPDVGHO-9
0RQLWRUGHYLVLyQWpUPLFDGHO-9
9HQWDQD GH DFFHVR D OD JXtD IOH[LEOH GHO FDUJDGRU
L]TXLHUGR 
7ULQFDGHEORTXHRHQHOHYDFLyQGHOFDxyQ
&DUJDGRUL]TXLHUGR

9HQWDQDV\SDQHOHVGHVPRQWDEOHV

E  3$57(3267(5,25




)LJXUD&iPDUDGHFRPEDWH9LVWDSRVWHULRU


 3DODQFDGHGHVEORTXHRGHOD  9HQWDQDGHFDUJDFDUJDGRU
HVFRWLOODGHO7LUDGRU L]TXLHUGR
 9iOYXODGHVREUHSUHVLyQGHO  57)³&´


6LVWHPD1%4  57)³'´
 6HUYRGHDFFLRQDPLHQWRGH  &DMDGHDOLPHQWDFLyQVXSUHVRUD
GLUHFFLyQ 0;GHOVLVWHPDGH
 &DMDGHFRQWUROPDHVWUR 0&6 GHO FRPXQLFDFLRQHV
VLVWHPDGHLQWHUIRQtD  0DQGRPDQXDOGHJLURGHODWRUUH
 3DODQFDGHGHVEORTXHRHVFRWLOOD  9HQWDQDGHLQVSHFFLyQ\D\XGDGH
GHO-9 FDUJDGHOFDUJDGRUGHUHFKR
 6HQVRUGHLQFOLQDFLyQ


(6&27,//$6

/D HVWUXFWXUD GH ODV HVFRWLOODV GH OD WRUUH UHVSRQGH D XQ GLVHxR VLPLODU D ODV
H[LVWHQWHV HQ HO FDVFR /DV FRUUHVSRQGLHQWHV D -9 \ 7LUDGRU QR VRQ LJXDOHV VLQR
VLPpWULFDV )LJV\ 
6XPRYLPLHQWRGHDSHUWXUD\FLHUUHVHYHIDFLOLWDGRSRUXQDEDUUDGHWRUVLyQODPLQDU
)LJQž HQXQRGHFX\RVH[WUHPRVOOHYDXQDVHULHGHPXHVFDV )LJQž
  FRUUHVSRQGLHQWHV D ODV GLVWLQWDV SRVLFLRQHV HQ ODV TXH SXHGH HQFODYDUVH OD
HVFRWLOOD GRQGH HQFDMD HO SHVWLOOR GH UHWHQLGD VREUH HO TXH DFW~D OD SDODQFD GH
UHWHQLGD )LJQž 
/D HVFRWLOOD VH DEUH QRUPDOPHQWH GHVGH HO LQWHULRU DXQTXH HQ FDVR GH QHFHVLGDG
SRGUtDDEULUVHGHVGHHOH[WHULRU



 

)LJXUD(VFRWLOOD 9LVWDH[WHULRU )LJXUD(VFRWLOOD 9LVWDLQWHULRU 


D$EULUODFRPSXHUWDGHODHVFRWLOODGHVGHHOLQWHULRU

7LUDUKDFLDDEDMRGHODSDODQFDGHUHWHQLGD )LJQž /DSXHUWDGHODHVFRWLOOD
WLHQGH D DEULUVH SRU DFFLyQ GH OD EDUUD GH WRUVLyQ \ VL VROWDPRV OD SDODQFD GH
UHWHQLGD TXHGDUi HQFODYDGD HQ OD VLJXLHQWH SRVLFLyQ TXH HV OD GH REVHUYDFLyQ
SURWHJLGD
+DEUiTXHYROYHUDDFWXDURWUDYH]VREUHODSDODQFDGHUHWHQLGDSDUDTXHDO]DIDUVX
SHVWLOOR SHUPLWD TXH OD SXHUWD GH OD HVFRWLOOD VLJD DEULpQGRVH KDVWD OD VLJXLHQWH
SRVLFLyQ

E&LHUUHGHODFRPSXHUWDGHODHVFRWLOODGHVGHHOLQWHULRU




7LUDUKDFLDDEDMRGHODSDODQFDGHUHWHQLGD )LJQž \ODSXHUWDGHODHVFRWLOOD
WHQGHUiDFHUUDUVHSRUDFFLyQGHODEDUUDGHWRUVLyQ )LJQž 


3(/,*52
38('(*2/3($5/$&$%(=$'(/75,38/$17(

&RPR HQ HO FDVR GH OD DSHUWXUD VL VROWDPRV OD SDODQFD GH EORTXHR OD SXHUWD LUi
HQFODYiQGRVHHQODVVXFHVLYDVSRVLFLRQHV
6LVHTXLHUHHOFLHUUHWRWDOVLQVROWDUODSDODQFDGHUHWHQLGDKDVWDHOILQDOD\XGDUDO
PRYLPLHQWR GH FLHUUH WLUDQGR GH DOJXQD GH ODV DVDV GH ORQD )LJ  Qž  
IXHUWHPHQWHHQVXSDUWHILQDOSDUDYHQFHUODDFFLyQGHODMXQWDGHJRPDKDVWDTXHOD
HVFRWLOODTXHGHHQFODYDGDHQVXSRVLFLyQGHFHUUDGD

F$EULUODFRPSXHUWDGHODHVFRWLOODGHVGHHOH[WHULRU

(QHOODWHUDOGHODSDODQFDGHUHWHQLGD )LJQž KD\XQDOODYH )LJQž 
TXH HQ HVD SRVLFLyQ VLUYH GH VHJXUR SDUD LPSHGLU OD DSHUWXUD GHVGH HO H[WHULRU
&DVR GH TXH VH TXLHUD SRGHU HIHFWXDU HVD DSHUWXUD GHVGH HO H[WHULRU VH UHWLUDUi
GLFKD OODYH GH VX DORMDPLHQWR KDELWXDO \ VH VLWXDUi HQ HO RULILFLR GHO PHFDQLVPR GH
DSHUWXUDH[WHULRU )LJQž \VHJLUDUiODOODYH )LJQž HQHOVHQWLGRGH
ODIOHFKDFRQORTXHVHFRQVHJXLUiTXHHOPHQFLRQDGRPHFDQLVPRVDOJDKDFLDDUULED
SURGXFLHQGRHOPLVPRHIHFWRTXHFXDQGRVHDFW~DGHVGHHOLQWHULRUVREUHODSDODQFD
GHUHWHQLGD )LJQž DEULpQGRVHSRUWDQWRODSXHUWDGHODHVFRWLOOD8QDYH]
UHDOL]DGDHVWDRSHUDFLyQUHWLUDUODOODYHGHOPHFDQLVPRGHDSHUWXUD\FRORFDUODHQVX
SRVLFLyQKDELWXDO
&XDQGR HO -HIH GH 9HKtFXOR \R HO 7LUDGRU VH OOHYDQ GLFKD OODYH \ VH DEDQGRQD HO
YHKtFXORGHEHUiSRQHUVHXQFDQGDGR )LJQž HQHORULILFLRGHOPHFDQLVPR
GH DSHUWXUD H[WHULRU SDUD HYLWDU TXH DOJXLHQ SXHGD LQWURGXFLU HQ HO PLVPR DOJXQD
KHUUDPLHQWDFRQODTXHSXGLHUDFRQVHJXLUDEULUODHVFRWLOOD

G%ORTXHRGHODHVFRWLOOD

3DUDEORTXHDUODHVFRWLOODGHVGHHOLQWHULRUVHGLVSRQHGHXQDSDODQFD )LJQž
 GHPDQLYHODDEDWLEOH )LJQž (VWDSDODQFDHQVXSRVLFLyQGHEORTXHR
DFWLYDHOFRQWDFWRUGHFLHUUH )LJQž 


38(57$6&255('(5$6'(/$3527(&&,Ï1'(/$7255(

/DV SXHUWDV GH FRUUHGHUD )LJ   VH DEUHQ DFFLRQDQGR VXV SHVWLOORV   \
HPSXMDQGR ODV PLVPDV   KDFLD ORV ODWHUDOHV WDO FRPR LQGLFDQ ODV IOHFKDV GH OD
ILJXUD\VHFLHUUDQDFWXDQGRHQVHQWLGRLQYHUVR
3RUUD]RQHVREYLDVGHVHJXULGDGHVWDVSXHUWDVGHEHQFHUUDUVHFXDQGRHO-9\7VH
HQFXHQWUDQ HQ VXV DVLHQWRV \ DQWHV GH SRQHU HQ IXQFLRQDPLHQWR OD WRUUH $PEDV
SXHUWDV GLVSRQHQ GH VHQGRV FRQWDFWRUHV HOpFWULFRV GH FLHUUH LJXDOHV D ORV GH ORV
DFFHVRVGHOFDVFRDILQGHGHWHFWDUVLQRHVWiQSHUIHFWDPHQWHFHUUDGDV






)LJXUD$FFHVRGHVGHODFiPDUDGHSHUVRQDOGHOFDVFR


3(/,*52
$17(6'(321(5/$7255((121&2/2&$53,(51$6<3,(6(1(/
,17(5,25'(/$&(67$&(55$5/$638(57$6&255('(5$6<
&20352%$5(/&,(55('(/$60,60$6


127$
6LHPSUHTXHHQHVWH0DQXDOVHWUDWHGHODFRPSUREDFLyQGHOFHUUDGRGH
HVFRWLOODVVHUHIHULUiDODVGRVHVFRWLOODVGHOFDVFRSRUWyQWUDVHUR\DODVGRV
SXHUWDVFRUUHGHUDVGHODFHVWDGHODWRUUH


$6,(1726

'LVSRQHQGHGRVPDQGRVGHDMXVWH
 3DODQFDGHOLEHUDFLyQGHODEDVHGHODVLHQWR )LJQž 3HUPLWHSRQHU
HODVLHQWR )LJQž HQSRVLFLyQYHUWLFDOVREUHODFROXPQDVRSRUWH )LJ
 Qž   FRQ OR TXH HO RSHUDGRU SXHGH SRQHUVH GH SLH FRQ FRPRGLGDG
VREUH HO SLVR GH OD WRUUH 3DUD HOOR VyOR KD\ DFFLRQDU OD SDODQFD \ WLUDU GHO
DVLHQWR KDFLD DUULED \ HO DVLHQWR VH UHSOHJDUi KDFLD DWUiV 3DUD SRQHU HO
DVLHQWR KRUL]RQWDO HPSXMDU HO DVLHQWR KDFLD DEDMR KDVWD TXH TXHGH
HQFODYDGR
 3HVWLOOR GH DMXVWH HQ DOWXUD )LJ  Qž   3HUPLWH REWHQHU RFKR DOWXUDV
GLIHUHQWHV GHO DVLHQWR 3DUD HOOR WLUDU KDFLD DIXHUD GHO SHVWLOOR \ DMXVWDU OD
DOWXUD GHO DVLHQWR DSURYHFKDQGR HO SHVR GHO FXHUSR &XDQGR VH DOFDQFH OD



DOWXUD GHVHDGD VROWDU HO SHVWLOOR SDUD TXH SRU DFFLyQ GH VX PXHOOH VH
LQWURGX]FDHQHORULILFLRFRUUHVSRQGLHQWH\TXHGHHQFODYDGR
/RV DVLHQWRV GLVSRQHQ GH XQ FLQWXUyQ GH VHJXULGDG GREOH FRQ XQD SDUWH ILMD )LJ
 Qž   \ GRV FDUUHWHV )LJ  Qž  \   VLWXDGRV HQ HO ODGR RSXHVWR
$VLPLVPR FXHQWDQ FRQ DOPRKDGLOODV GH ORQD GHVPRQWDEOHV \ UHSRVDFDEH]DV )LJ
Qž 
/DFROXPQDVRSRUWHVHDSR\DHQVXSDUWHLQIHULRUVREUHHOVRSRUWH )LJQž 



)LJXUD$VLHQWRVGHODWRUUH


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ H LGHQWLILFDQ ORV HOHPHQWRV VLWXDGRV HQ HO H[WHULRU H
LQWHULRUGHODWRUUHQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVWRGRVORVPDPSDURVGHEHQHVWDUFRORFDGR\
OODYHGHHVFRWLOODV&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

,GHQWLILFDUODGLVWULEXFLyQLQWHUQD\H[WHUQDGHODWRUUH
,GHQWLILFDUORVSHULVFRSLRVGHSXQWHUtDGHOWLUDGRU\-HIHGH9&,
0DQHMDUODVHVFRWLOODVGHVGHHOH[WHULRUHLQWHULRUGHO9&,\VDEHUEORTXHDUODV


0DQHMDUODVSXHUWDVFRUUHGHUDVGHODWRUUH
0DQHMDUDVLHQWRVGHODWRUUH
0DQLSXODUORVPDPSDURVGHODWRUUH
,GHQWLILFDODVJXtDVIOH[LEOHV\WROYDV
,GHQWLILFD\ORFDOL]DODVYHQWDQDVGHDFFHVRDFDUJDGRUGHOD$0FRD[LDO\DOPDFpQ
GHUHFRJLGDGHYDLQDV


6,78$&,Ï1),1$/


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1'(6&5,3&,Ï1,17(5,25'(/$7255( , 

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
 3UiFWLFDPLQXWRV
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQJUXSRHQHODXOD
3DUDODSDUWHSUiFWLFDVHFRORFDUiXQYHKtFXORSRUFDGDWULSXODQWHVFRPRPi[LPR
HQHOSDWLRRKDQJDU(OWULSXODQWHHVWDUiVLWXDGRHQHOSXHVWRGHO7LUDGRU&XDQGRVH
OHLQGLTXHLUiORFDOL]DQGRORVGLVWLQWRVHOHPHQWRVGHODSDUWHLQWHULRUGHODWRUUH


5(48,6,726$$/&$1=$5

4XH HO WULSXODQWH VHD FDSD] GH UHFRQRFHU \ ORFDOL]DU VLQ WLWXEHDU ORV GLVWLQWRV
HOHPHQWRVVLWXDGRVHQSXHVWRGHO7LUDGRU

6HFRQVLGHUDUDTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

(Q HO SXHVWR GHO 7LUDGRU VH HQFXHQWUDQ WRGRV ORV HOHPHQWRV \ PDQGRV QHFHVDULRV
SDUD HIHFWXDU WRGDV ODV RSHUDFLRQHV SURSLDV GH VX SXHVWR REVHUYDU DSXQWDU \
HIHFWXDUIXHJRFRQODVGLVWLQWDVDUPDVGHOYHKtFXOR


'(6&5,3&,Ï1'((/(0(1726'(/$7255(

D&iPDUDGHFRPEDWH3XHVWRGHOWLUDGRU




)LJXUD3XHVWRGHO7LUDGRU

 0DQLYHODGHPDQGRGHOHVFXGRGH  0DQGRHPSXxDGXUD
SURWHFFLyQEDOtVWLFD  3DQHO GH &RQWURO GH 0RQLWRUHV
 0RQLWRUGHYLVLyQWpUPLFD 3&0 GHYLVLyQWpUPLFD
 8QLGDG9LVXDO/iVHU  9HQWDQDGHREVHUYDFLyQGLUHFWD
 3DQHO GH &RQWURO GH DUPDV GHO  &DEH]DGHOSHULVFRSLR
7LUDGRU
 8QLGDG GH &RQWURO 3ULQFLSDO GH OD
'LUHFFLyQGH7LUR

E7HFKRGHODWRUUH

/DWRUUHGLVSRQHGHORVVLJXLHQWHVHOHPHQWRVGHLOXPLQDFLyQ
 7UHVOiPSDUDVGHLOXPLQDFLyQHQODFiPDUDGHDUPDV )LJQž FRQVXV
FRUUHVSRQGLHQWHVLQWHUUXSWRUHV )LJQž 
 7UHV SODIRQHV GH LOXPLQDFLyQ HQ OD FiPDUD GH FRPEDWH )LJ  Qž  
LJXDOHVDORVGHOFDVFR 
 8QDOiPSDUDGHLOXPLQDFLyQGHOFDUJDGRUGHUHFKR )LJQž 
 /X]URWDWLYDDFRSODEOHDOPiVWLO )LJQž \DGHVFULWDILFKD
GHHVWHPDQXDO
 &DMD GH LQWHUUXSWRUHV )LJ  Qž   SDUD OD OX] JLUDWRULD JHQHUDO SDUD OD
FiPDUD GH DUPDV \ OD OiPSDUD GHO FDUJDGRU GHUHFKR GHO FDxyQ 9HU GHWDOOH
)LJ 





)LJXUD(OHPHQWRVGHLOXPLQDFLyQGHODWRUUH  


)LJXUD(OHPHQWRVGHLOXPLQDFLyQGHODWRUUH  




)LJXUD/iPSDUDFiPDUDGHDUPDV






)LJXUD&DMDGHLQWHUUXSWRUHVOXFHVWRUUH


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ H LGHQWLILFDQ ORV HOHPHQWRV VLWXDGRV HQ HO LQWHULRU GH OD
WRUUH1RVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVWRGRVORVPDPSDURVGHEHQHVWDUFRORFDGRV\
HO9&,FRQPRWRUDSDJDGR&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDOD
PLVPD


$&&,21(6$5($/,=$5

5HFRQRFHU \ ORFDOL]DU WRGRV ORV HOHPHQWRV TXH VH HQFXHQWUDQ HQ HO SXHVWR GHO
7LUDGRUGHODFiPDUDGHFRPEDWH


6,78$&,Ï1),1$/


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/




),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1'(6&5,3&,Ï1,17(5,25'(/$7255( ,, 

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
 3UiFWLFDPLQXWRVSRU7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1


/DSDUWHWHyULFDVHUHDOL]DUiHQJUXSRHQHODXOD\SDUDODFODVHSUDFWLFDVHFRORFDUi
XQYHKtFXORHQHOSDWLRRKDQJDU(OWULSXODQWHVHVLWXDUiHQHOSXHVWRGHOWLUDGRU\HO
HYDOXDGRUHQHOSXHVWRGHO-HIHGH9HKtFXOR(OWULSXODQWHLUiORFDOL]DQGRHOHPHQWRV\
SXOVDGRUHV\VDEHUVXVIXQFLRQHV

5(48,6,726$$/&$1=$5

4XH HO WULSXODQWH VHD FDSD] GH ORFDOL]DU \ PDQHMDU VLQ WLWXEHRV ORV HOHPHQWRV \
PDQGRVGHVFULWRVHQODVHVLyQ

6HFRQVLGHUDUDTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

'(6&5,3&,Ï1'((/(0(1726'(/$7255(

D3HULVFRSLRGHOWLUDGRU

(OSHULVFRSLRGHO7LUDGRUFRPRSULQFLSDOOOHYDDFRSODGRHOUHWtFXORGHSXQWHUtDGHOD
'LUHFFLyQGH7LURFRQWURODGRSRUHOFRPSXWDGRUEDOtVWLFR

D  (/(0(172648(/2&20321(1

 &DEH]D GH SHULVFRSLR TXH FRQWLHQH HO HVSHMR \ ODV YHQWDQDV WDQWR SDUD ORV
HOHPHQWRV GLXUQRV FRPR SDUD OD FiPDUD WpUPLFD 7DPELpQ LQFOX\H HO


VHUYRVLVWHPDQHFHVDULRSDUDLQWURGXFLUHOiQJXORGHVXSHUHOHYDFLyQFDOFXODGR
SRUHOFRPSXWDGRUEDOtVWLFR(VWiXQLGRPHFiQLFDPHQWHFRQHOFRQMXQWRFDxyQ
PDVDRVFLODQWH 
 0RQWXUD
 &XHUSRGHSHULVFRSLRTXHLQFOX\H
o /D8QLGDG9LVXDO/iVHU 89/ HOHPHQWRSULQFLSDOGHSXQWHUtDGLXUQD\
PHGLFLyQGHGLVWDQFLDVTXHLQFOX\HHORFXODUGHSXQWHUtDGLXUQRFRQHO
UHWtFXOR \ ORV GDWRV GH GLVWDQFLD HO WHOpPHWUR OiVHU \ OD XQLGDG GH
FRQWURO GH GHVSOD]DPLHQWR HQ D]LPXW GHO UHWtFXOR TXH LQWURGXFH ODV
SUHGLFFLRQHV FDOFXODGDV SRU HO FRPSXWDGRU EDOtVWLFR HQ IXQFLyQ GH OD
YHORFLGDGGHOEODQFR
o (OVHQVRUGHODFiPDUDWpUPLFD



 )LJXUD&RQMXQWRSHULVFRSLRYLVWD
)LJXUD&RQMXQWRSHULVFRSLRYLVWD SRVWHULRU
DQWHULRU
 &DEH]DGH(VSHMR  8QLGDG9LVXDO/iVHU 89/ 
 0RQWXUDGHO3HULVFRSLR  6HQVRUGHOD&iPDUD7pUPLFD
 
D  &$%(=$'((63(-2'(/3(5,6&23,2'(/7,5$'25

/D&DEH]DGH(VSHMR )LJ LQFRUSRUDORVVHUYRPHFDQLVPRVGHPRYLPLHQWRGH
ODOtQHDGHPLUDHQHOHYDFLyQHLQFOX\HXQDFXELHUWDEDOtVWLFDFRQGRVYHQWDQDVXQD
GHJHUPDQLR  SDUDSHUPLWLUHOSDVRGHODUDGLDFLyQ,5KDFLDHO6HQVRUGHOD&7\
ODRWUDGHYLGULRSDUDODYHQWDQDSDQRUiPLFD[  \ORVFDQDOHVGtDOiVHU  
(O HVSHMR   HQOD]D PHFiQLFDPHQWH FRQ HO DUPD D WUDYpV GHO PHFDQLVPR GH
VXSHUHOHYDFLyQSHUPLWLHQGRHOSRVLFLRQDPLHQWRGHODOtQHDGHPLUDHQWRGRHOUDQJR
GH UHFRUULGR GHO FDxyQ \ HO GHVSOD]DPLHQWR GH OD HVFHQD QHFHVDULR SDUD OD
LQWURGXFFLyQGHOiQJXORGHVXSHUHOHYDFLyQUHTXHULGRSDUDEDWLUHOREMHWLYR





)LJXUD&DEH]DGHHVSHMR

 7RUQLOORGHEDUULGR  &DUWXFKR GHVHFDQWH FRQ LQGLFDGRU
 9HQWDQD ,5 GHO 6HQVRU GH OD GHKXPHGDG
&iPDUDWpUPLFD  &RORUD]XO6HFR
 9HQWDQDSDQRUiPLFD[  &RORU URVD +XPHGDG &DPELDU
 (VSHMR FDUWXFKR GHVHFDQWH ž
 9HQWDQD8QLGDG9LVXDO/iVHU (VFDOyQ 
 9iOYXODGHSUHVXUL]DFLyQ

D  021785$'(/3(5,6&23,2

/D0RQWXUDGH3HULVFRSLR 03  )LJV\ HVODHVWUXFWXUDGRQGHVHDFRSODQ
SRUODSDUWHVXSHULRUOD&DEH]DGH(VSHMR &( \SRUODLQIHULRUOD89/\HO6HQVRUGH
OD&7$VLPLVPRSHUPLWHHODFRSODPLHQWRGHOFRQMXQWRGHOSHULVFRSLRFRQODWRUUHGHO
YHKtFXOR,QFRUSRUDODYHQWDQDGHREVHUYDFLyQ[FRQVXILOWURGHSURWHFFLyQOiVHU






)LJXUD0RQWXUDGHOSHULVFRSLR







)LJXUD0RQWXUDGHOSHULVFRSLR



127$
/D 03 GLVSRQH GH XQ ILOWUR GH VHJXULGDG LQVWDODGR HQ HO FDQDO GH REVHUYDFLyQ [
TXHSURWHJHDORSHUDGRUGHODUDGLDFLyQOiVHU


D  5(7Ë&8/2'(/3(5,6&23,2






)LJXUD5HWtFXORGHOSHULVFRSLRGHOWLUDGRU

(OWLSRGHPXQLFLyQVHOHFFLRQDGDDSDUHFHHQSDQWDOODPHGLDQWHXQDOHWUDFODYH

7,32'(081,&,Ï1 $/=$'(&20%$7( &/$9((1
HQ+0 3$17$//$
(UURU1LQJXQR  (
0*  $
03737+(,  *
$3)6'6  3


)LJXUD'HWDOOHGHOUHWtFXORGHSXQWHUtD

/DVFDUDFWHUtVWLFDVWpFQLFDVGHORVGLVWLQWRVHOHPHQWRVVHH[SRQHQHQHO
FRUUHVSRQGLHQWH07


127$
/RVWLSRVGHPXQLFLyQVHH[SRQHQHQODILFKDGHHVWHPDQXDO 

E8QLGDGYLVXDOOiVHU 89/ 



/D8QLGDG9LVXDO/iVHU )LJV\ LQFRUSRUDODVVLJXLHQWHVIXQFLRQHV
 2EVHUYDFLyQGHODHVFHQDHQHOHVSHFWURYLVLEOH\DGTXLVLFLyQGHREMHWLYRVVL
ODVFRQGLFLRQHVGHYLVLELOLGDGVRQDGHFXDGDV
 0HGLFLyQGHGLVWDQFLDV WHOpPHWUROiVHU 
 ,QWHJUDXQPHFDQLVPRGHGHVSOD]DPLHQWRGHODOtQHDGHPLUDHQDFLPXW
 3UHVHQWDODLQIRUPDFLyQGHOD'7HQHORFXODUGHOD89/




)LJXUD8QLGDG9LVXDO/iVHU  

1ž'(120,1$&,Ï1 )81&,Ï1
 $32<$)5(17( 
 2&8/$5 5HDOL]DUSXQWHUtDV
 0$1'2(1)248( $MXVWDUGLRSWUtDV
 ,/805(7 5HyVWDWRGHLOXPLQDFLyQGHOUHWtFXOR
 ,17(5583725 6HOHFFLRQD HO HFR TXH VHUi XWLOL]DGR SDUD FDOFXODU OD
35,0(52Ò/7,02 GLVWDQFLDDOEODQFR
 //$9(/È6(5 &RQHFWDRGHVFRQHFWDHOOiVHU
 ,1',&$'25 '( ,QGLFD VL KD HQWUDGR KXPHGDG HQ HO LQWHULRU GH OD
+80('$' XQLGDG&RQWLHQHXQFDUWXFKRGHVHFDQWH
&RORUD]XO6HFR
&RORU URVD +XPHGDG &DPELDU FDUWXFKR GHVHFDQWH
ž( 
 9È/98/$ '( 3HUPLWH SUHVXUL]DU HO SHULVFRSLR PDQWHQLHQGR OD
35(685,=$&,Ï1 HVWDQTXHLGDG
 &21087$'25 6HOHFFLRQD PRGR 1250$/ SDUD GLVSDUR OiVHU FRQ
'(/ $7(18$'25 SOHQR DOFDQFH R PRGR (175(1$0,(172 SDUD
/È6(5 GLVSDUROiVHUFRQHQHUJtDDWHQXDGD



 0$1'2 '( /26 ,QWURGXFLU ILOWURV HQ OD ySWLFD GH DFXHUGR FRQ ODV
),/7526 FRQGLFLRQHVGHLOXPLQDFLyQDPELHQWDOHV
 326,&,Ï1,/80,1$&,Ï1),/752
&/$5$12
1(%/,1$1(8752
62/$5$=8/&/$52



)LJXUD8QLGDG9LVXDO/iVHU  


3(/,*52
(/ +$= /È6(5 (6 3(/,*5262 < 38('( &$86$5 &(*8(5$ 6, 12 6(
87,/,=$1 *$)$6 '( 6(*85,'$' /È6(5 12 $3817$5 181&$ (/
7(/e0(752/È6(5+$&,$(/3(5621$/
6, (/ +$= /È6(5 (6 5()/(-$'2 325 81$ 683(5),&,( 3/$1$ <
%5,//$17( 38('( &$86$5 &(*8(5$ $ 0(126 48( 6( 87,/,&(1 *$)$6
'(6(*85,'$'/È6(5


127$
/D 89/ GLVSRQH LQWHUQDPHQWH GH XQ ILOWUR GH VHJXULGDG LQVWDODGR HQ HO RFXODU GHO
FDQDOYLVXDOTXHSURWHJHDORSHUDGRUGHODUDGLDFLyQOiVHUGH1G<$* QP 

F&iPDUDWpUPLFD

/DFiPDUDWpUPLFDSHUPLWHODYLVLyQWDQWRGHGtDFRPRGHQRFKH\HQFXDOTXLHU
FLUFXQVWDQFLDGHWLHPSRPHWHRUROyJLFR

F  (/(0(172648(/$&20321(1

 6HQVRU WpUPLFR LQVWDODGR HQ HO FXHUSR GHO SHULVFRSLR  TXH D WUDYpV GH OD
YHQWDQD FRUUHVSRQGLHQWH HQ OD FDEH]D GHO SHULVFRSLR FDSWD \ JHQHUD OD
LPDJHQWpUPLFD
 8QLGDGHOHFWUyQLFDGHODFiPDUDWpUPLFDTXHJHQHUD ODDOLPHQWDFLyQGHEDMD
WHQVLyQ\HOFRQWUROGHLQIRUPDFLyQGHUHWtFXORV


 'RV PRQLWRUHV SDQWDOODV  SDUD HO -HIH GH 9HKtFXOR \ 7LUDGRU TXH SUHVHQWDQ
ODVLPiJHQHVWpUPLFDVHOUHWtFXOR\DPERVGLVSRQHQGHPDQGRVGHFRQWUROGH
EULOORWDQWRGHLPDJHQFRPRGHOUHWtFXOR
 3DQHO GH &RQWURO GH 0RQLWRUHV 3&0  TXH GLVSRQH GH ORV PDQGRV TXH
FRQWURODQODWHUPRJUDItDSDUDDPERVWULSXODQWHVVDOYREULOOR\UHWtFXOR

F  021,725'(/$&È0$5$7e50,&$

$PERVPRQLWRUHVHOGHO-9\HOGHO7LUDGRUVRQLJXDOHV



)LJXUD0RQLWRU

1ž '(120,1$&,Ï1 )81&,Ï1
 0RQLWRU 3UHVHQWDUODLPDJHQWpUPLFD
 0DQGRGH%5,//2 &RQWUROEULOORGHODLPDJHQ
 0DQGRGH%5,//25(7,&8/ &RQWUROEULOORGHOUHWtFXOR

F  3$1(/'(&21752/2'(021,725(6'(/$&È0$5$7e50,&$ 3&0 






)LJXUD3DQHOGH&RQWUROGHORV0RQLWRUHV  


1ž '(120,1$&,Ï1 )81&,Ï1
 0DQGR&2175$67( &RQWUROGHJDQDQFLDHQWRGRVORVFDQDOHV
 ,QWHUUXSWRUGH 3RVLFLRQHV
32/$5,'$'  %/$1&2 &$/,(17( /RV FXHUSRV PiV
FDOLHQWHVVHREVHUYDUiQPiVEULOODQWHV
 1(*52 &$/,(17( /RV FXHUSRV PiV
FDOLHQWHVVHREVHUYDUiQPiVRVFXURV
 ,QWHUUXSWRU&$032 (OHJLUHOFDPSRGHYLVLyQ
 $1&+2SDUDREVHUYDFLyQ
 (675(&+2SDUDHOWLUR
 ,QWHUUXSWRU9,6,Ï1 (QFHQGHU 21 RDSDJDU 2)) HO6LVWHPDGH&iPDUD
7e50,&$ 7pUPLFD
 ,QWHUUXSWRU(1)248( $MXVWDUHOHQIRTXHGHOD&iPDUD
 /(-26
 &(5&$




)LJXUD3DQHOGH&RQWUROGHORV0RQLWRUHV  

1ž '(120,1$&,Ï1 )81&,Ï1
 0DQGR6,67(0$ 6HOHFFLRQDUODIRUPDGHIXQFLRQDPLHQWRGHOD
&iPDUD
 7(67$XWRWHVW
 1250$/1RUPDO
 +202+RPRJHQHL]DFLyQ
 ,QGLFDGRU$&7,92 6HHQFLHQGHFXDQGRWRGDVODVWHQVLRQHVGH
$/,0(17$&,Ï1 DOLPHQWDFLyQJHQHUDGDVHQOD8(&7DOFDQ]DQVX
QLYHOQRUPDO
 ,QGLFDGRU$&7,92 6HHQFLHQGHFXDQGRORVGHWHFWRUHVDOFDQ]DQVX
6(1625 WHPSHUDWXUDGHIXQFLRQDPLHQWR . PLQXWRV
GHVSXpVGHHQFHQGHUVHDSUR[LPDGDPHQWH
 &RQPXWDGRUDUWLFXODGR 3HUPLWLUODKRPRJHQHL]DFLyQGHOVLVWHPDPRYLHQGR
PDQGR+202*(1 HOUHWtFXOR$55,%$$%$-2,=4'$<'&+$
)XQFLRQDFRPRXQMR\VWLFN 

F  5(7Ë&8/26'(/$&È0$5$7e50,&$

/DFiPDUDWpUPLFDSHUPLWHWUDEDMDUHQGRVPRGRV
D  0RGR2EVHUYDFLyQORFDOL]DFLyQGHEODQFRV
E  0RGR3XQWHUtD
$PERVPRGRVSXHGHQVHOHFFLRQDUVHFRQHOLQWHUUXSWRU&$032 )LJ
Qž £(UURU1RVHHQFXHQWUDHORULJHQGHODUHIHUHQFLD$PEDVLPiJHQHVRIUHFHQ
ODVLJXLHQWHLQIRUPDFLyQ



,PDJHQHQ³FDPSRDQFKR´


)LJXUD,PDJHQHQFDPSRDQFKR

 'LVWDQFLDHQ   $O]DGHFRPEDWHRGLVWDQFLDDOWHUQDWLYD
GHFiPHWURV
 7LSRVGHPXQLFLyQ   )DOORGHOVLVWHPD
$$PHWUDOODGRUD   5HWtFXORLQGLFDQGRHOiUHDDEDUFDGDHQ
*0373+(, FDPSRDQFKR
3$3)6'6   HURƒ(&2
  3XQWRVHFRVP~OWLSOHV

,PDJHQHQ³FDPSRHVWUHFKR´


)LJXUD,PDJHQHQFDPSRHVWUHFKR

 'LVWDQFLDHQGHFiPHWURV   )DOORGHOVLVWHPD
 7LSRVGHPXQLFLyQ   5HWtFXORPyYLO
$$PHWUDOODGRUD     5HWtFXORILMR
*73+(,03   HURƒ(&2



3$3)6'6   3XQWRVHFRVP~OWLSOHV
 $O]DGHFRPEDWHRGLVWDQFLD   
DOWHUQDWLYD


G&RPSXWDGRUEDOtVWLFR

(O FRPSXWDGRU EDOtVWLFR UHDOL]D HO FiOFXOR PDWHPiWLFR QHFHVDULR SDUD OD
GHWHUPLQDFLyQ GH ORV iQJXORV GH WLUR \ OD SUHGLFFLyQ HQ D]LPXW SDUWLHQGR GH ORV
SDUiPHWURVLQWURGXFLGRVHQHOVLVWHPDWDQWRGHIRUPDPDQXDOFRPRSRUPHGLRGHOD
LQIRUPDFLyQ VXPLQLVWUDGD SRU ORV WUDQVGXFWRUHV /RV UHVXOWDGRV REWHQLGRV GH ORV
FiOFXORV EDOtVWLFRV FRQ FRUUHFFLRQHV GHELGDV D ORV SDUDODMHV \ FRUUHFFLRQHV
VLVWHPiWLFDV VRQ WUDQVPLWLGRV D OD OtQHD GH PLUD &RQWLHQH OD HOHFWUyQLFD GH
DGDSWDFLyQ SDUD ORV WUDQVGXFWRUHV \ OD HOHFWUyQLFD GH DWHQFLyQ D ORV LQWHUUXSWRUHV
SURFHGHQWHVGHODVFRQVRODVSHULIpULFDV

H8QLGDGGH&RQWURO3ULQFLSDO

6HWUDWDGHXQSDQHOTXHGLVSRQHGHORVGLVWLQWRVLQWHUUXSWRUHVSXOVDGRUHVH
LQGLFDGRUHVSDUDHOPDQHMR\IXQFLRQDPLHQWRGHOFRPSXWDGRU3HUPLWHLQWURGXFLU\
SUHVHQWDULQIRUPDFLyQFRQWUROGHVHQVRUHV\HIHFWXDUDMXVWHV


)LJXUD8QLGDGGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1
 &RQPXWDGRUDUWLFXODGR 0RYHUHOUHWtFXORGHSXQWHUtDDUULEDDEDMRGHUHFKDR
+202*(1(,=$&,Ï1 L]TXLHUGDGXUDQWHODVRSHUDFLRQHV MR\VWLFN 
 7HVWLJR3:5 6HHQFLHQGH YHUGH FXDQGRHOLQWHUUXSWRUSULQFLSDOHVWi
HQ21
 ,QWHUUXSWRUSULQFLSDO &RQHFWDU 21 RDSDJDU 2)) OD8&3\OD'LUHFFLyQ
GH7LUR
 7HVWLJR)$//2 ,QGLFDGHIRUPDOXPLQRVD HQURMR XQIDOORTXHQR
SHUPLWDODRSHUDWLYLGDGGHOVLVWHPD
 3XOVDGRU7(67 9HULILFDHOIXQFLRQDPLHQWRGHODVOiPSDUDV ORVWHVWLJRV
SHUPDQHFHQHQFHQGLGRVPLHQWUDVVHPDQWLHQHHO
LQWHUUXSWRUHQSRVLFLyQ7(67SUHVLRQDQGRKDFLDDEDMR 
8QDYH]VROWDGRYXHOYHDVXSRVLFLyQLQLFLDOYHULILFDQGR
HOVLVWHPDHQVHJXQGRV
 3XOVDGRU+202 3HUPLWHLQWURGXFLUFRUUHFFLRQHVGHKRPRJHQHL]DFLyQ



 3XOVDGRU&(52 3HUPLWHLQWURGXFLU\FRPSUREDUORVHUURUHVVLVWHPiWLFRV
GHODPXQLFLyQ
 3XOVDGRU',67$ D 3XOViQGROR SHUPLWH LQWURGXFLU QRUPDOPHQWH OD
GLVWDQFLD
E 6L VH HQFLHQGH DXWRPiWLFDPHQWH LQGLFD IDOOR HQ HO
IXQFLRQDPLHQWR GHO WHOpPHWUR OiVHU (QWUD
DXWRPiWLFDPHQWH HO DO]D GH FRPEDWH GHO DUPD
VHOHFFLRQDGD



)LJXUD8QLGDGGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1
 3XOVDGRU6(16$1*8 D  $O SXOVDUOR SRQH IXHUD GH VHUYLFLR DO VHQVRU \
 DXWRPiWLFDPHQWH LQWURGXFH HO YDORU ³´ FRPR
iQJXORGHLQFOLQDFLyQ
E  $OLOXPLQDUVHDXWRPiWLFDPHQWHLQGLFDDQXODFLyQ
SRU PRYLPLHQWR R SRU IDOOR HQ HO VHQVRU GH
LQFOLQDFLyQGHYHKtFXOR
 3XOVDGRU&/($5 %RUUDUHOYDORUQXPpULFRTXHVHxDOHODSDQWDOOD
 3XOVDGRU(17(5 ,QWURGXFLUORVGDWRVPRVWUDGRVHQODSDQWDOOD
 7HVWLJRVGHPXQLFLyQ 3UHVHQWDQWLSRGHPXQLFLyQVHOHFFLRQDGR
 3XOVDGRU9,(17 3HUPLWHODLQWURGXFFLyQPDQXDOGHHVWHSDUiPHWUR
PHGLDQWHHOWHFODGRQXPpULFR
 3XOVDGRU$/7, ,QWURGXFLUPDQXDOPHQWHODDOWLWXG
 3XOVDGRU7(03$,5( ,QWURGXFLUPDQXDOPHQWHODWHPSHUDWXUDDPELHQWH
 0DQGRGHEULOOR 3RWHQFLyPHWURSDUDFRQWURODUHOEULOORGHOD8&3
 7HFODGRQXPpULFR 3HUPLWHLQWURGXFLUORVGDWRVFRUUHVSRQGLHQWHVFXDQGR
VHRSULPHDOJ~QSXOVDGRUGHOWDEOHUR
 3DQWDOOD D  3UHVHQWDHOYDORUQXPpULFRTXHVHLQWURGX]FDHQ
HO FRPSXWDGRU PHGLDQWH HO WHFODGR R HO YDORU
PHGLGR DO UHDOL]DU ORV DMXVWHV GHO YLVRU /RV
WHVWLJRVGHDEDMRPDUFDGRVFRQIOHFKDVLQGLFDQ
HO VHQWLGR TXH WRPDQ ORV YDORUHV
FRUUHVSRQGLHQWHVGH$=,087\(/(9$&,21
E  3RU GHIHFWR PXHVWUD HO WLSR GH PXQLFLyQ
VHOHFFLRQDGD





I0DQGRHPSXxDGXUDGHOWLUDGRU

6RQ ORV HQFDUJDGRV GH WUDQVPLWLU ODV yUGHQHV GH JLUR R HOHYDFLyQ D ORV VHUYRV
7DPELpQLQFOX\HQORVGLVSDUDGRUHVGHODVDUPDV\OiVHU



)LJXUD0DQGRHPSXxDGXUDGHO7LUDGRU

1ž '(120,1$&,Ï1 )81&,Ï1
 (PSXxDGXUDV &RQWURODUHOPDQGR
 3XOVDGRUDO]DGH ,QWURGXFLUHODO]DGHFRPEDWHFRPRGLVWDQFLDGHWLUR
FRPEDWH´
 3XOVDGRUOiVHU 5HDOL]DUODPHGLFLyQGHGLVWDQFLDOiVHU\ODSUHGLFFLyQ
ODWHUDO
 'LVSDUDGRUHV 5HDOL]DUIXHJRFRQHODUPDPHQWR
 3XOVDGRUHVWRPDGH (VQHFHVDULRWHQHUORSXOVDGRSDUDSRGHUDFWXDUVREUH
FDUJD ORVRWURVSXOVDGRUHV


J3DQHOGH&RQWURO3ULQFLSDO

(O3DQHOGH&RQWURO3ULQFLSDOSHUPLWHDFFLRQDUGLYHUVRVVLVWHPDV\SUHVHQWDOD
LQIRUPDFLyQVREUHHOVWDWXVGHGLVWLQWRVHOHPHQWRV\VLVWHPDV




)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1
 ,QGLFDGRU=21$,17(5 6H LOXPLQD FXDQGR OD WRUUH VH HQFXHQWUD HQWUH ODV  \
',5(& ODV\HQWUHODV\ODVLQGLFDQGRTXHHVWiHQXQD
GH ODV ]RQDV GRQGH SRU GHEDMR GH XQ GHWHUPLQDGR
iQJXOR GH GHSUHVLyQ GHO FDxyQ SXHGH LQWHUIHULU FRQ HO
FDVFR
 ,QWHUUXSWRU$18/$5 ,QKLELU VHJXULGDG FRQ HVFRWLOODV DELHUWDV $O SRQHUOR HQ
6(*(6&7 21 EDMR OD UHVSRQVDELOLGDG GHO -9  HO LQGLFDGRU
(6&27 $%,(5 GHEHUi SDUSDGHDU \ OD OyJLFD GHO
VLVWHPD LJQRUDUi HO KHFKR GH TXH HVWp DELHUWD DOJXQD
HVFRWLOOD
 ,QGLFDGRU(6&27 ,QGLFDUTXHHVWiDELHUWDDOJXQDGHODVWUHVHVFRWLOODVGHO
$%,(5 FDVFR R ODV SXHUWDV FRUUHGHUDV GH OD SURWHFFLyQ GH OD
WRUUH &XDQGR VH HQFLHQGH HO VLVWHPD GH DUPDV VH
SRQH HQ 6(*852 \ VH GHVFRQHFWDUiQ HO VLVWHPD GH
VHUYRV \ OD HVWDELOL]DFLyQ 3DUSDGHD VL HO LQWHUUXSWRU
$18/$56(*(6&7HVWiHQ21
 ,QWHUUXSWRUJHQHUDO &RQHFWDUODDOLPHQWDFLyQGHHQHUJtDHOpFWULFDDODWRUUH
7255(212)) FRQGRVSRVLFLRQHV
217LUDQGRKDFLDDIXHUD
2))3UHVLRQDQGR




)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1

 3XOVDGRUGH $MXVWDUODGHULYDGHODHVWDELOL]DFLyQ
FRPSHQVDFLyQGHGHULYD
&203'(5, 
 7RPDGHFRUULHQWH 3HUPLWLU OD FRQH[LyQ GH DFFHVRULRV DX[LOLDUHV D  9
FF
 3XOVDGRULQGLFDGRU &RQHFWDU SUHVLRQiQGROR  HO VLVWHPD GH UHDUPH GHO
5($56(59 FLHUUH GHO FDxyQ FXDQGR H[LVWD XQD LQWHUUXSFLyQ R
DYHUtDHQHOFDxyQ6HLOXPLQDHQ³URMR´

 3XOVDGRU%,7352; 6LODSDQWDOODHVWiDSDJDGDRUGHQSDUDSUHVHQWDU
YHU ILFKD  HOPHQ~GHO%,7(
GHHVWHPDQXDO  6LVHHVWiHMHFXWDQGRDOJXQRGHORVWHVWRUGHQSDUD
SUHVHQWDUHOVLJXLHQWHPHQVDMH

 3XOVDGRULQGLFDGRU &RQHFWDU SUHVLRQiQGROR  HO VLVWHPD GH DUPDGR GH


5($51250 FLHUUHGHOFDxyQ6HLOXPLQDHQ³YHUGH´
 3XOVDGRU'(6&21 $SDJDU SUHVLRQiQGROR  ODV OXFHV GH ORV SDQHOHV \
/8&(6 ODVOXFHVGHWRUUH\FDVFR6XIXQFLyQHVVHPHMDQWHDO
 TXHGLVSRQHHO-87
 3XOVDGRU%,76(/(& (MHFXWDUHOPHQVDMHSUHVHQWDGRHQODSDQWDOOD
YHU ILFKD 
GHHVWHPDQXDO 






)LJXUD3DQHOGH&RQWURO3ULQFLSDO  


1ž '(120,1$&,Ï1 )81&,Ï1
 3DQWDOODGHLQIRUPDFLyQ 3UHVHQWDU PHQVDMH GH LQWHJULGDG GHO VLVWHPD GXUDQWH
YHU ILFKD  OD HMHFXFLyQ GHO %,7( HQ FXDOTXLHUD GH VXV
GHHVWHPDQXDO  PRGDOLGDGHV
 3XOVDGRULQGLFDGRU &XDQGRVHFRQHFWD SUHVLRQiQGROR DFWLYDOD
(67$%212)) HVWDELOL]DFLyQGHWRUUH\FDxyQ,QLFLDOPHQWHHQYtDXQD
VHxDOGHSHWLFLyQDOVLVWHPDGHDFFLRQDPLHQWR\
HVWDELOL]DFLyQ\HOLQGLFDGRUSDUSDGHD HQ³iPEDU´ 
&XDQGRVHUHFLEHODFRQILUPDFLyQDODVHxDOHO
LQGLFDGRUOXFHILMR3DUDSRGHUDFWLYDUVHOD
HVWDELOL]DFLyQGHEHHVWDUHQ21HOSXOVDGRU  
6(592212))
 ,QGLFDGRU7(16%$-$ 6HLOXPLQDHQ³URMR´FXDQGRHOYROWDMHEDMDD9
 3RUGHEDMRGH9HOLQGLFDGRUSDUSDGHD
$QiORJDPHQWHVXFHGHSRUHQFLPDGH\9
 3XOVDGRULQGLFDGRU $FWLYDU SUHVLRQiQGROR HOVLVWHPDGHDFFLRQDPLHQWR
6(592212)) SRGHUPRYHUODWRUUH\HOFDxyQHOpFWULFDPHQWH
 3DUSDGHD HQ ³YHUGH´  \ HO VLVWHPD GH VHUYRV TXHGD
LQKLELGR VL KD\ DOJXQD HVFRWLOOD DELHUWD R HUURU HQ HO
VLVWHPD HQ FX\R FDVR VH HQFLHQGH HO LQGLFDGRU  
(55256(592







)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1
 ,QGLFDGRU=21$,17(5 ,QGLFDUTXHODSRVLFLyQGHODWRUUHHQGLUHFFLyQHQWUD
'(35( HQ]RQDSURKLELGD\TXHHOiQJXORGHGHSUHVLyQGHO
FDxyQ HV PD\RU GHO SHUPLWLGR HQ HVD ]RQD (O
FDxyQVHHOHYDDXWRPiWLFDPHQWH\VHLQWHUUXPSHHO
WLUR VHLOXPLQDHQ³URMR´ 
 ,QGLFDGRU75,1&$6 ,QGLFDU TXH OD WULQFD GH GLUHFFLyQ R GH HOHYDFLyQ
HVWiQSXHVWDV\VHTXLHUHPRYHUODWRUUHRFXDQGR
KD\ DOJ~Q REVWiFXOR H[WHULRU TXH EORTXHD HO
PRYLPLHQWRHQGLUHFFLyQRHQHOHYDFLyQGHOFDxyQ
VH LOXPLQD HQ ³URMR´  1R VH HQFLHQGH FRQ ODV
WULQFDVSXHVWDV
 ,QGLFDGRU(55256(592 ,QGLFDU VL KD\ IDOORV HQ HO VLVWHPD GH HOHYDFLyQ GH
FDxyQ\JLURGHWRUUH VHLOXPLQDHQ³URMR´ (QHVWH
FDVRSDUSDGHDHOSXOVDGRU  6(592212))
 &RQHFWRU 3HUPLWLU FRQHFWDU XQ RUGHQDGRU SRUWiWLO SDUD UHFLELU
LQIRUPDFLyQGHORVGLVWLQWRVVLVWHPDV
 5HyVWDWR 5HJXODU OD LQWHQVLGDG GH LOXPLQDFLyQ GH ORV
LQGLFDGRUHV\GHODSDQWDOOD


K3DQHOGH&RQWUROGHO7LUDGRU







)LJXUD3DQHOGH&RQWUROGHDUPDVGHO7LUDGRU  

1ž '(120,1$&,Ï1 )81&,Ï1
 3DQWDOOD GH LQIRUPDFLyQ $YLVDUDO7LUDGRUGH
FRQORVWHVWLJRV
326,1&$/,0 URMR  (ODOLPHQWDGRUGHOFDxyQQRHVWiELHQSRVLFLRQDGR
&,(55( $75$6 (O FLHUUH GHO FDxyQ HVWi HQ SRVLFLyQ UHWUDVDGD GH
iPEDU  DUPDGR 
0*5$) YHUGH  6HOHFFLRQDGR WLURFRQ$0(75$//$'25$DUiIDJDV
GHGLVSDURV DSUR[ 
0*5$)&217 YHUGH  6HOHFFLRQDGD$0(75$//$'25$HQIXHJRFRQWLQXR
0077 YHUGH  6HOHFFLRQDGRWLURFRQ&$fÏ1WLURDWLUR
005$) YHUGH  6HOHFFLRQDGR&$fÏ1DUiIDJDVGHGLVSDURV
005$) YHUGH  6HOHFFLRQDGR&$fÏ1DUiIDJDVGHGLVSDURV
005$) YHUGH  6HOHFFLRQDGR&$fÏ1DUiIDJDVGHGLVSDURV





)LJXUD3DQHOGH&RQWUROGHDUPDVGHO7LUDGRU  

1ž '(120,1$&,Ï1 )81&,Ï1
 /21* 5$) 6HOHFWRU GHO 9DULDUDOSXOVDUORHOQ~PHURGHGLVSDURVGHOD
Q~PHUR GH GLVSDURV SRU UiIDJD UiIDJD GHO FDxyQ R GH OD DPHWUDOODGRUD VHJ~Q
GHOFDxyQ\GHODDPHWUDOODGRUD LQGLFDFLyQHQODSDQWDOOD
 &,=43XOVDGRUVHOHFWRUGHO ,QGLFDU DO SXOVDUOR TXH VH KD VHOHFFLRQDGR HO
FDxyQFRQFDUJDGRUL]TXLHUGR FDxyQSDUDGLVSDUDUFRQHOFDUJDGRUL]TXLHUGR
VHLOXPLQDHQ³iPEDU´ 
  & '(5 3XOVDGRUVHOHFWRU ,QGLFDU DO SXOVDUOR TXH VH KD VHOHFFLRQDGR HO
GHO FDxyQ FRQ FDUJDGRU FDxyQ SDUD GLVSDUDU FRQ HO FDUJDGRU GHUHFKR
GHUHFKR VHLOXPLQDHQ³iPEDU´ 
 )8(*23XOVDGRUGHGLVSDUR 3HUPLWLUDOSXOVDUORHOGLVSDURGHODUPDPHQWR
VHLOXPLQDHQ³URMR´ 
 6(*8523XOVDGRUGHVHJXUR ,PSHGLUDOSXOVDUORHOGLVSDURGHODUPDPHQWR
VHLOXPLQDHQ³YHUGH´ 
 0* 3XOVDGRUVHOHFWRU GH ,QGLFDUDOSXOVDUORTXHODDPHWUDOODGRUDVHKD
DPHWUDOODGRUD VHOHFFLRQDGR VHLOXPLQDHQ³iPEDU´ 
 ),1&,17$,QGLFDGRUGHILQDOGH ,QGLFDU TXH KD DFWXDGR HO ILQ GH FLQWD \ HV
FLQWDGHDOLPHQWDFLyQ QHFHVDULR SURFHGHU D OD UHFDUJD GH PXQLFLyQ
6LVHSXOVDSHUPLWHWLUDUKDVWDHO~OWLPRGLVSDUR
VHLOXPLQDHQ³URMR´KDVWDTXHVHSXOVD 
 5HyVWDWR 5HJXODU OD LQWHQVLGDG GH LOXPLQDFLyQ GH
LQGLFDGRUHV\GHODSDQWDOOD


5(680(1




(QHVWDILFKDVHLGHQWLILFDQ\VHGHVFULEHHOIXQFLRQDPLHQWRGHWRGRVORVHOHPHQWRV
VLWXDGRV HQ HO SXHVWR GHO WLUDGRU QR VH FRQVLGHUD FRQYHQLHQWH UHDOL]DU XQ UHVXPHQ
GHORVPLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVWRGRVORVPDPSDURVGHEHQHVWDUFRORFDGRV\
HO9&,FRQPRWRUDSDJDGR&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDOD
PLVPD


$&&,21(6$5($/,=$5

(QFHQGHUODWRUUHSDUDSRGHUSRQHUHQIXQFLRQDPLHQWRWRGRVORVHOHPHQWRVVLWXDGRV
HQHOSXHVWRGHOWLUDGRU 3DUDHOORGHEHDUUDQFDUHO9&,RDX[LOLDUVHGHXQ(9,7521
SDUDHYLWDUFRQVXPRH[FHVLYRGHEDWHUtDV 
5HFRQRFHUi ORFDOL]DUi \ PDQHMDUi VLQ WLWXEHRV OD 8QLGDG 9LVXDO /iVHU 89/ 
H[SOLFDQGRVXIXQFLRQDPLHQWRHQDPERVPRGRV
5HFRQRFHUi ORFDOL]DUi \ PDQHMDUi VLQ WLWXEHRV OD &iPDUD 7pUPLFD \ HO 3DQHO GH
&RQWUROGH0RQLWRUHV
5HFRQRFHUiORFDOL]DUi\PDQHMDUiVLQWLWXEHRVOD8QLGDGGH&RQWURO3ULQFLSDO 8&3 
5HFRQRFHUi ORFDOL]DUi \ H[SOLFDUi HO PDQHMR VLQ WLWXEHRV GHO 0DQGR(PSXxDGXUD
'HO7LUDGRU
5HFRQRFHUiORFDOL]DUi\PDQHMDUiVLQWLWXEHRVHO3DQHOGH&RQWURO3ULQFLSDO
5HFRQRFHUi ORFDOL]DUi \ PDQHMDUi VLQ WLWXEHRV HO 3DQHO GH &RQWURO GH DUPDV GHO
7LUDGRU


6,78$&,Ï1),1$/

'HEHQHQFRQWUDUVHHQFHQGLGDODWRUUHOD&iPDUD7pUPLFD\OD8&3


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

'HEHQ DSDJDUVH OD 8&3 HO 3DQHO GH &RQWURO GH 0RQLWRUHV \ OD WRUUH (O YHKtFXOR
GHEHDSDJDUVHVLHVWDEDDUUDQFDGR
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï138(67$(10$5&+$'(/$7255(

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFDV $XOD 7HRUtDPLQXWRV
9HKtFXOR 3UiFWLFDPLQXWRVSRU7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

&RORFDUXQYHKtFXORSRUFDGDWULSXODQWHVFRPRPi[LPRHQXQOXJDUDSURSLDGRSDUD
SRGHUPRYHUOLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVXPRYLPLHQWR
(OWULSXODQWHVHFRORFDUiHQHOSXHVWRGHO7LUDGRU\HOLQVWUXFWRUHQHOSXHVWRGHO-HIH
GH9HKtFXORSDUDSRQHUHQIXQFLRQDPLHQWRODWRUUH

5(48,6,726$$/&$1=$5

4XHHOWULSXODQWHVHDFDSD]GHSRQHUHQIXQFLRQDPLHQWRODWRUUHVLJXLHQGRXQRUGHQ
DGHFXDGR HQ ORV GLVWLQWRV SDVRV \ KDFHU IUHQWH D ODV SRVLEOHV LQFLGHQFLDV TXH VH
SUHVHQWHQGXUDQWHVXIXQFLRQDPLHQWR

6HFRQVLGHUDUDTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

6LVRODPHQWHVHYDQDUHDOL]DUHQODWRUUHRSHUDFLRQHVTXHQRVXSRQJDQXQFRQVXPR
HOpFWULFR LPSRUWDQWH EDVWDUi FRQ FRORFDU HQ HO SDQHO GH FRQWURO GHO FRQGXFWRU
,17(5583725 35,1&,3$/ '( %$7(5Ë$6 HQ SRVLFLyQ  VLHQGR FRQYHQLHQWH
WDPELpQFRQHFWDUHOLQWHUUXSWRU$55$148(%$7(5Ë$6

(O VLVWHPD SHUPLWH HO JLUR GH OD WRUUH HQ ORV ž \ HQ HOHYDFLyQ GHO FDxyQ \ GH OD
DPHWUDOODGRUDFRD[LDOHQWUH±ž\žHQPDQXDO

38(67$(1)81&,21$0,(172'(/$7255(



(QWHQGHPRVSRU³SXHVWDHQVHUYLFLR´SRQHUODWRUUHHQFRQGLFLRQHVGHVHUXWLOL]DGD
SDUD HOOR OR SULPHUR HV SURSRUFLRQDU DOLPHQWDFLyQ HOpFWULFD D WRGRV ORV VLVWHPDV
SULQFLSDOHV
/D DOLPHQWDFLyQ GH OD WRUUH HV SURSRUFLRQDGD SRU HO VLVWHPD HOpFWULFR JHQHUDO GHO
YHKtFXORTXHDWUDYpVGHODQLOORFROHFWRUDOLPHQWDHOVLVWHPDHOpFWULFRHVSHFtILFRGH
ODWRUUH
3DUDHOORHQODFDMDGHGLV\XQWRUHVJHQHUDOGHODFiPDUDGHFRQGXFFLyQKDQGHHVWDU
DFWLYDGRV HO GLV\XQWRU JHQHUDO GHO YHKtFXOR \ HO GLV\XQWRU SULQFLSDO GH OD WRUUH &RQ
HOOR ODV GRV EDWHUtDV GH VHUYLFLR GHO YHKtFXOR SURSRUFLRQDQ DOLPHQWDFLyQ SDUD
VLVWHPDVGHEDMRFRQVXPR

D2SHUDFLRQHVSUHYLDV

  &RORFDUHOLQWHUUXSWRU,1735,1%$7(5Ë$6HQVXSRVLFLyQVLVRODPHQWHVH
YDQDUHDOL]DURSHUDFLRQHVGHEDMRFRQVXPR
  &RPSUREDU TXH ORV FLQFR GLV\XQWRUHV GH OD FDMD GH GLVWULEXFLyQ GH SRWHQFLD
HVWiQDFWLYDGRV


35(&$8&,Ï1
3RQHUHQPDUFKDHOPRWRURFRQHFWDUDXQDIXHQWHGHDOLPHQWDFLyQH[WHUQDHQ
FDVR GH WHQHU TXH HIHFWXDU PRYLPLHQWRV GH WRUUHFDxyQ FRQ ORV VHUYRV X
RSHUDFLRQHV GH DUPDGR GHO FDxyQ 38('(1 $*27$56( 5È3,'$0(17( /$6
%$7(5Ë$6

3DUDXQXVRQRUPDOGHODWRUUHGHEHQREVHUYDUVHODVVLJXLHQWHVLQVWUXFFLRQHV
 3RQHUHQPDUFKDHOPRWRUGHOYHKtFXOR
 /DWULSXODFLyQGHEHUiRFXSDUVXVSXHVWRV\FHUUDUODVSXHUWDVFRUUHGHUDVGHOD
SURWHFFLyQGHODWRUUH
 /DV WULQFDV GH EORTXHR GH JLUR GH OD WRUUH \ GH HOHYDFLyQ GHO FDxyQ VH
VROWDUiQ
 &RPSUREDU TXH HO SXOVDGRU GH RVFXUHFLPLHQWR '(6&21 /8&(6 HVWi
GHVFRQHFWDGR 6L HVWXYLHUD FRQHFWDGR QR VH HQFHQGHUi QLQJ~Q LQGLFDGRU
GXUDQWHODDXWRFRPSUREDFLyQSUHYLDDOFRQHFWDUODWRUUH\GDUiODLPSUHVLyQGH
TXHIDOWDWHQVLyQ
8QD YH] HIHFWXDGR OR DQWHULRU \ VREUH HO SDQHO SULQFLSDO SRQHU HQ 21 HO LQWHUUXSWRU
JHQHUDO7255(212)) )LJ 





)LJXUD3DQHOGH&RQWURO3ULQFLSDOGHODWRUUH
(QHVHPRPHQWR\VXSRQLHQGRXQLQLFLRFRUUHFWRVHSURGXFLUi
 $UUDQFDHO%,7(\VHLQLFLDHODXWRWHVW
 6HUHDOL]DXQWHVWGHOiPSDUDVGXUDQWHVHJXQGRV
 6HLOXPLQDODSDQWDOODGHLQIRUPDFLyQ YHUDSDUWDGRVLJXLHQWH \WUDQVFXUULGRV
VHJXQGRVVHSUHVHQWDHOPHQVDMH,1,&,2&255(&72 GXUDQWHVHJ 
 (OVLVWHPDDGRSWDODFRQILJXUDFLyQLQLFLDO
o $UPDVHOHFFLRQDGD$PHWUDOODGRUD0*
o 0RGRGHGLVSDUR5iIDJDVGHGLVSDURV
o 6HUYRV2))
o (VWDELOL]DFLyQ2))
o '$/6HPXHYHDODSRVLFLyQFHQWUDOVLHOFLHUUHHVWiDWUiV DUPDGR 
'HSHQGLHQGRGHODVLWXDFLyQSUHYLDGHODUPDVHLOXPLQDUiQ
 (QOD3DQHOGH&RQWURO3ULQFLSDO
o =21$,17(5',5(&6LHOFDxyQHVWiHQWUHODV\ODVRHQWUH\

o (6&27$%,(576LHVWiDELHUWDDOJXQDHVFRWLOOD
 (QORV3DQHOHVGH&RQWUROGHDUPDVGHO-9\7LUDGRUORVLQGLFDGRUHV
o 6(*85
o 0*
o ),1&,17$ 6LHOFDUJDGRUGHODDPHWUDOODGRUDHVWiYDFtR 
 (QODVSDQWDOODVGHLQIRUPDFLyQGHORV3DQHOHVGH&RQWUROGHDUPDV
o &,(55($75$66LHOFLHUUHGHOFDxyQHVWiHQHVDSRVLFLyQ
o 326,1&$/,06LHO'$/QRHVWiFHQWUDGR
o 0*5$)
/DWRUUHDKRUDHVWiSUHSDUDGDSDUDODDFWLYDFLyQGHWRGRVORVVLVWHPDV

E&RPSRQHQWHVTXHLQWHUYLHQHQHQHOPRYLPLHQWRHOpFWULFRGHODWRUUH


(O VLVWHPD GH DFFLRQDPLHQWR \ HVWDELOL]DFLyQ GH WRUUHFDxyQ HV HO HQFDUJDGR GHO
PRYLPLHQWR HQ DFLPXW GH OD WRUUH \ GH HOHYDFLyQ GHO FDxyQ DVt FRPR GH VX
HVWDELOL]DFLyQHQGRVHMHVSDUDHOWLURREVHUYDFLyQ
(O VLVWHPD SHUPLWH HO JLUR GH OD WRUUH HQ ƒ \ OD HOHYDFLyQ GHO FDxyQ \ GH OD
DPHWUDOODGRUDFRD[LDOHQWUH±ž\ƒ
8Q VLVWHPD GH SURWHFFLyQ HOHYD HO FDxyQ DXWRPiWLFDPHQWH HYLWDQGR JROSHDU HO
FDVFRFXDQGRVHPXHYHFRQXQiQJXORGHGHSUHVLyQ\VHHQFXHQWUDHQWUHOD\ODV



3RUUD]RQHVGHVHJXULGDGHOVLVWHPDGHJLURGHWRUUHQRSXHGHVHURSHUDGRFRQODV
HVFRWLOODV DELHUWDV VDOYR TXH VH DFW~H EDMR OD UHVSRQVDELOLGDG GHO -9  VREUH HO
LQWHUUXSWRU GH DQXODFLyQ GH HVFRWLOODV DELHUWDV $18/$5 6(* (6&7 VLWXDGR HQ OD
3DQHOGH&RQWURO3ULQFLSDO/DVFDUDFWHUtVWLFDVWpFQLFDVGHOVLVWHPDVHH[SRQHQHQHO
0DQXDO7pFQLFRFRUUHVSRQGLHQWHDOYHKtFXOR

6XVFRPSRQHQWHVVRQ
 8QLGDGGHSRWHQFLDGHOVHUYRPRWRUGHHOHYDFLyQ
 8QLGDGGHSRWHQFLDGHOVHUYRPRWRUGHGLUHFFLyQ
 8QLGDGGHFRQWUROJHQHUDOGHHMHV$;&21
 &RQMXQWRGHDFFLRQDPLHQWRHQHOHYDFLyQ
 &RQMXQWRGHDFFLRQDPLHQWRHQDFLPXW
 *LUyVFRSRGHGRVHMHV
 0DQGRVGHFRQWUROGHO-9\GHO7LUDGRU
 7ULQFDVGHEORTXHR

E  81,'$'(6'(327(1&,$<&21752/'((-(6




)LJXUD8QLGDGHVGHSRWHQFLD\FRQWUROGHHMHV

1ž '(120,1$&,Ï1 )81&,Ï1
 8QLGDGGHSRWHQFLDGHO &RQWURODUHOVHUYRPRWRUHQHOHYDFLyQ
VHUYRPRWRUGHHOHYDFLyQ
 8QLGDGGHFRQWUROJHQHUDOGHHMHV 5HFLEHODVVHxDOHVGHOJLUyVFRSRFRRUGLQD
$;&21 ODVXQLGDGHVGHFRQWUROHQHOHYDFLyQ\HQ
GLUHFFLyQ\ODFRPXQLFDFLyQFRQOD8QLGDG
(OHFWUyQLFDGH&RQWUROGHWRUUH


 8QLGDGGHSRWHQFLDGHO &RQWURODUHOVHUYRPRWRUHQGLUHFFLyQ
VHUYRPRWRUGHGLUHFFLyQ

E  &21-8172'($&&,21$0,(172(1$&,087

(V HO HQFDUJDGR GH JLUDU OD WRUUH SDUD HIHFWXDU OD SXQWHUtD GHO FDxyQ HQ DFLPXW
&RQVWDGH
 6LVWHPDGHDFFLRQDPLHQWRHOpFWULFRPHGLDQWHXQVHUYRPRWRUGHDOWDSUHFLVLyQ
(OPRWRUHVFRQWURODGRSRUODVVHxDOHVUHFLELGDVGHORVPDQGRVGHFRQWURORHO
JLUyVFRSRFXDQGRVHDFWLYDODHVWDELOL]DFLyQ
 6LVWHPDGHDFFLRQDPLHQWRPDQXDOPHGLDQWHPDQLYHOD\HMHVPHFiQLFRV
 7UHQGHHQJUDQDMHV




)LJXUD&RQMXQWRGHDFFLRQDPLHQWRHQDFLPXW

 6HUYRPRWRU  0DQLYHODPDQGRPDQXDO
 $FRSODPLHQWRGHODFFLRQDPLHQWR  %UD]RDEDWLEOH
PDQXDO  7UHQGHHQJUDQDMHV
 0HFDQLVPRDQWLUHWRUQR  &RURQDGHODWRUUH
 (PEUDJXH
 (MHGHWUDQVPLVLyQGHOD
PDQLYHOD

E  &21-8172'($&&,21$0,(172(1(/(9$&,Ï1

(VHOHQFDUJDGRGH PRYHUHOFDxyQ SDUD HIHFWXDUODSXQWHUtDHQ HOHYDFLyQ&RQVWD
GH



 6LVWHPDGHDFFLRQDPLHQWRHOpFWULFRPHGLDQWHXQVHUYRPRWRUGHDOWDSUHFLVLyQ
(OPRWRUHVFRQWURODGRSRUODVVHxDOHVUHFLELGDVGHORVPDQGRVGHFRQWURORHO
JLUyVFRSRFXDQGRVHDFWLYDODHVWDELOL]DFLyQ
 6LVWHPDGHDFFLRQDPLHQWRPDQXDOPHGLDQWHPDQLYHOD\HMHVPHFiQLFRV
 7UHQGHHQJUDQDMHV
 (TXLOLEUDGRU




)LJXUD&RQMXQWRGHDFFLRQDPLHQWRHQDFLPXW

 &LOLQGURGHHOHYDFLyQ  7UHQGHHQJUDQDMHV
 (TXLOLEUDGRU  (PEUDJXH
 0DQLYHODPDQGRPDQXDO  0HFDQLVPRDQWLUHWRUQR
 6HUYRPRWRU  (MHGHWUDQVPLVLyQGHODPDQLYHOD

E  0$1'26'(&21752/'(029,0,(172

([LVWHQ GRV PDQGRV GH FRQWURO GH PRYLPLHQWR XQR SDUD HO -9 VH GHVFULEH HQ OD
ILFKD   \ RWUR SDUD HO WLUDGRU TXH VH GHVFULEH HQ OD ILFKD  
TXHVRQORVHQFDUJDGRVGHWUDQVPLWLUODVyUGHQHVGH JLURR HOHYDFLyQ DORVVHUYRV
7DPELpQLQFOX\HQORVGLVSDUDGRUHVGHODVDUPDV\OiVHU6XVLWXDFLyQVHPXHVWUDHQ
ODILFKDGHHVWHPDQXDO

E  *,5Ï6&232'('26(-(6

(V HO HOHPHQWR TXH MXQWR FRQ OD 8QLGDG $;&21  SHUPLWH HVWDELOL]DU OD WRUUH \ HO
FDxyQ6XVLWXDFLyQVHPXHVWUDHQODILFKDGHHVWHPDQXDO





)LJXUD*LUyVFRSRGHGRVHMHV


E  75,1&$6'(%/248(2'(029,0,(172


35(&$8&,Ï1
$QWHV HIHFWXDU JLURV HQ HOpFWULFR GH OD WRUUH FRPSUREDU TXH HVWD WULQFD HVWi
GHVHQFODYDGDSDUDHYLWDUGDxRVJUDYHVHQODPLVPD

x %ORTXHRGHODWRUUH

(OPRYLPLHQWRGHJLURGHODWRUUHVHEORTXHDPHGLDQWHXQDWULQFDVLWXDGDGHWUiV\D
ODL]TXLHUGDGHO-9GHODQWHGHOHTXLSRGHFRPXQLFDFLRQHV )LJQž TXHDFW~D
PHGLDQWHXQDSDODQFDGHDFFLRQDPLHQWRGLUHFWDPHQWHVREUHODFRURQDGHJLUR
'LFKDSDODQFDWLHQHGRVSRVLFLRQHV
 $DGHODQWHSDUDTXHJLUHOLEUHPHQWH
 %DWUiVSDUDGHMDUODHQFODYDGDHQODVSRVLFLRQHV
o DODVSDUDPDQWHQLPLHQWR\WUDQVSRUWH
o DODVSDUDDEULUHOSRUWyQGHO*03


 35(&$8&,Ï1
(V SRVLEOH FRORFDU ODV WULQFDV HQ SRVLFLyQ GH HQFODYDGR IXHUD GH ODV
SRVLFLRQHV DQWHULRUHV VLQ TXH HOOR VXSRQJD LQPRYLOL]DU OD WRUUH DO QR H[LVWLU
SHVWLOORGHILMDFLyQIXHUDGHHVDVSRVLFLRQHV(QHVWHFDVRVLVHPXHYHODWRUUH
SXHGHQURPSHUVHODVWULQFDV

(OPRYLPLHQWRILQDODQWHVGHSRQHUODWULQFDKDGHVHUVLHPSUHPDQXDO






)LJXUD7ULQFDGHEORTXHRGHODWRUUH

x %ORTXHRGHOFDxyQ

&RQREMHWRGHEORTXHDUHOPRYLPLHQWRHQHOHYDFLyQGHOFDxyQ Dž VHGLVSRQHGH
XQDWULQFDFX\RPDQGRVLWXDGRGHODQWH\DODL]TXLHUGDGHO-9 )LJQž 'LFKR
PDQGRWLHQHGRVSRVLFLRQHV
 ,1HQODYHUWLFDOSDUDWULQFDUHOFDxyQ
 287KDFLDDEDMRSDUDOLEHUDUOR




)LJXUD7ULQFDGHHOHYDFLyQ

3DUDPRYHUHOPDQGRGHXQDDRWUDSRVLFLyQKD\TXHWLUDUGHOSRPRGHOPLVPRSDUD
OLEHUDUORGHVXILMDFLyQ

F&RQH[LyQGHOPRYLPLHQWRHOpFWULFRGHODWRUUH



9pDVH07±2SHUDFLyQGHOVLVWHPD

G0RYLPLHQWRPDQXDOGHODWRUUH

,QGHSHQGLHQWHGHOVLVWHPDGHDFFLRQDPLHQWRHOHFWURPHFiQLFRHVWHYHKtFXORGLVSRQH
GHXQVLVWHPDPHFiQLFRFRQPDQGRVPDQXDOHVSDUDJLURGHODWRUUH\HOHYDFLyQGHO
FDxyQ

G  $&&,21$0,(1720(&È1,&2'(*,52'(/$7255(

(OPDQGRPDQXDOGHJLURGHODWRUUHHVWiVLWXDGRDODDOWXUDGHODFRURQDGHJLURGH
ODPLVPDHQWUHORVDVLHQWRVGHO-HIHGH9HKtFXOR\GHO7LUDGRU\IXQFLRQDPHGLDQWH
HO PRYLPLHQWR URWDFLRQDO GH OD PDQLYHOD )LJ  Qž  HQ XQR R HQ RWUR VHQWLGR
GHSHQGLHQGRGHSDUDGRQGHVHTXLHUDTXHJLUHODWRUUH6XPDQLYHOD )LJQž 
HV DEDWLEOH ILMiQGRVH SDUD VX XVR HQ SRVLFLyQ KRUL]RQWDO PHGLDQWH XQ SHVWLOOR GH
ILMDFLyQTXHWLHQHDWDOHIHFWR7DPELpQHVDEDWLEOHƒHOEUD]RFRPSOHWRDOUHGHGRU
GHOHMHGHJLUROLEHUiQGRORPHGLDQWHXQSHVWLOORTXHWLHQHDVXL]TXLHUGDGHPRGR
TXH GLFKR EUD]R TXHGH KRUL]RQWDO $O ILQDOL]DU VX XWLOL]DFLyQ VH YROYHUi D SRQHU HO
EUD]RHQYHUWLFDO\WLUDQGRGHODPDQLYHODKDFLDHOH[WHULRUVHDEDWLUipVWDWDPELpQ

G  $&&,21$0,(1720(&È1,&2'((/(9$&,Ï1'(/&$fÏ1

(OPDQGRPDQXDOGHHOHYDFLyQGHOFDxyQ )LJQž HVWiVLWXDGRGHODQWH\DOD
GHUHFKDGHODVLHQWRGHO7LUDGRUDODGHUHFKD\GHEDMRGHOPDQGRFRUUHVSRQGLHQWHD
OD'76XHPSXxDGXUDWDPELpQHVDEDWLEOH FRQHOPLVPRVLVWHPDGHOPDQGRGHJLUR
GHODWRUUH \XQDYH]HQSRVLFLyQKRUL]RQWDOJLUDQGRDGHUHFKDVVHDEDWLUiHOFDxyQ
\DL]TXLHUGDVVHHOHYDUi


5(680(1

(QHVWDILFKDVHGHVFULEHQODVDFFLRQHV\SDVRVDUHDOL]DUSDUDODSXHVWDHQPDUFKD
GHODWRUUHQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVH
OD WRUUH OLEUHPHQWH \ FRQ URWDWLYR SXHVWR (O 9&, GHEH HQFRQWUDUVH FRQ PRWRU
DSDJDGRDXQTXHSDUDHVWDVRSHUDFLRQHVVHSRGUiRUGHQDUTXHVHDUUDQTXHRTXHVH
HQFKXIHXQDIXHQWHGHDOLPHQWDFLyQH[WHUQD (9,7521 &DGDHYDOXDGRVXELUiDXQ
9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

&RPSUREDUDODVHJXULGDGGHODWULSXODFLyQ\ODVHVFRWLOODVFHORVtDV
6HRUGHQDDUUDQFDUHO9&,VLSURFHGH
6HSRQGUiVLJXLHQGRHOSURFHGLPLHQWRHQIXQFLRQDPLHQWRODWRUUH




6,78$&,Ï1),1$/

/D WRUUH GHO 9&, FRQ ORV 6(5926 \ (67$%,/,=$&,Ï1 GHEHQ HVWDU FRQHFWDGRV \
pVWDGHEHPRYHUVHHQHOpFWULFRDWUDYpVGHORVPDQGRVGHO-9R7LU


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

'HEHQDSDJDUVHOD(67$%,/,=$&,Ï1\6(5926\SRVWHULRUPHQWHOD7RUUHGHMDQGR
HO6HJXURGHDQXODFLyQGHHVFRWLOODVGHVDFWLYDGR\ODVWULQFDVSXHVWDV
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1&$fÏ10.

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRV
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/DFODVHWHyULFDVHUHDOL]DUiHQHODXOD\ODFODVHSUiFWLFDVHUHDOL]DUDHQHOKDQJDU
HVFDOyQ FRQ XQ FDxyQ GHVPRQWDGR VREUH XQD PHVD /D FODVH WHyULFD \ SUiFWLFD VH
UHDOL]DUiSRUHOHTXLSRGHPDQWHQLPLHQWRGHDUPDPHQWR

5(48,6,726$$/&$1=$5

(O WULSXODQWH GHEH VDEHU ORFDOL]DU ORV HOHPHQWRV SULQFLSDOHV GHO FDxyQ \ VDEHU HO
IXQFLRQDPLHQWREiVLFRGHOPLVPR

6HFRQVLGHUDUDTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

D $UPDPHQWRGHO9&,

/DWRUUHHVWiHTXLSDGDFRQHOVLJXLHQWHDUPDPHQWRTXHSRUVXXELFDFLyQ SRGHPRV
GLYLGLUORHQ

$UPDPHQWRLQWHUQR
x 8QFDxyQDXWRPiWLFR  0$86(50.GHPP[
x 8QDDPHWUDOODGRUD  0*6GHPPFRD[LDOFRQHOFDxyQ

$UPDPHQWR H[WHUQR &XDWUR EDWHUtDV WULSOHV GH ODQ]DLQJHQLRV   DJUXSDGDV HQ GRV
JUXSRVGHVHLVXQRDFDGDEDQGDGHODWRUUH



E &RQMXQWRDUPDPHQWRLQWHUQRPDVDRVFLODQWH

(O FDxyQ \ OD DPHWUDOODGRUD FRD[LDO YDQ PRQWDGRV VREUH OD ³PDVD RVFLODQWH´ TXH
VLUYH GH VRSRUWH WDQWR DO DUPDPHQWR FRPR D ORV VLVWHPDV SHULIpULFRV \ GLVWLQWDV
LQWHUIDVHV


0$6$26&,/$17(

(VWiFRPSXHVWDSRUORVVLJXLHQWHVHOHPHQWRVSULQFLSDOHV )LJ 
 7XERVRSRUWHGHOWXERGHOFDxyQ  (MHUFHODIXQFLyQGHVRSRUWHGHODQWHUR
\SURWHFFLyQGHOWXER
 7DPERU   (MHUFH OD IXQFLyQ GH LQWHUIDVH SULQFLSDO HQWUH HO FRQMXQWR
DUPDPHQWR LQWHUQRPDVD RVFLODQWH \ OD HVWUXFWXUD GH OD WRUUH SHUPLWLHQGR HO
PRYLPLHQWR HQ HOHYDFLyQ GH WRGR HO FRQMXQWR ,QFRUSRUD FRPR HOHPHQWRV
SULQFLSDOHV
o (OHVFXGR
o /RVDORMDPLHQWRVGHORVHMHVGHPXxRQHV  
o 0DQJXLWRJXtDGHODDPHWUDOODGRUDFRD[LDO  
 /D FXQD   6LUYH GH VRSRUWH DO FDxyQ \ VLVWHPDV SHULIpULFRV DVt FRPR DO
DIXVWHGHODDPHWUDOODGRUDFRD[LDO(QWUHORVSULPHURVFDEHGHVWDFDU
o 0HFDQLVPR GH GHVSOD]DPLHQWR GHO GREOH DOLPHQWDGRU TXH SHUPLWH OD
DOLPHQWDFLyQGHOFDxyQSRUDPERVODGRV
o 0HFDQLVPRGHDUPDGRGHOFLHUUH
o $FFLRQDPLHQWRGHOPHFDQLVPRGHGLVSDUR
o 6HQVRUHV
o 0HFDQLVPRGHLQWHUUXSFLyQGHOIXHJR




)LJXUD&RQMXQWRPDVDRVFLODQWH



&$fÏ10.'(6&5,3&,Ï1*(1(5$/

(O FDxyQ 0$86(5 0.   PP [   HV XQ DUPD GH JUDQ SUHFLVLyQ \ DOWD
FDGHQFLDGHIXHJR6XDOFDQFHHIHFWLYR\VXSUHFLVLyQSHUPLWHQEDWLUREMHWLYRVIXHUD



GHO DOFDQFH GH IXVLOHV DPHWUDOODGRUDV \ FDxRQHV GH PHQRU FDOLEUH VLHQGR
HVSHFLDOPHQWHDSWRSDUDEDWLU
x 9HKtFXORVDFRUD]DGRVOLJHURVSRUHQFLPDGHORVP
x $HURQDYHV\KHOLFySWHURVGHDWDTXHSRUHQFLPDGHORVP




)LJXUD&RQMXQWRFDxyQ

(VXQDUPDDXWRPiWLFDSRUWRPDGHJDVHVTXHDFFLRQDQ
x (OGHVEORTXHR\UHWURFHVRGHOFLHUUH\ODH[WUDFFLyQ\H[SXOVLyQGHODYDLQD
x (OPHFDQLVPRGHDOLPHQWDFLyQ 'REOHDOLPHQWDGRU 

(O FDxyQ GLVSRQH GH XQ GREOH DOLPHQWDGRU TXH SHUPLWH VX DOLPHQWDFLyQ SRU OD
L]TXLHUGD R SRU OD GHUHFKD OR TXH SHUPLWH XWLOL]DU GRV WLSRV GLVWLQWRV GH PXQLFLyQ
HQFLQWDGD

/DVHFXHQFLDGHGLVSDURVHLQLFLDFRQHOFLHUUHHQSRVLFLyQUHWUDVDGDUHWHQLGRSRUHO
PHFDQLVPR GH GLVSDUR ORV PXHOOHV UHFXSHUDGRUHV FRPSULPLGRV \ XQ FDUWXFKR HQ
SRVLFLyQ GH VHU DUUDVWUDGR SRU HO FLHUUH $FFLRQDGR HO GLVSDUDGRU \ OLEUH HO FLHUUH
DUUDVWUDHOFDUWXFKRLQWURGXFLpQGRORHQODUHFiPDUDEORTXHiQGRVH\SURGXFLpQGRVH
ODSHUFXVLyQ\GLVSDURGHOFDUWXFKR


(/(0(172635,1&,3$/(6'(/&$fÏ1

(OFDxyQ0.HVWiFRQVWLWXLGRSRUORVVLJXLHQWHVFRPSRQHQWHVSULQFLSDOHV





)LJXUD&RPSRQHQWHVSULQFLSDOHVGHOFDxyQ

1ž '(120,1$&,Ï1 )81&,Ï1
 78%2 
 0(&$1,602'()5(12 $EVRUEHODHQHUJtDGHOUHWURFHVRGHODUPD\
5(&83(5$'25 PDQWHQHUODHQSRVLFLyQGHGLVSDUR(VWi
DFRSODGRDOFDMyQGHPHFDQLVPRV\DODFXQD
6HWUDWDGHXQPHFDQLVPRGHDFFLRQDPLHQWR
KLGUiXOLFR
 '2%/($/,0(17$'25 $OLPHQWDHODUPDGHOFDUJDGRUGHUHFKRRGHO
'$/  FDUJDGRUL]TXLHUGR(VWiDFFLRQDGRSRUORVJDVHV
GHOGLVSDUR
 &$-Ï1'( )LMDHOWXER\JXtDHOFLHUUHHQVXVPRYLPLHQWRV
0(&$1,6026 DORMDQGRORVPHFDQLVPRVGHUHFXSHUDFLyQGHO
FLHUUH\H[SXOVLyQGHODYDLQD6REUHpOVH
DFRSODQHOGREOHDOLPHQWDGRUHOVLVWHPDGH
DUPDGRGHOFLHUUHHOPHFDQLVPRGHGLVSDUR\HO
PHFDQLVPRGHIUHQR\UHFXSHUDFLyQ(VWi
PRQWDGRVREUHODFXQD


(/78%2 )LJ 

(QpOFDEHVHxDODU
 ,QWHULRUPHQWHWLHQHXQUD\DGRSURJUHVLYRGH[WURUVXP



 3RUVXSDUWHSRVWHULRUWLHQHXQHVWULDGRGLVFRQWLQXR WLSRED\RQHWD   SDUDVX
VXMHFLyQDOFDMyQGHPHFDQLVPRV\XQUHEDMHPHFDQL]DGRSDUDHOH[WUDFWRU
 (QVXSDUWHGHODQWHUDGLVSRQHGHXQIUHQRGHERFD  
 (QODSDUWHFHQWUDOHOPDQJXLWRJXtD  
'LVSRQH GH WUHV VDOLGDV GH JDVHV SDUD DFFLRQDU HO DOLPHQWDGRU \ GHVEORTXHDU HO
FLHUUH/DVDOLGDGHOJDVHVUHJXODGDSRUWREHUDV \ GHGLIHUHQWHPHGLGDSDUD
HYLWDUFRQIXVLRQHV



)LJXUD&RPSRQHQWHVGHOWXER

 &RQMXQWRWXER  3DVDGRU 7REHUDWRPDGHJDVHVDOLPHQWDGRU
 (VWULDGRHQ HOiVWLFR 7REHUDWRPDGHJDVHVGHOFLHUUH [
ED\RQHWD  0DQJXLWRJXtD  
 =RQDFLOtQGULFD  7XER 3DVDGRUHOiVWLFR
 3DVDGRUGH  7XHUFD [  )UHQRGHERFD
DMXVWH

3DUD VX PRQWDMH HQ HO FDMyQ GH PHFDQLVPRV HO WXER WLHQH JUDEDGD XQD IOHFKD
GHODQWHGHOD]RQDGHPRQWDMHGHOPDQJXLWRJXtD  \SDUDVXGHVPRQWDMHH[LVWHQ
GRV RULILFLRV GHODQWH GHO DVLHQWR GHO PDQJXLWR JXtD SDUD OD LQVHUFLyQ GH OD OODYH GH
JDQFKRDUWLFXODGD YHUORWHGHDERUGR RSDUDXQDOODYHGHWHWRQHV  


127$
/RVWXERVFDxyQFRQQžGHVHULHPD\RUTXHLQFRUSRUDQXQ  VRORSDVDGRUGH
DMXVWH )LJQž \XQ  VRORSDVDGRUHOiVWLFR )LJQž 

D&DMyQGHORVPHFDQLVPRV )LJV\ 

(V GH DFHUR IRUMDGR \ FRQVWLWX\H HO FRQMXQWR LQWHJUDGRU \ VRSRUWH GH WRGRV ORV
VXEVLVWHPDVTXHFRQIRUPDQHOFDxyQ


/RVHOHPHQWRVGHJXLDGR  VLUYHQGHVRSRUWH\JXtDGHOFDxyQVREUHODFXQD
(OFDMyQGHPHFDQLVPRVVHXQHDOIUHQRUHFXSHUDGRUPHGLDQWHXQEXOyQFRQILDGRU
GHERODLQWURGXFLGRHQHOVRSRUWHGHOIUHQRUHFXSHUDGRU  



)LJXUD&DMyQGHORVPHFDQLVPRV  &RQMXQWR

 &RQMXQWRFDMyQGHPHFDQLVPRV  &XHUSRGHOFDMyQGHPHFDQLVPRV
 &LHUUH  3LVWyQDFFLRQDPLHQWRSRUJDVGHO
 0HFDQLVPRVGHUHFXSHUDFLyQGHO '$/
FLHUUH  3LVWyQGHJDVGHOFLHUUH [ 
 $PRUWLJXDGRUGHOPHFDQLVPRGH 3LVWyQRSXHVWR [ 
GLVSDUR 3DVDGRUHOiVWLFR [ 
 7DSDGHOPHFDQLVPRGHGLVSDUR *XtDVODWHUDOHV DDPERVODGRV 
 0HFDQLVPRGHGLVSDUR 3DVDGRUGHILMDFLyQGHOIUHQR
UHFXSHUDGRU




)LJXUD&DMyQGHORVPHFDQLVPRV  &XHUSR

2ULILFLRDORMDPLHQWRWXER $ORMDPLHQWRSHVWLOORVEORTXHRFLHUUH
3HVWLOORGHEORTXHRGHOWXER 3HUQROLEHUDFLyQH[WUDFWRU
6HJXURVPHFiQLFRV 6RSRUWHVXMHFLyQIUHQRUHFXSHUDGRU
5DQXUDVJXtDGHOFLHUUH )LDGRUHVGHEORTXHR
$PRUWLJXDGRUGHOH[SXOVRU 3LVWRQHVRSXHVWRV

(Q VX SDUWH GHODQWHUD SRVHH XQ RULILFLR FHQWUDO FRQ HVWUtDV PHFDQL]DGDV WLSR
ED\RQHWD   SDUDDORMDU\VXMHWDUHOWXER(OSHVWLOORGHEORTXHR  TXHDVHJXUD
HOWXERHQVXSRVLFLyQHVWiVLWXDGRHQXQUHEDMHUHDOL]DGRHQODSDUWHVXSHULRU/RV
GRV SLVWRQHV GH JDV   GHO DOLPHQWDGRU FRQ SLVWRQHV RSXHVWRV   SDUD
GHVEORTXHDU HO FLHUUH HVWiQ VLWXDGRV GHQWUR GH GRV WDODGURV D DPERV ODGRV GHO
RULILFLRFHQWUDOGHPRQWDMHGHOWXER
6LWXDGR GHEDMR GHO FDMyQ GH PHFDQLVPRV H[LVWH XQ VRSRUWH DKRUTXLOODGR   SDUD
VXMHFLyQGHOFRQMXQWRGHOIUHQRUHFXSHUDGRU\XQSHUQRGHSUHVLyQ  SDUDOLEHUDUHO
H[WUDFWRU
8QDV UDQXUDV PHFDQL]DGDV   HQ HO LQWHULRU GHO FDMyQ GH PHFDQLVPRV VLUYHQ GH
JXtDSDUDHOGHVOL]DPLHQWRGHOFLHUUH(QHOH[WUHPRDQWHULRUGHGLFKDVJXtDVH[LVWHQ
GRVUHEDMHV  SDUDHODORMDPLHQWRGHORVSHVWLOORVGHEORTXHRGHOFLHUUH
$GHPiVGLVSRQHGHGRVVHJXURV YHUGHWDOOHHQOD)LJ \GHGRVILDGRUHV
GHEORTXHR  ORFDOL]DGRVHQORVODGRVGHUHFKRHL]TXLHUGRGHOFDMyQ
(Q OD SDUWH SRVWHULRU GHO FDMyQ HVWi DORMDGR HO DPRUWLJXDGRU GHO H[SXOVRU   TXH
VLUYHGHVRSRUWH\JXtDDORVGLVFRVGHPXHOOHTXHIRUPDQHODPRUWLJXDGRUGHOFLHUUH
$L]TXLHUGD\GHUHFKDGHQWURGHOFDMyQGHPHFDQLVPRVKD\GRVILDGRUHVGHEORTXHR
 \GRVUHWHQHVTXHDVHJXUDQODKHUPHWLFLGDG
(VWRVUHWHQHVSXHGHQDFWXDU VHJ~QPRGHOR FRPRVHJXURVPHFiQLFRVGLVSRQLHQGR
GHGRVSRVLFLRQHV
 $UPDGRXQDPDUFDHQODGLUHFFLyQGHWLUR )LJ$ 
 6HJXURGRVPDUFDVWUDQVYHUVDODODGLUHFFLyQGHWLUR )LJ% 





)LJXUD6HJXURVPHFiQLFRV



35(&$8&,Ï1
'HVSXpV GH OD LQVWDODFLyQ GHO FDMyQ GH PHFDQLVPRV QR VH WLHQH DFFHVR D
HVWRV VHJXURV 3RU OR WDQWR DQWHV GH OD LQVWDODFLyQ GHO FDMyQ GH ORV
PHFDQLVPRV KDEUi TXH FRORFDU GLFKRV VHJXURV HQ OD SRVLFLyQ GH GLVSDUR R
DUPDGR $ 


E0HFDQLVPRGHUHFXSHUDFLyQGHOFLHUUH )LJ 

/DV GRV XQLGDGHV TXH FRPSRQHQ GLFKR PHFDQLVPR YDQ PRQWDGDV HQ VHQGRV
RULILFLRVVLWXDGRVHQORVODWHUDOHVGHOFDMyQGHPHFDQLVPRVDOLQHDGRVFRQODJXtDGH
GHVSOD]DPLHQWR GHO FLHUUH $PEDV XQLGDGHV VH DFRSODQ DO FHUURMR GH EORTXHR GHO
FLHUUHPHGLDQWHODVRUHMHWDVGHDFRSODPLHQWR  \ILMDVDOFDMyQGHPHFDQLVPRVSRU
HOUHWHQHGRU  
7LHQHQSRUPLVLyQ
 'HVEORTXHDUHOFLHUUHGHVSXpVGHOGLVSDUR
 (PSOD]DUDpVWHHQODSRVLFLyQGHUHWHQLGD
 ,PSXOVDUHOFLHUUHKDFLDGHODQWHGHVSXpVGHDFWXDUVREUHHOGLVSDUDGRU






)LJXUD0HFDQLVPRGHUHFXSHUDFLyQGHOFLHUUH

 0HFDQLVPRGH  0XHOOH 7RSHGHOPDQJXLWR
UHFXSHUDFLyQ  &RQMXQWRWXERGHO $VLHQWRGHOPXHOOH
 3DVDGRUHOiVWLFR PXHOOH 0XHOOH
 &DVTXLOORWRSH  3DVDGRUHOiVWLFR 2UHMHWDGHDFRSODPLHQWR
 0DQJXLWRGHOPXHOOH  5HWHQHGRU
 3HVWLOORGHUHWHQLGD 7XERJXtDGHOPXHOOH


'HVSXpV GHO GLVSDUR HO PHFDQLVPR GH UHFXSHUDFLyQ ~QLFDPHQWH GHVEORTXHD HO
FLHUUHODSUHVLyQGHORVJDVHVGHODFDUJDGHSUR\HFFLyQHVVXILFLHQWHSDUDHPSXMDU
HOFLHUUHDODSRVLFLyQPiVUHWUDVDGD
(O FDVTXLOOR WRSH   HVWi DSR\DGR HQ HO IURQWDO GHO FDMyQ GH PHFDQLVPRV (O
PHFDQLVPRTXHGDVXMHWRSRUHOUHWHQHGRU  PLHQWUDVTXHHOSHVWLOOR  LPSLGHHO
PRYLPLHQWRUDGLDOHYLWDQGRDIORMDPLHQWRVQRGHVHDGRV(OUHWHQHGRU  \HOWRSHGHO
PDQJXLWR  HVWiQWRWDOPHQWHURVFDGRVGHQWURGHOWXERJXtDGHOPXHOOH  

F&LHUUH )LJ 

(VWi VLWXDGR HQ ORV DORMDPLHQWRV PHFDQL]DGRV GHO FDMyQ GH PHFDQLVPRV TXH OH
VLUYHQGHJXtDGXUDQWHVXVGHVSOD]DPLHQWRVGHUHWURFHVR\UHFXSHUDFLyQ\WLHQHSRU
PLVLyQ
 ,QWURGXFLUHOFDUWXFKRHQODUHFiPDUD
 2EWXUDUODUHFiPDUD\JXLDUDOSHUFXWRUSURGXFLHQGRHOGLVSDUR
 ([WUDHU\H[SXOVDUODYDLQDGHODUHFiPDUDGHVSXpVGHOGLVSDUR





)LJXUD&LHUUH

 &RQMXQWRFLHUUH  3HUFXWRU ([WUDFWRU
 ([SXOVRU  &HUURMRGHEORTXHR  5DQXUDODWHUDOGH
 3HVWLOORGHEORTXHR  &KDYHWDGHFRQH[LyQ DFRSODPLHQWRGHO
GHUHFKR  3HVWLOORGHEORTXHRL]T PHFDQLVPRUHFXSHUDGRU
 &DEH]DGHOFLHUUH 3DVDGRUHVFLOtQGULFRV  5HVDOWHIURQWDOGH
 3RUWDSHUFXWRU 0XHOOHGHOH[WUDFWRU DUUDVWUHGHOFDUWXFKR


F  )81&,21$0,(172

(O FLHUUH HVWi XQLGR D VX PHFDQLVPR GH UHFXSHUDFLyQ D WUDYpV GH ODV UDQXUDV
ODWHUDOHV   GHO FHUURMR GH EORTXHR   GRQGH VH DFRSODQ ODV RUHMHWDV GH ORV
PDQJXLWRV )LJQž GHORVUHFXSHUDGRUHV
/D FKDYHWD GH FRQH[LyQ   FRQHFWD HO SHUFXWRU   D WUDYpV GHO SRUWDSHUFXWRU  
FRQ HO FHUURMR GH EORTXHR   \ VyOR VH SXHGH GHVPRQWDU FXDQGR HO FHUURMR VH
HQFXHQWUHWRWDOPHQWHGHVSOD]DGRKDFLDGHODQWH
'XUDQWHHOUHFRUULGRGHUHFXSHUDFLyQGHOFLHUUHHOUHVDOWHGHODSDUWHGHODQWHUDGHOD
FDEH]D   HPSXMD DO GLVSDUR HQ SRVLFLyQ GH DOLPHQWDFLyQ IXHUD GHO '$/ \ OR
LQWURGXFH HQ OD UHFiPDUD $O PLVPR WLHPSR HO H[WUDFWRU HQJDQFKD OD UDQXUD GH OD
YDLQD\HOFXORWHGHODPLVPDREOLJDDODSDUWHWUDVHUDGHOH[WUDFWRUDLQWURGXFLUVHHQ
ODFDEH]DGHOFLHUUH  
 %ORTXHR GHO FLHUUH &XDQGR HO FLHUUH   FKRFD FRQWUD HO WXER GHO FDxyQ ORV
GRVSHVWLOORVGHEORTXHR \ VHDEUHQKDFLDIXHUD\HOFHUURMRGHEORTXHR
 SUHVLRQDGRSRUORVPXHOOHVUHFXSHUDGRUHVVHLQWURGXFHHQWUHORVSHVWLOORV
\ HO FLHUUH SUHVLRQDQGR D DTXHOORV FRQWUD HO FDMyQ GH ORV PHFDQLVPRV
SURYRFDQGRDVtHOEORTXHRGHOFLHUUH$VXYH]HOSHUFXWRUHVDUUDVWUDGRSRUOD
FKDYHWD  TXHHVHPSXMDGDSRUHOSRUWDSHUFXWRU  
 'HVEORTXHRGHOFLHUUH&XDQGRHOFHUURMR  HVHPSXMDGRKDFLDDWUiVSRUODV
RUHMHWDVGHDFRSODPLHQWRVHOLEHUDQORVSHVWLOORV \ GHVEORTXHiQGRVHHO


FLHUUH$ODYH]HOSHUFXWRU\HOSRUWDSHUFXWRUVRQDUUDVWUDGRVKDFLDDWUiVSRU
ODFKDYHWDGHFRQH[LyQ
 5HWURFHVR /D SUHVLyQ GH ORV JDVHV HQ HO LQWHULRU GHO WXER HPSXMDQ HO FLHUUH
KDFLD DWUiV &XDQGR HO FLHUUH LPSDFWD FRQWUD HO DPRUWLJXDGRU GHO FLHUUH HO
H[SXOVRU VDOH GH OD FDEH]D GHO FLHUUH FKRFD VREUH OD YDLQD \ OD H[SXOVD GHO
FDxyQ
 5HWHQFLyQGHOFLHUUH$ODYH]TXHHOFLHUUHLPSDFWDFRQWUDVXDPRUWLJXDGRUOD
SDODQFDGHUHWHQLGDGHOFLHUUHEDVFXODGHODQWHGHOFHUURMRGHEORTXHRHLPSLGH
HOPRYLPLHQWRGHOFLHUUHKDFLDGHODQWH

G0HFDQLVPRGHGLVSDUR )LJ 

(O PHFDQLVPR GH GLVSDUR HVWi PRQWDGR HQ OD SDUWH WUDVHUD GHO FDMyQ GH ORV
PHFDQLVPRVGHEDMRGHODJXtDGHGHVOL]DPLHQWRGHOFLHUUH\DFW~D
 /LEHUDQGRHOFLHUUHGHVGHODSRVLFLyQGHUHWHQLGDFXDQGRHVDFWLYDGR
 5HWHQLHQGRHOFLHUUHFXDQGRVHLQWHUUXPSHHOWLUR





)LJXUD0HFDQLVPRGHGLVSDUR


3DUDDEVRUEHUODHQHUJtDGHVDUUROODGDGXUDQWHODUHWHQLGDHOPHFDQLVPRGHGLVSDUR
HVWiXQLGRDOFDMyQGHORVPHFDQLVPRVDWUDYpVGHODPRUWLJXDGRUGHOPHFDQLVPRGH
GLVSDUR

G  )81&,21$0,(172'(/',63$5$'25 )LJ 

(QHOLQWHULRUGHODFDUFDVD  VHHQFXHQWUDQVXMHWRVPHGLDQWHEXORQHVODSDODQFD
GHUHWHQLGDGHOFLHUUH  \HOEDODQFtQ  
/DFRUUHGHUD  HVWiLQVWDODGDMXQWRFRQORVHPSXMDGRUHV  \ORVPXHOOHV  
/DSDODQFDGHGLVSDUR  VHILMDSRUVXHMHHQODFDUFDVD
(OFDO]R  HVWiDSR\DGRHQODSDODQFDGHGLVSDUR  GHQWURGHODFDUFDVD








)LJXUD)XQFLRQDPLHQWRGHOGLVSDUDGRU

 3DODQFDGHUHWHQLGDGHOFLHUUH  &RUUHGHUD
 %DODQFtQ  (PSXMDGRU
 &DUFDVDGHOPHFDQLVPRGHGLVSDUR  0XHOOH
 &DO]R  0XHOOHSDODQFDUHWHQLGD
 3DODQFDGHGLVSDUR

G  326,&,Ï1,1,&,$/ )LJ 



(OFLHUUHHVWiVXMHWRSRUODSDODQFDGHUHWHQLGD  $ODFWXDUVREUHHOGLVSDUDGRUOD
SDODQFD GH GLVSDUR   HV SUHVLRQDGD KDFLD HO LQWHULRU GH OD FDUFDVD   $O PLVPR
WLHPSRHOFDO]R  JLUDKDFLDDEDMR\ODFRUUHGHUD  HVHPSXMDGDKDFLDDWUiVSRU
OD SDODQFD GH GLVSDUR   /D SUHVLyQ GHO FLHUUH \ HO PXHOOH   JLUDQ OD SDODQFD GH
UHWHQLGD  \HOEDODQFtQ  KDFLDHOLQWHULRUGHODFDUFDVD  FRQORTXHHOFLHUUH
TXHGDOLEHUDGR

G  7,52$7,52 )LJ 

(QHVWDPRGDOLGDGHOPHFDQLVPRGHGLVSDURVLWXDGRHQODFXQDDFFLRQDODSDODQFD
GH GLVSDUR   /D FRUUHGHUD   VH PXHYH KDFLD DWUiV \ OD SDODQFD GH UHWHQLGD  
SLYRWD KDFLD DEDMR SUHVLRQDGD SRU HO PXHOOH   OLEHUDQGR DVt HO FLHUUH TXH VH
PXHYHKDFLDGHODQWH$ODYH]HOPHFDQLVPRGHGLVSDURUHWRUQDUiSLGDPHQWHDVX
SRVLFLyQEiVLFD(OFLHUUHHQVXUHWURFHVRSUHVLRQDHOEDODQFtQ  KDFLDDEDMRFRQ
ORFXDOpVWHOHYDQWDODSDODQFDGHUHWHQLGD\DVtODFRUUHGHUDSUHVLRQDGDSRUVXV
PXHOOHV VH GHVSOD]D KDFLD GHODQWH EORTXHDQGR OD SDODQFD GH UHWHQLGD (O FLHUUH
TXHGDUHWHQLGRGHQXHYRSRUODSDODQFDGHUHWHQLGD

G  5È)$*$6 )LJ 




(Q HVWD PRGDOLGDG OD SDODQFD GH GLVSDUR   VH PDQWLHQH SUHVLRQDGD SRU HO
PHFDQLVPR GH GLVSDUR GHQWUR GH OD FDUFDVD   'XUDQWH HO UHFRUULGR GH UHWURFHVR
GHOFLHUUHQRVHDFWLYDHO EDODQFtQ  PLHQWUDVTXHODSDODQFD GHGLVSDUR  HVWp
SUHVLRQDGD(OFLHUUHVHSXHGHPRYHUOLEUHPHQWHKDFLDGHODQWHVLQOLPLWDFLRQHV

H$PRUWLJXDGRUGHOPHFDQLVPRGHGLVSDUR )LJ 

(VWi LQVWDODGR HQ OD SDUWH SRVWHULRU GHO FDMyQ GH PHFDQLVPRV EDMR HO DPRUWLJXDGRU
GHOH[SXOVRU
3RUVXSDUWHGHODQWHUDWLHQHXQDEULGD  SDUDHQJDQFKHDOPHFDQLVPRGHGLVSDUR
(OPXHOOHHVWiSUHFDUJDGR(ODQLOORGHDVLHQWR  VXMHWDHODPRUWLJXDGRUDOFDMyQGH
PHFDQLVPRV





)LJXUD$PRUWLJXDGRUGHOPHFDQLVPRGHGLVSDUR

(QHOUHFRUULGRGHUHFXSHUDFLyQHOFLHUUHHVUHWHQLGRSRUODSDODQFDGHUHWHQLGDGHO
PHFDQLVPRGHGLVSDUR/DHQHUJtDFLQpWLFDGHOFLHUUHHVDEVRUELGDSRUODWHQVLyQGHO
PXHOOHXQLGRSRUHOYiVWDJRDOPHFDQLVPRGHGLVSDUR

I$PRUWLJXDGRUGHH[SXOVLyQ )LJ 

6LWXDGRHQODSDUWHSRVWHULRUGHOFDMyQGHPHFDQLVPRVWLHQHSRUIXQFLyQ
 $FWXDUVREUHHOH[SXOVRUSDUDODH[SXOVLyQGHODYDLQD
 ,QYHUWLUODGLUHFFLyQGHOPRYLPLHQWRGHOFLHUUH




 'LVFRDPRUWLJXDGRUGHO
FLHUUH
 0XHOOHVGHGLVFRV
 $PRUWLJXDGRUGHH[SXOVLyQ
 &XHUSRGHODPRUWLJXDGRU
 7RSHUHWpQ
 7RUQLOORGHKH[iJRQR
LQWHULRU
 &DEH]DGHODPRUWLJXDGRU
 0XHOOHVGHGLVFRV
 *XtDGHOPXHOOH
7XHUFDWRSH


)LJXUD$PRUWLJXDGRUGHH[SXOVLyQ


J'REOHDOLPHQWDGRU )LJV\ 

(O GREOH DOLPHQWDGRU SURSRUFLRQD OD PXQLFLyQ DO FDxyQ (VWi VLWXDGR HQ XQD
HVWUXFWXUDGHDSR\RHQFLPDGHOFDxyQ\VXMHWRDODFXQDGHWDOIRUPDTXHWDQWRHO
UHFRUULGRGHUHWURFHVRFRPRHOGHUHFXSHUDFLyQGHOFDxyQQRWLHQHQLQIOXHQFLDVREUH
HODOLPHQWDGRU



)LJXUD'REOHDOLPHQWDGRU  




 &RQMXQWR'$/  *XtD
 3DVDGRUHOiVWLFR  &XHUSR
 7XERGHILMDFLyQ  (VFRWDGXUDGHILMDFLyQDOD
 &DEH]DGHPDQGR FXQD

(O'$/HVXQHOHPHQWRPX\FRPSOHMRFX\RGHVSLHFHFRPSOHWRVHHVWXGLDFRQPiV
SURIXQGLGDG HQ HO 0DQXDO GH 0DQWHQLPLHQWR GH ž (VFDOyQ $TXt D WtWXOR GH
GHVFULSFLyQJHQHUDO\IXQFLRQDPLHQWRFRPELQDGRVHxDODUHPRVTXHHVWiFRPSXHVWR
SRU
 8Q FXHUSR   TXH HV OD HVWUXFWXUD EiVLFD GHO DOLPHQWDGRU \ TXH GLVSRQH GH
ODVVXMHFLRQHV\DSR\RVQHFHVDULRVSDUDDORMDUWRGRVORVFRPSRQHQWHV
 /DFDEH]DGHPDQGR  HVWiLQVWDODGDHQODFDUDSRVWHULRUGHO'$/\TXHGD
UHWHQLGD SRU HO WXER GH ILMDFLyQ   TXH D VX YH] TXHGD ILMR SRU XQ SDVDGRU
HOiVWLFR   7UDQVIRUPD HO PRYLPLHQWR OLQHDO GHO SLVWyQ GH JDV HQ XQ
PRYLPLHQWR URWDWLYR (Q OD SDUWH VXSHULRU HVWi LQVWDODGR XQ WRSH GH
DPRUWLJXDFLyQ   'LVSRQH GH XQ HQJUDVDGRU   \ GH XQ WRUQLOOR   SDUD
PRQWDU\DVHJXUDUODSDODQFDGHSDUDGDGHHPHUJHQFLD



)LJXUD'REOHDOLPHQWDGRU  &DEH]DGHPDQGR

 7RSHGHDPRUWLJXDFLyQ  7RUQLOOR  (QJUDVDGRU




)LJXUD'REOHDOLPHQWDGRU  
5DPSDDOLPHQWDFLyQGHUHFKD  5DPSDDOLPHQWDFLyQL]TXLHUGD
&XHUSR  ÈUEROHVGHDUUDVWUH
0DQJXLWRVGHDFRSODPLHQWR  &DEH]DVWUDQVPLVRUDV
$QLOORVWHQVRUHV  7ULQTXHWHV

 /RV WULQTXHWHV   HVWiQ DORMDGRV HQ OD FDUD DQWHULRU GHO '$/ 6XV HMHV GH
DFFLRQDPLHQWR FRQHFWDQ OD FDEH]D GH PDQGR   FRQORV iUEROHV GH DUUDVWUH
 DWUDYpVGHODVFDEH]DVWUDQVPLVRUDV  \GHOFXHUSRGHORVWULQTXHWHV
(OIXQFLRQDPLHQWR\FRQVWLWXFLyQGHDPERVHVLGpQWLFRFRQODGLIHUHQFLDGHVX
URWDFLyQ\GHOGHQWDGRIURQWDO HQUDPSD GHORVFXHUSRVTXHVRQHQVHQWLGR
FRQWUDULR (O PRYLPLHQWR URWDWLYR RULJLQDGR HQ OD FDEH]D GH PDQGR HV
WUDQVPLWLGR D ORV iUEROHV GH DUUDVWUH D WUDYpV GHO GHQWDGR IURQWDO GHO FXHUSR
GHOWULQTXHWH'HVSXpVGHTXHORVHOHPHQWRVGHODFDEH]DGHPDQGRUHWRUQDQ
DVXSRVLFLyQLQLFLDOHOFXHUSRGHORVWULQTXHWHVHVGHVSOD]DGRD[LDOPHQWHSRU
ORVGLHQWHVIURQWDOHVHQUDPSDPLHQWUDVTXHORViUEROHVGHDUUDVWUHQRTXHGDQ
LQIOXHQFLDGRVGXUDQWHHVWDRSHUDFLyQ
 /RV iUEROHV GH DUUDVWUH   HVWiQ LQVWDODGRV ORQJLWXGLQDOPHQWH HQ HO
DOLPHQWDGRU HQWUH ORV WULQTXHWHV   \ ORV PDQJXLWRV GH DFRSODPLHQWR  
7UDQVPLWHQ D ODV UXHGDV GH HVWUHOOD HO PRYLPLHQWR URWDWRULR JHQHUDGR HQ OD
FDEH]DGHPDQGRDWUDYpVGHORVWULQTXHWHV\ORVPDQJXLWRVGHDFRSODPLHQWR
/D FRQVWLWXFLyQ \ HO IXQFLRQDPLHQWR GH ORV GRV iUEROHV GH DUUDVWUH VRQ
LGpQWLFRVSHURJLUDQHQVHQWLGRRSXHVWR(OPRYLPLHQWRURWDWLYRRULJLQDGRHQ
OD FDEH]D GH PDQGR HV WUDQVPLWLGR D ORV iUEROHV GH DUUDVWUH D WUDYpV GH ODV
FDEH]DVWUDQVPLVRUDV  
 /RV PDQJXLWRV GH DFRSODPLHQWR   HVWiQ VLWXDGRV HQ OD SDUWH WUDVHUD \
VLUYHQ SDUD PRYHU ODV UXHGDV GH HVWUHOOD D WUDYpV GH ODV HVFRWDGXUDV (VWiQ
FRQHFWDGRVFRQHOiUEROGHDUUDVWUHFRUUHVSRQGLHQWHSRUODVHVWUtDVLQWHULRUHV
\DODUXHGDGHHVWUHOODSRUODVHVFRWDGXUDV7UDQVPLWHQODIXHU]DGHOiUEROGH
DUUDVWUH D VX UXHGD GH HVWUHOOD SDUD OOHYDU OD PXQLFLyQ D OD SRVLFLyQ GH


DOLPHQWDFLyQ0HGLDQWHHOPRYLPLHQWRUDGLDOGHODQLOORWHQVRUHOPDQJXLWRGH
DFRSODPLHQWR HV GHVSOD]DGR D[LDOPHQWH \ VH GHVFRQHFWD HO HVWULDGR LQWHULRU
GHO PDQJXLWR GHO HVWULDGR H[WHULRU GHO iUERO GH DUUDVWUH TXHGDQGR
LQWHUUXPSLGRHOPRYLPLHQWR

J  )81&,21$0,(172'(/'$/ )LJ 

(O '$/ SURSRUFLRQD OD PXQLFLyQ DO DUPD GHVGH HO FDUJDGRU L]TXLHUGR R GHUHFKR
VHJ~QHOWLSRGHPXQLFLyQVHOHFFLRQDGD
$OSUHVLRQDU)8(*2
 6LOD0*HVWiVHOHFFLRQDGDHO'$/SHUPDQHFHHQVXSRVLFLyQFHQWUDO
 6L HVWi VHOHFFLRQDGR HO FDxyQ HO '$/ VH PXHYH D XQD SRVLFLyQ GH
DOLPHQWDFLyQ GHSHQGLHQGRGHOFDUJDGRUVHOHFFLRQDGR 

$OSUHVLRQDU6(*852HO'$/VHPXHYHDVXSRVLFLyQFHQWUDO


35(&$8&,Ï1
(O '$/ VyOR SXHGH PRYHUVH VL HO FLHUUH HVWi DWUiV OR FXDO GHEH WHQHUVH
SUHVHQWHGXUDQWHODPDQLSXODFLyQGHOFDxyQFRQORVPDQGRVPHFiQLFRV

/RVJDVHVGHOGLVSDURTXHVDOHQSRUODWREHUDGHOWXERVRQGLULJLGRVSRUHOFRQGXFWR
 KDFLDHOSLVWyQGHJDV  GHO'$/TXHLPSXOVDGRSRUGLFKRVJDVHVLQFLGHVREUH
ODDOHWDGHODOHYDPRWUL]  HQODFDEH]DGHPDQGRLPSULPLpQGROHXQPRYLPLHQWR
GHJLURHQVHQWLGRFRQWUDULRDODVDJXMDVGHOUHORMGHXQRVžTXHHVWUDQVPLWLGRDO
SLxyQGHPDQGR  GLUHFWDPHQWH\HQVHQWLGRFRQWUDULRDOVHFWRUGHQWDGR  (VWH
PRYLPLHQWRWHQVDHOPXHOOHKHOLFRLGDOSUHFDUJDGRVLWXDGRHQWUHODFDEH]DGHPDQGR
\HOVHFWRUGHQWDGR  
(OJLURGHOSLxyQGHPDQGR  \GHOVHFWRUGHQWDGR  HVWiOLPLWDGRSRUXQRVWRSHV
D XQ iQJXOR GH JLUR Pi[LPR GH ž VLHQGR DPRUWLJXDGR DO ILQDO SRU HO WRSH GH
DPRUWLJXDFLyQ



)LJXUD)XQFLRQDPLHQWRGHODFDEH]DGHPDQGRGHO'$/




 &DMyQGHPHFDQLVPRV  6HFWRUGHQWDGR
 /HYDPRWUL]  3LVWyQGHJDVGHO'$/
 3LxyQGHPDQGR  &RQGXFWRGHJDVHV
 (MHGHDFFLRQDPLHQWRGHO  5DQXUDGHDFRSODPLHQWR
WULQTXHWH


K0HFDQLVPRGHIUHQRUHFXSHUDGRU )LJ 

6H WUDWD GH XQ GLVSRVLWLYR GH DPRUWLJXDFLyQ KLGURPHFiQLFR TXH DEVRUEH
HOiVWLFDPHQWHODIXHU]DGHOUHWURFHVRGHOFDxyQ/DYHORFLGDGGHUHWURFHVRGHOFDxyQ
HV IUHQDGD SRU OD DFFLyQ GH XQ PXHOOH GH GLVFRV (O UHWRUQR D OD SRVLFLyQ LQLFLDO
EDWHUtD  HV IRU]DGR SRU OD GLVWHQVLyQ GHO PXHOOH FRPSULPLGR GXUDQWH HO UHWURFHVR \
VXYHORFLGDGUHGXFLGDSRUODDFFLyQGHOIOXLGRKLGUiXOLFR




)LJXUD)UHQRUHFXSHUDGRU

(OIUHQRUHFXSHUDGRU  HVWiXQLGRDOFDMyQGHPHFDQLVPRVSRUODFDEH]DURVFDGD
 HQHOYiVWDJRGHOSLVWyQPHGLDQWHXQEXOyQFRQILDGRUGHEROD/DXQLyQDODFXQD
VHHIHFW~DVREUHXQDSODFDVRSRUWHHQODTXHHQFDMDODSDUWHHVIpULFDGHOFLOLQGUR  
\VLUYHFRPRVRSRUWHDOFRQMXQWR

K  5(752&(62'(/&$fÏ1 )LJ 

'XUDQWHHOGLVSDURHOFRQMXQWRGHOFDxyQUHWURFHGH\HOEXOyQGHHQODFHGHOYiVWDJR
  FRQ HO FDMyQ GH PHFDQLVPRV WLUD GHO YiVWDJR FRQ SLVWyQ   DO TXH DUUDVWUD HQ
UHWURFHVR(OYiVWDJRHQVXPRYLPLHQWRFRPSULPHHOPXHOOHGHDQLOORV  $OPLVPR
WLHPSRHOSLVWyQSUHVLRQDHOOtTXLGRKLGUiXOLFRGHODFiPDUDSRVWHULRU % IRU]iQGROR
DSDVDUDODFiPDUDDQWHULRU $ DWUDYpVGHORVRULILFLRVGHOSLVWyQ'HHVWHPRGRVH
DEVRUEHODIXHU]DGHUHWURFHVRGHOFDxyQ\VHIUHQD

 9iVWDJRFRQSLVWyQ
 0XHOOHGHDQLOORV
 2ULILFLRVGHSDVR
GHDFHLWH
 7DSDGHREWXUDFLyQ
 &DEH]DGHO
YiVWDJR

)LJXUD)XQFLRQDPLHQWRGHOPHFDQLVPRGH
IUHQRUHFXSHUDGRU




K  5(&83(5$&,Ï1'(/&$fÏ1

$O FHVDU HO UHWURFHVR OD GLVWHQVLyQ GHO PXHOOH GH DQLOORV LPSXOVD HO FDxyQ KDFLD
GHODQWH (QWRQFHV HO DFHLWH HV IRU]DGR D SDVDU GH OD FiPDUD DQWHULRU $  D OD
SRVWHULRU %  D WUDYpV GH ORV RULILFLRV GH SDVR GH DFHLWH   GHO YiVWDJR GHO SLVWyQ
SXHVWRTXHORVRULILFLRVGHOSLVWyQHVWiQREWXUDGRVSRUODWDSDGHREWXUDFLyQ  'H
HVWH PRGR OD HQWUDGD HQ EDWHUtD GHO FDxyQ VH IUHQDUi KDVWD UHFXSHUDU VX SRVLFLyQ
LQLFLDO


)81&,21$0,(172&20%,1$'2

D&DUJDSDUFLDOGHOFDxyQ

3RVLFLyQSDUDODFDUJDSDUFLDO
 (OFLHUUHDGHODQWH
 (O'$/HVWiLQVWDODGRHQODFXQDVXMHWR\HQSRVLFLyQFHQWUDO
 (OSULPHUGLVSDURHQHODOLPHQWDGRUHQSRVLFLyQGHDOLPHQWDFLyQ

E$UPDGRGHOFLHUUH )LJ 


35(&$8&,Ï1
3DUDDUPDUHOFLHUUH\DVHDFRQHOGLVSRVLWLYRGHUHDUPHHOpFWULFRRHOPDQXDO
HO'$/GHEHHVWDUHQODSRVLFLyQFHQWUDO

$QWHV GH HIHFWXDU HO SULPHU GLVSDUR ORV VHJXURV PHFiQLFRV GHO FDMyQ GH ORV
PHFDQLVPRV   GHEHQ HVWDU HQ SRVLFLyQ GH DUPDGR   \ HO FLHUUH   WLHQH TXH
UHWUDHUVHFRQHOPHFDQLVPRGHDUPDGR(OFLHUUHTXHGDEORTXHDGR\ORVPXHOOHV  
GHO PHFDQLVPR GH UHFXSHUDFLyQ FRPSULPLGRV (Q OD SRVLFLyQ UHWUDVDGD HO FLHUUH
TXHGD UHWHQLGR SRU OD SDODQFD GH UHWHQLGD   GHO PHFDQLVPR GH GLVSDUR (Q HO
DOLPHQWDGRUHOSULPHUGLVSDUR  VHHQFXHQWUDHQVXSRVLFLyQGHDOLPHQWDFLyQ
(OFDxyQHVWiOLVWRSDUDHOGLVSDUR





)LJXUD$UPDGRGHOFLHUUH

F&DUJD\EORTXHR )LJ 

&XDQGRHOGLVSRVLWLYRGHGLVSDURGHODFXQDDFW~DVREUHODSDODQFDGHGLVSDUR  OD
SDODQFD GH UHWHQLGD   OLEHUD HO FLHUUH   TXH LPSXOVDGR SRU ORV PXHOOHV GH
UHFXSHUDFLyQLQLFLDHOUHFRUULGRKDFLDGHODQWH
'XUDQWH HO PRYLPLHQWR GH UHFXSHUDFLyQ GHO FLHUUH HO UHVDOWH IURQWDO GHO PLVPR
HPSXMDIXHUDGHODOLPHQWDGRUDOGLVSDURTXHHVWiHQSRVLFLyQGHDOLPHQWDFLyQ\OR
GHVSOD]DKDVWDLQWURGXFLUORHQODUHFiPDUD  
'XUDQWHHVWDRSHUDFLyQHOH[WUDFWRU  HQJDQFKDHOFXORWHGHODYDLQDGHOGLVSDURDO
LQWURGXFLUVHHQVXUDQXUDGHH[WUDFFLyQ$OILQDOL]DUHOUHFRUULGRGHUHFXSHUDFLyQGHO
FLHUUH VXV SHVWLOORV GH EORTXHR EDVFXODQ KDFLD IXHUD VREUH ORV SHVWLOORV ILMRV ORV
FXDOHVEORTXHDQHOFLHUUHSUHVLRQDGRVSRUHOFHUURMRGHOFLHUUHGXUDQWHVXUHFRUULGR
ILQDOKDFLDGHODQWH(QHVWHPRPHQWRHOFLHUUHKDDOFDQ]DGRODSRVLFLyQH[WUHPD\
SUHVLRQDDOGLVSDURHQHOLQWHULRUGHODUHFiPDUD/DSUHVLyQGHOFHUURMRGHEORTXHR
VREUHORVSHVWLOORVORVDFXxD\HVWDEOHFHHOEORTXHRUtJLGRGHOFLHUUH



)LJXUD&DUJD\EORTXHR

3DODQFDGHGLVSDUR &LHUUH 5HFiPDUD
3DODQFDGHUHWHQLGDGHOFLHUUH ([WUDFWRU



G%ORTXHR\GLVSDUR )LJ 

(O FLHUUH KD TXHGDGR EORTXHDGR SRU OD DFFLyQ GH ORV SHVWLOORV GH EORTXHR  
SUHVLRQDGRVFRQWUDORVSHVWLOORVILMRV  GHOFDMyQGHORVPHFDQLVPRVSRUODIXHU]D
GH ORV PXHOOHV UHFXSHUDGRUHV \ HVWi REWXUDQGR OD UHFiPDUD DOLPHQWDGD FRQ XQ
GLVSDUR
$OPLVPRWLHPSRHOSHUFXWRU  HVLPSXOVDGRKDFLDGHODQWHSRUHOSRUWDSHUFXWRU  
HOFXDOUHFLEHHOPRYLPLHQWRGHODFKDYHWDGHFRQH[LyQ  DUUDVWUDGDDVXYH]SRU
HOPRYLPLHQWRGHOFHUURMRGHEORTXHR  GHOFLHUUH
(OGLVSDURVHSURGXFHFXDQGRHOSHUFXWRUDVRPDSRUHOJUDQRGHIRJyQGHOFLHUUHH
LQFLGHHQODFiSVXODLQLFLDGRUDGHODYDLQDTXHLQIODPDODFDUJDGHSUR\HFFLyQ(VWD
DFFLyQHVSURGXFLGDSRU
 /DIXHU]DGHORVPXHOOHVUHFXSHUDGRUHV
 /DLQHUFLDGHOFHUURMRGHOFLHUUH

$OILQDOGHOGHVSOD]DPLHQWR ORV~OWLPRVPP ODFDUJDGHSUR\HFFLyQGHOGLVSDURHV
LQIODPDGDSRUDFFLyQGHOSHUFXWRU


)LJXUD%ORTXHR\GLVSDUR

 3HVWLOORGHEORTXHRILMR  3RUWDSHUFXWRU
 3HVWLOORGHEORTXHR  &KDYHWDGH
 &HUURMRGHEORTXHR FRQH[LyQ
 3HUFXWRU


H'HVEORTXHRGHOFLHUUH )LJ 




8QD YH] SURGXFLGR HO GLVSDUR HO SUR\HFWLO   HV LPSXOVDGR KDFLD GHODQWH SRU ORV
JDVHVSURGXFLGRVSRUODFRPEXVWLyQGHODFDUJDGHSUR\HFFLyQ&XDQGRHOSUR\HFWLO
VREUHSDVDODVWUHVWREHUDVGHJDV  GHOWXER GRVSDUDHOGHVEORTXHRGHOFLHUUH\
XQDSDUDHODFFLRQDPLHQWRGHO'$/ SDUWHGHHVWRVJDVHVVDOHQSRUODVWREHUDVGH
GHVEORTXHRGHOFLHUUH\VHGLULJHQSRUHOFRQGXFWR  DORVRULILFLRVGHVDOLGDGHJDV
VLWXDGRVHQWUHHOSLVWyQGHJDV  GHOFLHUUH\HOSLVWyQRSXHVWR  &DGDSLVWyQGH
JDV   LPSXOVD DO PDQJXLWR   FRUUHVSRQGLHQWH D FDGD PXHOOH UHFXSHUDGRU \ OH
REOLJDDGHVSOD]DUVHKDFLDDWUiV&RPRFDGDPDQJXLWRWLHQHVXRUHMHWD )LJQž
 DFRSODGDDOFHUURMRGHEORTXHRGHOFLHUUH  GHVSOD]DQDpVWHKDFLDDWUiV MXQWR
FRQ OD FKDYHWD GH FRQH[LyQ \ DO SHUFXWRU FRQ VX SRUWDSHUFXWRU  OLEHUDQGR DVt ORV
SHVWLOORV GH EORTXHR )LJ  Qž   TXH EDVFXODQ KDFLD OD FDEH]D GHO FLHUUH \ OR
GHVEORTXHDQSURGXFLpQGRVHODDSHUWXUDGHODUHFiPDUD


)LJXUD'HVEORTXHRGHOFLHUUH

 3UR\HFWLO  &HUURMRGHEORTXHR
 7REHUDVWRPDGHJDV  0DQJXLWRPXHOOHUHFXSHUDGRU
 &RQGXFWRGHJDV  9DLQD
 3LVWyQGHJDVGHODOLPHQWDGRU  3LVWyQGHJDVGHOFLHUUH
 /HYDPRWUL] 3LVWyQRSXHVWR

I5HFRUULGRGHUHWURFHVRGHOFLHUUH

/RV JDVHV GH FRPEXVWLyQ GH OD FDUJD GH SUR\HFFLyQ SUHVLRQDQ VREUH OD YDLQD H
LPSXOVDQDOFLHUUHKDFLDDWUiVXQDYH]GHVEORTXHDGRDDOWDYHORFLGDGYHQFLHQGROD
UHVLVWHQFLDGHORVPXHOOHVUHFXSHUDGRUHV

J([SXOVLyQGHODYDLQD )LJ 

(Q HO UHWURFHVR GHO FLHUUH ORV PXHOOHV UHFXSHUDGRUHV VH FRPSULPHQ DO PLVPR
WLHPSR PLHQWUDV TXH ORV WXERV JXtD GH GLFKRV PXHOOHV LPSLGHQ OD GHIOH[LyQ ODWHUDO
GHORVPLVPRV
$QWHV GH TXH HO FLHUUH FRPSOHWH HO UHWURFHVR HO H[SXOVRU   LPSDFWD FRQWUD HO
DPRUWLJXDGRUGHOH[SXOVRU  IUHQDQGRVXUHWURFHVR\KDFLpQGROHVDOLUGHODFDEH]D



GHOFLHUUHLQFLGLHQGRDVtVREUHHOFXORWHGHODYDLQD  DODFXDOVDFDGHODXxDGHO
H[WUDFWRU  DJUDQYHORFLGDGH[SXOViQGRODIXHUDGHODUPD


)LJXUD([SXOVLyQGHODYDLQD

 ([SXOVRU  $PRUWLJXDGRUGHOPHFDQLVPRGHGLVSDUR
 $PRUWLJXDGRUGHOH[SXOVRU  ([WUDFWRU
 $PRUWLJXDGRUGHOFLHUUH  9DLQD

K&LFORFRPSOHWR

(OFLHUUHDOILQDOGHOUHWURFHVRHVGHWHQLGRSRUODDFFLyQGHODPRUWLJXDGRUGHOFLHUUH
)LJQž HOFXDODEVRUEHFRQVXVPXHOOHVGHGLVFRODHQHUJtDUHPDQHQWHGHO
FLHUUH 'XUDQWH VX UHFRUULGR GH UHWURFHVR ORV PXHOOHV UHFXSHUDGRUHV VH KDQ
FRPSULPLGRSRUHIHFWRGHODHQHUJtDGHUHWURFHVR$OFHVDUpVWDORVPXHOOHVWLHQGHQ
DGLVWHQGHUVHSURGXFLHQGRXQPRYLPLHQWRKDFLDGHODQWHSDUDUHFXSHUDUVXSRVLFLyQ
QRUPDO (O FLHUUH SRU OD DFFLyQ GH ODV RUHMHWDV GH HPSXMH GH ORV PDQJXLWRV GH ORV
PXHOOHVUHFXSHUDGRUHVHVLPSXOVDGRKDFLDGHODQWHSDUDFRPSOHWDURWURQXHYRFLFOR
 
(OFLFORFRPSOHWRHVHOVLJXLHQWH
 &DUJD
 %ORTXHR REWXUDFLyQ GHOFLHUUH
 ,JQLFLyQGHODFDUJDGHSUR\HFFLyQGHOGLVSDUR
 'HVEORTXHR DSHUWXUD GHOFLHUUH
 &RPSUHVLyQGHORVPXHOOHVUHFXSHUDGRUHV
 ([SXOVLyQGHODYDLQD

(VWH FLFOR HQ HO PRGR GH GLVSDUR D UiIDJDV VH UHSLWH KDVWD TXH HO GLVSRVLWLYR GH
GLVSDURGHODFXQDOLEHUHDODSDODQFDGHGLVSDUR
&XDQGR VH OLEHUD OD SDODQFD GH GLVSDUR OD SDODQFD GH UHWHQLGD GHO FLHUUH VDOH GHO
PHFDQLVPRGHGLVSDUR\UHWLHQHHQODUHFXSHUDFLyQDOFLHUUHSRUODSDUWHWUDVHUDGHO
FHUURMR GH EORTXHR $O PLVPR WLHPSR HO FLHUUH \D KD UHFLELGR HO LPSXOVR KDFLD
GHODQWH SRU HO DPRUWLJXDGRU GHO FLHUUH \ HO PHFDQLVPR GH UHFXSHUDFLyQ (O
DPRUWLJXDGRUGHOPHFDQLVPRVHGLVSRQHDDEVRUEHUODHQHUJtDFLQpWLFDGHOFLHUUH\
SURWHJHDOFLHUUH\DOPHFDQLVPRGHGLVSDURGXUDQWHODUHWHQLGD
3DUD DVHJXUDU XQD UHWHQFLyQ HIHFWLYD GHO FLHUUH OD SDODQFD GH UHWHQLGD GHO FLHUUH
HVWiUtJLGDPHQWHEORTXHDGDSDUDSURWHJHUODGHUHERWHV



L0RYLPLHQWRGHODPXQLFLyQHQHODOLPHQWDGRU )LJ 

(OUHVDOWHDOLPHQWDGRUGHOFLHUUH  HPSXMDGXUDQWHHOUHFRUULGRGHUHFXSHUDFLyQDO
GLVSDUR  HQSRVLFLyQGHDOLPHQWDFLyQVDFiQGRORGHOHVODEyQ  KDFLDHOLQWHULRU
GHODUHFiPDUD
/RV JDVHV GH OD FRPEXVWLyQ GH OD FDUJD GH SUR\HFFLyQ GHO GLVSDUR SURYRFDQ HQ
FDGD GLVSDUR XQ PRYLPLHQWR GH JLUR GH OD UXHGD GH HVWUHOOD 3RFR DQWHV GH
FRPSOHWDU HO UHFRUULGR GH UHWURFHVR GHO FLHUUH XQ QXHYR GLVSDUR VH FRORFD HQ
SRVLFLyQGHDOLPHQWDFLyQHQODUXHGDGHHVWUHOOD  
&DGD PRYLPLHQWR GH OD UXHGD GH HVWUHOOD SURYRFDGR SRU HO GLVSDUR DQWHULRU
FRUUHVSRQGHFRQXQQXHYRGLVSDURHQSRVLFLyQGHDOLPHQWDFLyQDOWLUDUGHOFRQMXQWR
GHORVGLVSDURVHQJDU]DGRVXQRFRQRWUR
/RV HVODERQHV VRQ HPSXMDGRV KDFLD OD VDOLGD GXUDQWH OD VLJXLHQWH DOLPHQWDFLyQ \
GLULJLGRV SRU OD UDPSD   VLHQGR H[SXOVDGRV IXHUD GHO DOLPHQWDGRU HQ HO FLFOR
VLJXLHQWH


)LJXUD0RYLPLHQWRGHDOLPHQWDFLyQGHODPXQLFLyQ

(VODEyQ 5XHGDGHHVWUHOOD &LHUUH
'LVSDUR 5DPSD


6,67(0$63(5,)e5,&26'(/&$fÏ1

D0HFDQLVPRGHGHVSOD]DPLHQWRGHO'$/ )LJ 

(VWHVLVWHPDSHUPLWHDO'$/GHVSOD]DUVHDL]TXLHUGD DOLPHQWDFLyQSRUHOFDUJDGRU
L]TXLHUGR  FHQWUR SRVLFLyQ 6(*852 R $0 VHOHFFLRQDGD  R GHUHFKD DOLPHQWDFLyQ
SRU HO FDUJDGRU GHUHFKR  FXDQGR VH DFW~D VREUH ORV SXOVDGRUHV  &,=4 R 
&'(5GHODV8QLGDGHVGH&RQWUROGHO-HIHGH9HKtFXORRGHO7LUDGRU
(O VLVWHPD FRQVWD GH XQ PRWRU   TXH PXHYH PHGLDQWH HQJUDQDMHV XQ KXVLOOR  
eVWH D VX YH] GHVSOD]D ODWHUDOPHQWH D OD KRUTXLOOD   TXH HQFDMD HQ HO '$/   D
WUDYpVGHODSLH]D  REOLJiQGROHDPRYHUVHDXQR\RWURODGR(QFDVRGHDYHUtD
GHOPRWRUSXHGHRSHUDUVHPHGLDQWHXQVLVWHPDPDQXDOJLUDQGRHOFXDGUDGLOOR  (O
SURFHGLPLHQWRVHH[SOLFDHQGHWDOOHHQODILFKDGHHVWHPDQXDO



)LJXUD6LVWHPDGHPDQGRGHO'$/

 0RWRU  3LH]D GH DFRSODPLHQWR VXSHULRU GHO
 0HFDQLVPRGHPDQGRPDQXDO '$/
 +XVLOOR  'REOHDOLPHQWDGRU '$/ 
 +RUTXLOODGHDFRSODPLHQWR  3XHQWHWUDVHUR
GHVSOD]DEOH

E0HFDQLVPRDUPDGRGHOFLHUUH )LJV\ 

(VWHPHFDQLVPRSHUPLWHDUPDUHOFLHUUHSDUDHOGLVSDUROOHYiQGRORKDFLDDWUiVKDVWD
TXHTXHGHUHWHQLGRSRUHOPHFDQLVPRGHGLVSDUR$VLPLVPRSHUPLWHOOHYDUHOFLHUUHD
VXSRVLFLyQGHUHSRVR GHODQWHREWXUDQGRHOFLHUUH GHPDQHUDFRQWURODGD
(OVLVWHPDFRQVWDGHXQPRWRU  TXHSRUPHGLRGHOWUHQGHHQJUDQDMHV  DFFLRQD
XQ KXVLOOR   \ pVWH D VX YH] D XQD SLH]D GHVSOD]DEOH   /D SLH]D GHVSOD]DEOH
GLVSRQHGHXQDXxDGHHQJDQFKH  TXHDUUDVWUDHOFLHUUHHQDPERVVHQWLGRV




)LJXUD0HFDQLVPRGHDUPDGRGHOFLHUUH  

(OWHWyQ  WLHQHSRUPLVLyQDEDWLUODXxDGHHQJDQFKHOLEHUDQGRHOFLHUUHFXDQGROD
SLH]DGHVSOD]DEOHDOFDQ]DODSRVLFLyQPiVDGHODQWDGD&XDQGRODSLH]DGHVSOD]DEOH
VHPXHYHKDFLDDWUiV\VXSHUDODSRVLFLyQGHOWHWyQODDFFLyQGHVXPXHOOHHOHYDOD
XxDGHHQJDQFKHSHUPLWLHQGRDUUDVWUDUHOFLHUUHKDFLDDWUiV
(Q FDVR GH DYHUtD HO FXDGUDGLOOR   SHUPLWH PHGLDQWH HO DFRSODPLHQWR GH XQD
PDQLYHOD   ORWH GH D ERUGR  HO DFFLRQDPLHQWR PDQXDO GHO VLVWHPD (O
SURFHGLPLHQWRVHH[SOLFDHQODILFKDGHHVWHPDQXDO



)LJXUD0HFDQLVPRGHDUPDGRGHOFLHUUH  

E  %/248('(/0(&$1,602'($50$'2'(/&,(55( )LJ 

7UDVODWDSD  VHHQFXHQWUDHOPHFDQLVPRGHEORTXHRGHOVLVWHPDGHDUPDGRGHO
FLHUUHeVWHPHFDQLVPREORTXHDHOVLVWHPDFXDQGRQRHVWiHQPRYLPLHQWRPHGLDQWH
ODSLH]DGHEORTXHR  TXHWUDEDHOHQJUDQDMHGHEORTXHR  3DUDGHVEORTXHDUHO
PHFDQLVPR \ SHUPLWLU HO PRYLPLHQWR HO VROHQRLGH   DO DFWLYDU ORV PDQGRV GH
UHDUPH GHO 3DQHO GH &RQWURO 3ULQFLSDO UHWUDH OD SLH]D GH EORTXHR OLEHUDQGR HO
HQJUDQDMH
(QFDVRGHDYHUtDGHOVLVWHPDODSLH]DGHEORTXHR  SXHGHUHWUDHUVHPDQXDOPHQWH
SRUODDFFLyQGHODSDODQFD  PRYLpQGRODGHODSRVLFLyQ$ODSRVLFLyQ%




)LJXUD0HFDQLVPRGHEORTXHR

F$FFLRQDPLHQWRGHOPHFDQLVPRGHGLVSDUR )LJ 

(ODFFLRQDPLHQWRGHOPHFDQLVPRGHGLVSDURWLHQHSRUPLVLyQ
 $FFLRQDUHOPHFDQLVPRGHGLVSDURGHOFDxyQOLEHUDQGRODUHWHQLGDGHOFLHUUH
 $FFLRQDUODSDODQFDGHUHWHQFLyQGHO'REOH$OLPHQWDGRUHQFDUJDGDGHHYLWDU
PRYLPLHQWRV\YLEUDFLRQHVGHO'$/GXUDQWHHOGLVSDUR
3DUDHOORGLVSRQHPRVGHXQVROHQRLGH  TXHDODFFLRQDUHOGLVSDUDGRUDFW~DVREUH
ODVFDGHQDV  TXHDVXYH]ORKDFHQVREUHHOYiVWDJR  OLEHUDQGRODUHWHQLGDGHO
FLHUUH
6LPXOWiQHDPHQWHDFFLRQDHOHMH  \ODYDULOOD  REOLJDQGRDODSDODQFDGHUHWHQLGD
 GHOSXHQWHWUDVHURDILMDUHO'$/





)LJXUD$FFLRQDPLHQWRGHOPHFDQLVPRGHGLVSDUR

(QFDVRGHDYHUtDGHOVROHQRLGHRGHOVLVWHPDGHGLVSDURHOpFWULFRVHSXHGHHMHFXWDU
HO GLVSDUR PDQXDOPHQWH PHGLDQWH XQD SDODQFD H[LVWHQWH HQ HO ORWH GH D ERUGR (O
SURFHGLPLHQWRVHH[SOLFDHQODILFKDGHHVWHPDQXDO

G6HQVRUHV )LJV\ 

/RVVHQVRUHVDFW~DQFRPRHOHPHQWRVGHFRQWUROGHORVPHFDQLVPRVSHULIpULFRVGH
PRGRTXHODWULSXODFLyQSXHGDFRQRFHUHQWRGRPRPHQWRODVLWXDFLyQGHORVPLVPRV
6RQORVVLJXLHQWHV




 
)LJXUD6HQVRUHV   )LJXUD6HQVRUHV  

1ž 6(1625 )81&,Ï1
 326,&,Ï1&(175$/ 'HWHFWD TXH HO '$/ VH HQFXHQWUD HQ SRVLFLyQ
'(/'$/ FHQWUDO6HHQFXHQWUDHQHOSXHQWHGHODQWHUR
 &8(17$ 'HWHFWD HO Q~PHUR GH UHYROXFLRQHV TXH HMHFXWD
5(92/8&,21(6'$/ HO PRWRU GHO PHFDQLVPR GH GHVSOD]DPLHQWR GHO
'$/ SDUD FRQWURODU VX GHVSOD]DPLHQWR (VWi
VLWXDGREDMRHOKXVLOORGHGLFKRPHFDQLVPRODGR
L]TXLHUGR
 326,&,Ï1&,(55( 'HWHFWD TXH HO FLHUUH HVWi DUPDGR 6H
$75È6 HQFXHQWUD VREUH HO SXHQWH WUDVHUR 'HWHFWD
DVLPLVPR HO Q~PHUR GH GLVSDURV TXH VH
HIHFW~DQ
 5($50('(/$17( 'HWHFWD TXH HO VLVWHPD GH DUPDGR SLH]D
GHVSOD]DEOH  VH HQFXHQWUD HQ SRVLFLyQ
DGHODQWDGD 6H HQFXHQWUD HQ OD SDUWH LQIHULRU
GHUHFKDGHODFXQD
 5($50($75È6 'HWHFWD TXH HO VLVWHPD GH DUPDGR SLH]D
GHVSOD]DEOH  VH HQFXHQWUD HQ SRVLFLyQ
UHWUDVDGD 6H HQFXHQWUD HQ OD SDUWH LQIHULRU
GHUHFKDGHODFXQD

H,QKLELGRUGHOGLVSDUR )LJ 

(O LQKLELGRU GHO GLVSDUR HV XQ VROHQRLGH   TXH VH DFWLYD FXDQGR HO VHQVRU GH
SRVLFLyQ UHWUDVDGD GHO FLHUUH GHWHFWD XQ Q~PHUR GH GLVSDURV VXSHULRU HQ GRV D OD
UiIDJD VHOHFFLRQDGD (Q HVWH FDVR HO VROHQRLGH DFWXDQGR PHFiQLFDPHQWH VREUH OD
SDODQFDGHSDUDGDGHHPHUJHQFLD  GHWHQGUtDODDOLPHQWDFLyQ\SRUWDQWRHOIXHJR





)LJXUD6ROHQRLGHLQKLELGRUGHOGLVSDUR


5(680(1

(Q HVWD ILFKD VH KDFH XQD GHVFULSFLyQ JHQHUDO GHO DUPDPHQWR GHO 9&, \ XQD
GHWDOODGD GHO &DxyQ 0N  DGHPiV VH H[SOLFD HO IXQFLRQDPLHQWR FRPELQDGR GHO
PLVPR\RWURVVLVWHPDVSHULIpULFRVGHHVWHSRUORTXHQRVHFRQVLGHUDFRQYHQLHQWH
UHDOL]DUXQUHVXPHQGHORVPLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

&DxyQ GH 9&, FRQ GHVPRQWDGR SDUD H[SOLFDFLyQ PDQLSXOHR \ UHFRQRFLPLHQWR (O
UHVSRQVDEOHGHODWHyULFD\SUiFWLFDVHUiHOSHUVRQDOHVSHFLDOLVWDHQDUPDPHQWR


$&&,21(6$5($/,=$5

([SOLFDFLyQGHORVFRPSRQHQWHVGHOFDxyQGHO9&,3L]DUUR
([SOLFDFLyQGHOPRQWDMH\GHVPRQWDMHGHORVPLVPRV
([SRVLFLyQIXHUDGHWRUUHGHOIXQFLRQDPLHQWRFRPELQDGRGHOFDxyQ


6,78$&,Ï1),1$




),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1&$fÏ10.081,&,21$0,(172

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\SDWLRRKDQJDU 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVSRU7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
0XQLFLyQLQHUWH
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQJUXSRHQHODXOD
3DUD OD SDUWH SUiFWLFD VH FRORFDUi XQ YHKtFXOR SRU FDGD  WULSXODQWHV HQ HO SDWLR R
KDQJDUHOLQVWUXFWRUHQHOSXHVWRGHO-HIHGHO9HKtFXOR\HO7LUDGRUHQVXSXHVWR6H
H[SOLFDUiQORVGLVWLQWRVDSDUWDGRVGHODVHVLyQGHIRUPDSUiFWLFD6HUtDFRQYHQLHQWH
XWLOL]DUPXQLFLyQLQHUWHSDUDODVSUiFWLFDVGHODILFKD


5(48,6,726$$/&$1=$5

(O WULSXODQWH GHEH VDEHU ORV WLSRV GH PXQLFLRQHV TXH VH HPSOHDQ FRQ VXV
FDUDFWHUtVWLFDV EDOtVWLFDV JHQHUDOHV VDEUi PXQLFLRQDU ORV GRV FDUJDGRUHV FRQ
PXQLFLyQLQHUWH

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

081,&,Ï1'(00[

D7LSRV

(OFDxyQ0$86(5 0.SXHGHXVDU GLYHUVRVWLSRVGHPXQLFLyQHQIXQFLyQGHO
EODQFR D EDWLU \ HIHFWRV D FRQVHJXLU IXQGDPHQWDOPHQWH PXQLFLyQ GH HMHUFLFLR
PXOWLSURSyVLWR \ SHUIRUDQWH /RV FDUWXFKRV VH XWLOL]DQ HQJDU]DGRV PHGLDQWH
HVODERQHVGHVLQWHJUDEOHV



$OGLVSRQHUGHXQGREOHDOLPHQWDGRU '$/ GHPXQLFLyQSXHGHKDFHUIXHJRFRQGRV
WLSRVGHPXQLFLyQLQGLVWLQWDPHQWHTXHSUHYLDPHQWHKDQGHELGRVHUFDUJDGDVHQORV
GRVFDUJDGRUHVGHTXHGLVSRQH
(O FRPSXWDGRU EDOtVWLFR SHUPLWH XWLOL]DU  WLSRV EiVLFRV FLQFR GH FDxyQ \  GH
DPHWUDOODGRUD(VWRVWLSRVEiVLFRVVRQORVVLJXLHQWHV
 03PXOWLSURSyVLWR
 +(,URPSHGRUDLQFHQGLDULD
 03'6DQWLPLVLOSHUIRUDQWHVXEFDOLEUDGD
 $3'6SHUIRUDQWHVXEFDOLEUDGD
 $3'6)6SHUIRUDQWHVXEFDOLEUDGDHVWDELOL]DGDSRUDOHWDV

'H HVWDV PXQLFLRQHV HO FRPSXWDGRU VROR WLHQH FDUJDGDV DGHPiV GH ODV
FRUUHVSRQGLHQWHV D OD PXQLFLyQ GH DPHWUDOODGRUD  ODV WDEODV FRUUHVSRQGLHQWHV D
ODVPXQLFLRQHV
 0376'\VXYHUVLyQGHHMHUFLFLR737
 $3)6'67

7LSR 9ž &DUDFWHUtVWLFDV
PV
0376' 0XOWLSXUSRVH 0XQLFLyQPXOWLSURSyVLWRGHIUDJPHQWDFLyQH
7UDFHU6HOI'HVWUXFW  LQFHQGLDULDWUD]DGRUDFRQDXWRGHVWUXFFLyQ

737 7UDLQLQJ3UDFWLFH 'LVSDURGHHMHUFLFLRGHEDMRFRVWH\

7UDFHU  SUHVWDFLRQHVGHWLHPSRGHYXHOR\YHORFLGDG
LQLFLDOVLPLODUHVDOD0376'
$3)6'67 $UPRXU  (IHFWLYRFRQWUDREMHWLYRVDFRUD]DGRVWDQWRGH
3LHUFLQJ)LQ6WDELOL]HG EOLQGDMHKRPRJpQHRFRPRHVSDFLDGR
'LVFDUGLQJ6DERW7UDFHU  (IHFWLYRFRQEDMRViQJXORVGHLQFLGHQFLD
 &RUWRWLHPSRGHYXHOR

D',63$52;000376'

0XQLFLyQGHWLSRPXOWLSURSyVLWRGRWDGDGHFDUJDH[SORVLYDHLQFHQGLDULD'LVSRQHGH
XQ UHWDUGR TXH OH SHUPLWH DFWLYDUVH WUDV DWUDYHVDU EODQFRV VLQ SURWHFFLyQ R
OLJHUDPHQWH SURWHJLGRV /D H[SORVLyQ GHO SUR\HFWLO JHQHUD GH  D  IUDJPHQWRV \
WLHQHHIHFWRVLQFHQGLDULRVVREUHHOEODQFR
$OLPSDFWDUVREUHHOEODQFRVHSURGXFHXQDUHDFFLyQHQFDGHQDFRPHQ]DQGRSRUOD
FDUJD LQFHQGLDULD  FDUJD LQFHQGLDULD  FDUJD H[SORVLYD FRQ OD FRUUHVSRQGLHQWH
IUDJPHQWDFLyQ GHO FXHUSR GHO SUR\HFWLO \ ILQDOL]DQGR FRQ OD LJQLFLyQ GH OD FDUJD
LQFHQGLDULD  TXH SURYRFD ORV HIHFWRV LQFHQGLDULRV HQ HO EODQFR (VWH SURFHVR
SURGXFH XQ UHWDUGR GH  PV TXH KDFH TXH ORV HIHFWRV VH PDQLILHVWHQ
DSUR[LPDGDPHQWHFPHQHOLQWHULRUGHOEODQFR
(Q HO FDVR GH QR LPSDFWDU HQ HO REMHWLYR HQ HO LQWHUYDOR GH  V HO GLVSRVLWLYR GH
DXWRGHVWUXFFLyQGHWRQDUiHOSUR\HFWLO

'$7267e&1,&26




)$%5,&$17(*'6%6 75$=$'XUDFLyQ!V
(63(&,),&$&,Ï1 7,(032'($&&,Ï1dPV
67$1$* 35(&,6,Ï1'HVYLDFLyQWLSLFD
',63$52 +\9PLOpVLPDV
7,32 0376' DUWLOOHUDV
3(62 aJ (03$&$'2   
352<(&7,/ 7,32(03$48(0HWiOLFR
7,320376' HVWDQFR0
0XOWLSURSyVLWRFRQ &217(1,'2
DXWRGHVWUXFFLyQ  GLVS[HVODE
3(62J 3(62NJ
,'(17,),&$&,Ï1 92/80(1 GP
/DTXHDGRDPDULOORFRQ ',0(16,21(6[[
EDQGDURMD PP
9$,1$$FHURODTXHDGR 180(5281
6,67(0$'( *5,(6*2&203$7,% 
,1,&,$&,21 &
7,32&iSVXODER[HUFRQ 12& ±±
ERRVWHU 7(03$/0$&(1$-(
',0(16,21(6 ž&Dž&
&iSVXOD‘[PP 3(621(72(;3/26,92a
%RRVWHU‘[PP NJ
&$5*$'( 3$/(7,=$'2
352<(&&,Ï1 3$/(7$'(;
7,326LPSOHEDVH &$17,'$'(PSDTXHV
3(62aJ 3(62aNJ
&$5$&7(5,67,&$6 92/80(1P
%$/Ë67,&$6
9(/2&,'$'9ž 
PV )LJXUD
35(6,Ï15(&È0$5$ 'LVSDURFRPSOHWR
3PHGLDd03D 0376'




 
)LJXUD&RUWHGHOGLVSDUR03 )LJXUD'LPHQVLRQHVGHOGLVSDUR03
76' 76'
 2MLYD $O   &DUJDGHDXWRGHVWUXFFLyQ &203$ 
 &DUJDLQFHQGLDULD 56  &DUJDWUD]DGRUD
 'LVFRGHDSR\R $O  'LVFRGHVHOODGR ODWyQ 
 &XHUSRGHOSUR\HFWLO DFHUR  'LVFRGLVWDQFLDGRU DFHUR 
 &DUJDLQFHQGLDULD 56  &DUJDGHSUR\HFFLyQ 1& 
 &DUJDH[SORVLYD 3%;1  9DLQD DFHUR 
 &DUJDLQFHQGLDULD ]LUFRQLR  0XOWLSOLFDGRU\HVWRStQ
 %DQGDGHIRU]DPLHQWR SOiVWLFR 

E',63$52;007376%

(V OD YHUVLyQ GH LQVWUXFFLyQ GHO 037 SUHVHQWDQGR VX PLVPD IRUPD SUR\HFWLO HQ
FRORU D]XO  GLPHQVLRQHV \ FDUDFWHUtVWLFDV EDOtVWLFDV  6X WUD\HFWRULD UHSURGXFH HQ
JUDQPHGLGDODGHO037
6HXVDH[FOXVLYDPHQWHSDUDHMHUFLFLRVGHLQVWUXFFLyQSRUORTXHFXHQWDWDPELpQFRQ
WUD]DSDUDREVHUYDFLyQGHODWUD\HFWRULD(OSUR\HFWLOQRGLVSRQHGHQLQJ~QDUWLILFLRGH



DXWRGHVWUXFFLyQ \ DO LPSDFWDU VREUH XQ EODQFR GXUR VH GHIRUPD R VH URPSH HQ
JUDQGHVIUDJPHQWRV

'$7267e&1,&26

)$%5,&$17(*'6DQWD%iUEDUD6LVWHPDV
(63(&,),&$&,Ï167$1$*
',63$52
7,32737
02'(/26%
3(62aJ
352<(&7,/
7,32737 (MHUFLFLR7UD]DGRU 
3(62J
,'(17,),&$&,21/DTXHDGRD]XO
9$,1$
,JXDOTXHHO037
6,67(0$'(,1,&,$&,21
,JXDOTXHHO037
&$5*$'(352<(&&,Ï1
,JXDOTXHHO037
&$5$&7(5Ë67,&$6%$/Ë67,&$6
,JXDOTXHHO037
(03$&$'2,JXDOTXHHO037VDOYR
12& ±±

3$/(7,=$'2,JXDOTXHHO037




)LJXUD'LVSDUR
FRPSOHWR737






)LJXUD'LPHQVLRQHVGHOGLVSDUR

)LJXUD&RUWHGHOGLVSDUR737 737
 2MLYD $O   'LVFRGLVWDQFLDGRU DFHUR 
 &XHUSRGHOSUR\HFWLO DFHUR   &DUJDGHSUR\HFFLyQ 1& 
 %DQGDGHIRU]DPLHQWR SOiVWLFR   9DLQD DFHUR 
 &DUJDWUD]DGRUD  0XOWLSOLFDGRU\HVWRStQ
 'LVFRGHVHOODGR ODWyQ 

F',63$52;00$3)6'67:.30&

(O GLVSDUR $3)6'67 HV XQD PXQLFLyQ GH HQHUJtD FLQpWLFD GH DOWR SRGHU GH
SHQHWUDFLyQ PX\ LQGLFDGD FRQWUD FDUURV GH FRPEDWH YHKtFXORV DFRUD]DGRV \
IRUWLILFDFLRQHVGHDUHQD\KRUPLJyQ(VHIHFWLYRWDQWRFRQWUDEOLQGDMHVKRPRJpQHRV
FRPRHVSDFLDGRV
(OSUR\HFWLOHVVXEFDOLEUDGRGHDOHDFLyQGHWXQJVWHQR\HTXLOLEUDGRSRUDOHWDV3RUVX
GLVHxR OD SpUGLGD GH HQHUJtD GXUDQWH HO YXHOR HV PX\ SHTXHxD GHELGR D VX EDMR


SHUILO DHURGLQiPLFR OR TXH OH SURSRUFLRQD XQD HOHYDGD SUHFLVLyQ /D FDUFDVD JXtD
VDERW VHGHVSUHQGHDXQRVFPGHODERFDGHOFDxyQ
(Q HO PRPHQWR GHO LPSDFWR HO SUR\HFWLO SHQHWUD D WUDYpV GH EODQFR FRQ HVFDVR
GHVJDVWH SURSLR HQ FRPSDUDFLyQ FRQ HO GHO EODQFR SURGXFLpQGRVH HQ HO LQWHULRU
DSDUWH GH ORV HIHFWRV PHFiQLFRV SURGXFLGRV SRU HO SURSLR SUR\HFWLO DOOi GRQGH
LPSDFWH XQ HIHFWR GH VREUHSUHVLyQ SUR\HFFLyQ GH IUDJPHQWRV \ XQ OLJHUR HIHFWR
LQFHQGLDULR
(O SUR\HFWLO QR WLHQH FDSDFLGDG GH DXWRGHVWUXFFLyQ SRU OR TXH VX DOFDQFH SXHGH
OOHJDUDVHUGH.P

'$7267e&1,&26

)$%5,&$17(5KHLQPHWDOO &$5$&7(5,67,&$6
:DIIH0XQLWLRQ %$/Ë67,&$6
(63(&,),&$&,Ï1 9(/2&,'$'9ž PV
',63$52 7,(0326'(98(/2
7,32 $3)6'67 PV
3(62J PV
352<(&7,/ PV
7,32 $3)6'67 75$=$ GXUDFLyQ V 
3(62J P 
3(62'(/1Ò&/(2 35(&,6,Ï1'HVYLDFLyQ
J WLSLFD+\9ž
0$7(5,$/ Q~FOHR  (03$&$'2
$OHDFLyQGHWXQJVWHQR 7,32(03$48(0HWiOLFR
9$,1$ HVWDQFR0
0$7(5,$/$FHUR &217(1,'2GLVSDURVHQ
6,67(0$'(,1,&,$&,21 FLQWDGHGLVSDURV
7,32 &iSVXODER[HUFRQ GLVSDURVXHOWRRFLQWDVGH
ERRVWHU GLVSDURVVXHOWRV
',0(16,21(6 3(62NJ
&iSVXOD‘[PP ',0(16,21(6[[
%RRVWHU‘[PP PP
&$5*$'(352<(&&,Ï1 3$/(7,=$'2
7,32 (&/ 
3(62aJ 3$/(7$'([[
PP
&$17,'$'HPSDTXHV 
3(62NJ )LJXUD
 $3'6)67





)LJXUD'LPHQVLRQHVGHOGLVSDUR$3'6)67

G081,&,21(6,1(57(6

6RQ GLVSDURV LQHUWHV VLQ SUR\HFWLO QL FDUJD GH SUR\HFFLyQ FRQ ODV PLVPDV
GLPHQVLRQHV\SHVRTXHODPXQLFLyQ0376HXWLOL]DSDUDLQVWUXLUDODWULSXODFLyQHQ
WDUHDVGHPXQLFLRQDPLHQWR$FWXDOPHQWHH[LVWHQGRVPRGHORVHQVHUYLFLR
 'LVSDUR'800<6%HVHOGLVSDURIDEULFDGRSRU*'6%6



 'LVSDUR 3,773<&($ (VHOGLVSDURIDEULFDGRSRUHO(7 73<&($ 
(VWHSXHGHHQFRQWUDUVHHQGRVYHUVLRQHVGLVSDURFRPSOHWRHQFRORUQDUDQMDR
VyORODRMLYD

H(03$48(6'(081,&,Ï10373

/DPXQLFLyQGH[VHSUHVHQWDHQXQFRQWHQHGRUPHWiOLFRGH.JGHSHVR
GRQGHVHDORMDQGLVSDURVGLVWULEXLGRVHQGRVFLQWDVGHPiVGRV  VXHOWRV


 
)LJXUD'LVWULEXFLyQLQWHULRUGHORV )LJXUD8QDGHODVFLQWDVGH
GLVSDURV GLVSDURV

E'RWDFLyQ

/DGRWDFLyQGHPXQLFLyQHVODVLJXLHQWH
 (PSOHRLQPHGLDWR WRWDODPERVFDUJDGRUHV 
&DUJDGRUGHUHFKR
&DUJDGRUL]TXLHUGR
 5HVHUYDDOPDFHQDGDWRWDO FDVFR 
0XOWLSURSyVLWR
3HUIRUDQWH
 7RWDOPXQLFLyQ

1RUPDOPHQWH\DOWHQHUHOFDUJDGRUGHUHFKRPD\RUFDSDFLGDGVXHOHFDUJDUVHFRQ
HO WLSR GH PXQLFLyQ GH PD\RU HPSOHR URPSHGRUDLQFHQGLDULD R PXOWLSURSyVLWR 
UHVHUYiQGRVHHOL]TXLHUGRSDUDODPXQLFLyQSHUIRUDQWH


127$
&DGDFDUJDGRUGHEHVHUFDUJDGRFRQHOPLVPRWLSRGHPXQLFLyQ


$/,0(17$&,Ï1<(;38/6,Ï1'(081,&,Ï1

/DDOLPHQWDFLyQGHOFDxyQODSURSRUFLRQDQVHQGRVFDUJDGRUHVVLWXDGRVDDPERV
ODGRVGHODWRUUH'HVGHHOORV\DWUDYpVGHJXtDVUtJLGDV\GHJXtDVIOH[LEOHVVH
DOFDQ]DHOGREOHDOLPHQWDGRU )LJ 







)LJXUD6LWXDFLyQGHORVFDUJDGRUHV

(QODILJXUDVHLQGLFDQORVGLVWLQWRVHOHPHQWRVHQFDUJDGRVGHODUHFRJLGDGH
YDLQDV \ HVODERQHV GHO FDxyQ \ $0 FRD[LDO DVt FRPR ORV HOHPHQWRV ILQDOHV GH OD
DOLPHQWDFLyQ7RGRVORVHOHPHQWRVTXHLQWHUYLHQHQHQODDOLPHQWDFLyQVHGHVFULELUiQ
PiVH[WHQVDPHQWHDOGHVFULELUORVFDUJDGRUHVWDQWRGHOFDxyQFRPRGHOD$0





)LJXUD(OHPHQWRVILQDOHVGHDOLPHQWDFLyQ\H[SXOVLyQ

D&DUJDGRUGHUHFKR )LJ 

7LHQHXQDFDSDFLGDGGHGLVSDURV SUHIHUHQWHPHQWHPXQLFLyQPXOWLSURSyVLWR03
R +(,  'LVSRQH GH XQ VHQVRU VLWXDGR HQ HO SLVR GH OD JXtD UtJLGD TXH GHWHFWD XQ
SUy[LPRILQGHODFLQWDDQXQFLDQGR³),1&,17$´HQODV8QLGDGHVGH&RQWUROGHO-9\
7LUDGRU&XDQGRVHHQFLHQGHHOLQGLFDGRUGLVSRQHD~QGHGLVSDURV
(VWiFRQVWLWXLGRSRUGRVFRQMXQWRV
 &XHUSR   (V HO DOPDFpQ SULQFLSDO GH ORV GLVSDURV GLVSXHVWRV HQ SRVLFLyQ
YHUWLFDO (VWiIRUPDGR
o /D SODFD LQIHULRU   TXH OOHYD PHFDQL]DGR HO FDPLQR GH URGDGXUD  
SRU GRQGH VH PXHYHQ ORV FXORWHV GH ORV GLVSDURV VREUH URGLOORV GH
EURQFH FDPELDQGR VX GLUHFFLyQ PHGLDQWH SODWRV FLUFXODUHV TXH JLUDQ
VREUHURGDPLHQWRV
o /D SODFD LQWHUPHGLD   FX\D SULQFLSDO PLVLyQ HV KDFHU GH JXtD DO
FDPLQRGHORVGLVSDURV
o /DSODFDVXSHULRU  TXHFLHUUDHOFDUJDGRUSRUODSDUWHVXSHULRU
o 9HQWDQDGHD\XGDGHFDUJD  
o 0RWRUGHDUUDVWUHGHODPXQLFLyQKDFLDHODUPD  

7RGRHOFDUJDGRUHVWiFDUHQDGR\GLVSRQHGHXQDYHQWDQDGHD\XGDGHFDUJD
  GHVPRQWDEOH \ YDULRV UHJLVWURV SDUD SHUPLWLU OD PDQLSXODFLyQ GH OD FLQWD
GHQWURGHOFXHUSRHQHOSURFHVRGHFDUJD$VLPLVPRGLVSRQHGHXQDOiPSDUD
 GHLOXPLQDFLyQLQWHULRU



 *XtDUtJLGD  (VHOWUDPRLQWHUPHGLRHQWUHHOFXHUSR\ODJXtDIOH[LEOHWLHQH
HOIURQWDO  GHVPRQWDEOHFRPRYHQWDQDGHFDUJDGHPXQLFLyQ(QVXH[WUHPR
 VHHQFXHQWUDODSLH]DGHDFRSODPLHQWRFRQODJXtDIOH[LEOH




)LJXUD&DUJDGRUGHUHFKR

E&DUJDGRUL]TXLHUGR )LJ 

7LHQH XQD FDSDFLGDG GH  GLVSDURV \ FXDQGR HO VHQVRU DQXQFLD ³),1 &,17$´
VLWXDGRFRPRHQHOFDUJDGRUGHUHFKRHQHOSLVRGHODJXtDUtJLGD VHGLVSRQHD~Q
GHGLVSDURV
(VWi FRQVWUXLGR FRQ OD PLVPD ILORVRItD \ FRQVWLWXFLyQ TXH HO GHUHFKR DXQTXH FRQ
PHQRU FDSDFLGDG 'LVSRQH DVLPLVPR GH XQD JXtD UtJLGD   \ XQD SLH]D GH
DFRSODPLHQWRFRQODJXtDIOH[LEOHL]TXLHUGD  
7LHQHXQDYHQWDQDGHFDUJDGHVPRQWDEOH  GRVUHJLVWURVGHD\XGD\REVHUYDFLyQ
 \XQPRWRUGHDUUDVWUH  






)LJXUD&DUJDGRUL]TXLHUGR

F*XtDVIOH[LEOHV )LJ 

/DVJXtDVIOH[LEOHVFRQHFWDQORVFDUJDGRUHVGHPXQLFLyQ L]TXLHUGR\GHUHFKR FRQ
HO'$/SHUPLWLHQGRJUDFLDVDVXDOWDIOH[LELOLGDGHOVHJXLPLHQWRGHORVPRYLPLHQWRV
GHHOHYDFLyQ\GHGHSUHVLyQGHOFDxyQ

G&RQWHQHGRUHVGHPXQLFLyQ

&RPRFRPSOHPHQWRDORVFDUJDGRUHVGHPXQLFLyQGHHPSOHRLQPHGLDWRH[LVWHQXQD
VHULHGHFRQWHQHGRUHVUHSDUWLGRVSRUWRGDODFiPDUDGHSHUVRQDOSDUDWUDQVSRUWHGH
PXQLFLyQGHUHVSHWRGHPP[FRQXQDFDSDFLGDGGHGLVSDURV


$/,0(17$&,Ï1'(/&$fÏ1

  3RQHU HO SHVWLOOR GH OD FDEH]D GH PDQGR )LJ  Qž  GH OD UXHGD
DOLPHQWDGRUDL]TXLHUGDGHO'$/HQODSRVLFLyQGHHPEUDJDGR HQYHUWLFDO (Q
HOFDVRGHOFDUJDGRUGHUHFKRVHDFW~DVREUHODUXHGDDOLPHQWDGRUDGHUHFKD\
VXHPEUDJXH
  &RQODOODYHGHFDUUDFD )LJQž HQHOWHWyQFRUUHVSRQGLHQWHHIHFWXDU
XQPRYLPLHQWRFRQWLQXRGHGHUHFKDDL]TXLHUGDFRPRLQGLFDQODVIOHFKDVTXH
KDJD JLUDU OD FDEH]D GH PDQGR GH OD UXHGD GH DOLPHQWDFLyQ KDVWD TXH VH
LQWURGX]FDQ ORV WUHV SULPHURV GLVSDURV HQ ODV UXHGDV GHQWDGDV GH
DOLPHQWDFLyQ )LJ 
  ,QWURGXFLU SRU OD YHQWDQD GH OD JXtD UtJLGD XQ ~OWLPR WUDPR GH VHLV GLVSDURV
FRQ HVODEyQ YDFtR HQ VXV GRV H[WUHPRV \ HQJUDSDUOR SRU OD L]TXLHUGD FRQ HO
~OWLPRGLVSDURGHORVWUDPRVLQWURGXFLGRVHQODJXtDIOH[LEOH\SRUODGHUHFKD



FRQ HO HVODEyQ YDFtR GHO ~OWLPR WUDPR LQWURGXFLGR HQ HO FXHUSR GHO FDUJDGRU
5HOOHQDUDPERVHVODERQHVFRQGRVGLVSDURVVXHOWRV
  5HWLUDUODOODYHGHFDUUDFD




)LJXUD$OLPHQWDFLyQGHOFDxyQ &DUJDLQLFLDOGHPXQLFLyQHQHO'$/ 





)LJXUD'LVSDURVHQSRVLFLyQGH³FDxyQDOLPHQWDGR´

(Q HO FDVR GH TXH SRU FXDOTXLHU FDXVD VHD QHFHVDULR GHVDOLPHQWDU HO DUPD \
VLHPSUHDOILQDOL]DUHOWLURRSHUDUGHODVLJXLHQWHPDQHUD
  'HVHPEUDJDUODVUXHGDVDOLPHQWDGRUDV
  'HVDFRSODUODJXtDIOH[LEOH
  &RQ OD OODYH GH FDUUDFD DFWXDU HQ VHQWLGR FRQWUDULR DO GH DOLPHQWDFLyQ SDUD
H[WUDHUODPXQLFLyQGHO'$/D\XGDQGRPDQXDOPHQWHGHVGHODJXtD IOH[LEOHR
UtJLGDVLKXELHUDPXFKDPXQLFLyQ


$/,0(17$&,Ï1'(/&$fÏ1

D&DUJDGRUGHUHFKR




6LQRVHKDDFWXDGRVREUHHOSXOVDGRU),1&,17$ UHFRUGHPRVTXHHOSXOVDGRU),1
&,17$SHUPLWHGLVSDUDUWRGDODPXQLFLyQHQFDVRQHFHVDULR TXHGDUiQHQHOVLVWHPD
GLVSDURV
 HQHODOLPHQWDGRU
 HQODJXtDIOH[LEOH
 HQODJXtDUtJLGD

2SHUDFLRQHVSDUDUHFDUJDU
  5HDOL]DU ORV SDVRV           <  FRUUHVSRQGLHQWHV DO PXQLFLRQDPLHQWR
GHOFDUJDGRUGHUHFKR7HQGUHPRVHOFXHUSRGHOFDUJDGRUFRQGLVSDURV
  ,QWURGXFLUXQ~OWLPRWUDPRGHWUDPRGHGLVSDURV
  (QOD]DU HVWD JUDSD FRQ OD GHO GLVSDUR  TXH UHVWD HQ OD JXtD UtJLGD GHO
FDUJDGRU\FRQHO~OWLPRGLVSDURGHOWUDPRLQWURGXFLGRFRQODJUDSDYDFtDGH
ODFDUJD\DUHDOL]DGDHQHOFXHUSRGHOFDUJDGRU
  5HOOHQDUDPEDVJUDSDVFRQGLVSDURVVXHOWRV

E&DUJDGRUL]TXLHUGR

6LQRVHKDDFWXDGRVREUHHOSXOVDGRU),1&,17$TXHGDUiQHQHOVLVWHPD
GLVSDURV
 HQHODOLPHQWDGRU
 HQODJXtDIOH[LEOH
 HQODJXtDUtJLGD

2SHUDFLRQHVSDUDUHFDUJDU
  5HDOL]DU ORV SDVRV       \   H[SOLFDGRV SDUD HO FDUJDGRU GHUHFKR
DSOLFDGRVDOFDUJDGRUL]TXLHUGR
  &RQWLQXDU LQWURGXFLHQGR WUDPRV SRU HO PLVPR SURFHGLPLHQWR \ HPSXMiQGRORV
DOLQWHULRUGHOFXHUSRGHOFDUJDGRUD\XGiQGRORVVLHVQHFHVDULRDWUDYpVGHOD
YHQWDQDGHFDUJD\GHOUHJLVWURVXSHULRUGHOFXHUSRGHOFDUJDGRUKDVWDTXHOD
JUDSDOLEUHGHOSULPHUWUDPRLQWURGXFLGRFRQWDFWHFRQHOGLVSDURTXHUHVWD
HQHOILQDOGHODJXtDIOH[LEOH
  $ WUDYpV GH OD YHQWDQD UHJLVWUR GH HQODFH GHO FXHUSR GHO FDUJDGRU UHWLUDU HO
~OWLPRGLVSDURGHODPXQLFLyQTXHTXHGDHQODJXtDIOH[LEOH\HQOD]DUODFLQWD
H[LVWHQWHFRQODQXHYDTXHVHKDHVWDGRLQWURGXFLHQGR\UHOOHQDUODJUDSDFRQ
HOGLVSDURUHWLUDGRDQWHULRUPHQWH
  ,QWURGXFLU XQ ~OWLPR WUDPR GH VHLV GLVSDURV FRQ JUDSD OLEUH \ UHOOHQDU FRQ XQ
GLVSDUR (QJUDSDU FRQ HO ~OWLPR GLVSDUR GH OD FLQWD \ UHOOHQDU FRQ XQ GLVSDUR
VXHOWR


5(680(1

(QHVWDILFKDVHGHVFULEHQODVGLIHUHQWHVPXQLFLRQHV\DUWLILFLRVGHXVRHQHO9&,DVt
FRPR ORV SURFHGLPLHQWRV GH DOLPHQWDFLyQ GH ODV PLVPDV QR VH FRQVLGHUD
FRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6



6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVFRQWRGRVORVSDQHOHVGHDFFHVRDODFiPDUD
GHDUPDV\FDUJDGRUHVFRORFDGRV/DEROVDGHDFFHVRULRVGHWRUUHVHHQFRQWUDUiHQ
VXOXJDU(OYHKtFXORVHHQFRQWUDUiVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVHOD
WRUUHOLEUHPHQWH&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

([SOLFDUiORVGLIHUHQWHVWLSRVGHPXQLFLRQHVGHPP
([SOLFDUiODUHYLVLyQSUHPXQLFLRQDPLHQWRGHODPXQLFLyQ HVODERQDGR 
4XLWDUiORVSDQHOHVGHDFFHVRDOFDUJDGRUDPXQLFLRQDU\RWURVSDQHOHVGHDFFHVRD
ODVJXtDVIOH[LEOHVFDxyQHWFQHFHVDULRVDX[LOLDGRSRURWURWULSXODQWH
5HDOL]DUiHOPXQLFLRQDPLHQWRHQFDGDFDVRDX[LOLDGRSRURWURWULSXODQWH
([SOLFDUi\OOHYDUDDFDERODDOLPHQWDFLyQGHOGREOHDOLPHQWDGRU
5HDOL]DUiHQFDGDFDVRODUHWLUDGDGHODPXQLFLyQGHO'$/\GHORVFDUJDGRUHV


6,78$&,Ï1),1$/

(O9&,VHHQFRQWUDUiFRQODPXQLFLyQLQHUWHHQDPERVFDUJDGRUHV\'$/FRQWRGRV
ORVSDQHOHVGHDFFHVRDODFiPDUDGHDUPDV\FDUJDGRUHVFHUUDGRV


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

'HEHQVDFDUVHODPXQLFLyQGHO'$/\FDUJDGRUHVFRORFDUORVSDQHOHVGHDFFHVRD
ODFiPDUDGHDUPDV\FDUJDGRUHV\SRQHUODPXQLFLyQLQHUWHHQODSDUWHWUDVHUDGHO
9&,



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1$0(75$//$'25$0*±6

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVSRU7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV
3DUD OD SUiFWLFD VH FRORFDUi XQ YHKtFXOR HQ XQ OXJDU DSURSLDGR SDUD SRGHU PRYHU
OLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVXPRYLPLHQWR(OWULSXODQWH
VH VLWXDUi HQ HO SXHVWR GHO  -HIH GH 9HKtFXOR SDUD UHDOL]DU ODV RSHUDFLRQHV GH
PRQWDMHGHODDPHWUDOODGRUDHQHODIXVWH\RSHUDFLRQHVGHFDPELRGHFDxyQ3DUDOD
SUiFWLFDGHGHVSLHFHGHOD0*6VHGLVSRQGUiGHXQDPHVD

5(48,6,726$$/&$1=$5

(O WULSXODQWH GHEH VDEHU GHVPRQWDU \ PRQWDU  OD DPHWUDOODGRUD 0* \ VDEHU HO
IXQFLRQDPLHQWREiVLFR$GHPiVHOWULSXODQWHVDEUiPRQWDUODDPHWUDOODGRUDHQHO9&,
\UHDOL]DUXQFDPELRGHFDxyQ

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
 GH DFLHUWRV VLQ FRPHWHU IDOORV HQ FXDQWR D OD VHJXULGDG GH ODV DUPDV TXH
LPSOLFDUtDQRVXSHUDUODWDUHD

'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6$0(75$//$'25$&2$;,$/

(ODUPDPHQWRVHFXQGDULRHVWiFRPSXHVWRSRUXQDDPHWUDOODGRUD0*6HQ
PRQWDMHFRD[LDOFRQHOFDxyQ6XVFDUDFWHUtVWLFDVVHGHWDOODQHQHO0DQXDO7pFQLFR
FRUUHVSRQGLHQWHDOYHKtFXOR

D&RQMXQWRDPHWUDOODGRUDFRD[LDO )LJ 




/D DPHWUDOODGRUD FRD[LDO YD PRQWDGD VREUH XQ DIXVWH HOiVWLFR ILMDGR D OD FXQD GHO
FDxyQ
(OPHFDQLVPRGHGLVSDURVHDFFLRQDHOpFWULFDPHQWHSRUPHGLRGHXQVROHQRLGH  
TXH DFW~D VREUH HO GLVSDUDGRU GH OD PiTXLQD /RV GLVSDUDGRUHV HOpFWULFRV YDQ
LQFRUSRUDGRV HQ ORV PDQGRV GHO -HIH GH 9HKtFXOR \ GHO 7LUDGRU \ VRQ ORV PLVPRV
TXHVHXWLOL]DQSDUDHOFDxyQ



)LJXUD&RQMXQWR$0FRD[LDO\DFFHVRULRV

 0DQJXLWRJXtDGHOD$0  7LUDGRU GH GHVEORTXHR GHO
 7ROYDGHDOLPHQWDFLyQ VRSRUWHSRVWHULRU
 7ROYDLQWHUPHGLD  6RSRUWHSRVWHULRUGHVOL]DQWH
DOLPHQWDFLyQH[SXOVLyQ  3DODQFDGHPRQWDU
 6ROHQRLGHGHGLVSDUR *XtDSRVWHULRU
 *XtDDQWHULRU 7XHUFDGHDMXVWH
 6RSRUWHDQWHULRU


D  &21-8172$0(75$//$'25$&2$;,$/ )LJ 

/DSRVLFLyQGHODDPHWUDOODGRUDSDUDHOGLVSDURYLHQHILMDGDSRUHOPDQJXLWRJXtD  
\ XQ DIXVWH DFRSODGR D OD FXQD \ TXH ILMD OD SDUWH SRVWHULRU (O DIXVWH FRQVWD
EiVLFDPHQWH GH GRV VRSRUWHV XQR DQWHULRU   \ RWUR SRVWHULRU   H[WHQVLEOH KDFLD
DWUiVSDUDSHUPLWLUODFRORFDFLyQGHODDPHWUDOODGRUD\ODVRSHUDFLRQHVGHFDPELRGH
FDxyQ





)LJXUD$IXVWHGHODDPHWUDOODGRUDFRD[LDO

 0DQJXLWRJXtD  3ODFDGHILMDFLyQDODFXQD
 6RSRUWHDQWHULRU  &RQWDFWRVVROHQRLGHGHGLVSDUR
 6RSRUWHSRVWHULRU  (MHGHOVRSRUWHSRVWHULRU

D  (/(0(17263(5,)e5,&26 )LJV\ 

/RVSHULIpULFRVVRQHOHPHQWRVTXHIDFLOLWDQHOPDQHMRGHODDPHWUDOODGRUDLPSXHVWRV
SRUVXVLWXDFLyQHQHOYHKtFXOR


)LJXUD(OHPHQWRVSHULIpULFRVGHOD$0FRD[LDO  

1ž '(120,1$&,Ï1 )81&,Ï1


 72/9$'($/,0(17$&,Ï1 )DFLOLWDODDOLPHQWDFLyQGHODUPDHYLWDQGR
HQJDQFKHV
 62/(12,'('(',63$52 3HUPLWHHOGLVSDURHOpFWULFRGHOD
DPHWUDOODGRUDGHVGHORVPDQGRVGHO-9\
7LUDGRU
 *8Ë$$17(5,25 3HUPLWHODILMDFLyQGHODDPHWUDOODGRUDHQHO
VRSRUWHDQWHULRU\ODFRQH[LyQHOpFWULFDGHO
VROHQRLGH
 3$/$1&$'(5(7(1,'$ )LMDODJXtDHQHOVRSRUWH3UHVLRQiQGROD
SHUPLWHGHVEORTXHDUODJXtDSDUDH[WUDHUOD
DPHWUDOODGRUD
 $6$'(/$3$/$1&$'(0217$5
 3(67,//2'(%/248(2 )LMDODSRVLFLyQGHODSDODQFDGHPRQWDU
'(//$3$/$1&$'( 3DUDSRGHUPRQWDUHODUPDKD\TXH
0217$5 SUHVLRQDUOR
 3$6$'25'(%/248(2 )LMDHOYiVWDJRGHODSDODQFDGHPRQWDUHQ
VXJXtD )LJ 
 *8Ë$3267(5,25 6LUYHGHDSR\RGHODDPHWUDOODGRUDVREUHHO
VRSRUWHSRVWHULRU$VLPLVPRVLUYHGHJXtDD
ODSDODQFDGHPRQWDUPHGLDQWHXQDVRUHMHWDV
TXHWLHQHHQVXODGRGHUHFKR )LJQž
 
 3$/$1&$'(0217$5 3DODQFDTXHSHUPLWHHOPRQWDMHGHOFLHUUH
6XIRUPDDODUJDGDIDFLOLWDODRSHUDFLyQGDGD
ODDQJRVWDSRVLFLyQGHODUPD
 *8Ë$'(/$3$/$1&$'(0217$5
 08(//('(/3(67,//2'(%/248(2




)LJXUD(OHPHQWRVSHULIpULFRVGHOD$0FRD[LDO  




)LJXUD(OHPHQWRVSHULIpULFRVGHOD$0FRD[LDO  


35(3$5$&,Ï1'(/$$0(75$//$'25$&2$;,$/

D,QVWDODFLyQHQVXDIXVWH

  5HWLUDUHOSDQHOTXHGDDFFHVRDODIXVWH )LJ 




)LJXUD3DQHOGHDFFHVRDOD$0FRD[LDO

  ,QWURGXFLU OD $0 SRU OD HVFRWLOOD GHO -9 FRQ OD ERFDFKD KDFLD DEDMR KDFLD HO
IRQGRGHODFiPDUDGHFRPEDWHKDVWDTXHVXSDUWHSRVWHULRUVDOYHODHVFRWLOOD
$FRQWLQXDFLyQPRYHUODKDFLDDWUiVFXLGDQGRGHQRJROSHDUODUDGLRHQFDUDUOD
KDFLDHOPDQJXLWRJXtDHLQWURGXFLUODHQODFiPDUDGHDUPDV


  8QDYH]HQFDUDGD\DSR\DGDSRUODERFDFKDHQHOPDQJXLWRJXtD )LJXUD
Qž   UHWUDVDU HO VRSRUWH SRVWHULRU )LJXUD  Qž  OLEHUiQGROR GH VX WHWyQ
WLUDQGR GHO ERWyQ GH GHVEORTXHR )LJXUD  Qž   KDFLD IXHUD \ DSR\DU OD
JXtDSRVWHULRU )LJXUDQž HQHOVRSRUWHSRVWHULRU



)LJXUD0RQWDMHOD$0FRD[LDOHQVXDIXVWH  

  'HVOL]DUHOFRQMXQWRKDFLDGHODQWHDMXVWDQGRODJXtDDQWHULRU )LJXUDQž 
HQHOVRSRUWHDQWHULRU )LJXUDQž 



)LJXUD0RQWDMHOD$0FRD[LDOHQVXDIXVWH  

  $O DFRSODUVH VH FRQHFWDUiQ ORV FRQWDFWRV )LJXUD  Qž   TXH DFWLYDQ HO
VROHQRLGH GH GLVSDUR )LJXUD  Qž   \ VH EORTXHDUiQ ORV SHVWLOORV GH
UHWHQLGDGHDPEDVJXtDV )LJXUDQž\ ILMDQGRODDPHWUDOODGRUDHQVX
SRVLFLyQGHILQLWLYD )LJXUD 






)LJXUD0RQWDMHOD$0FRD[LDOHQVXDIXVWH  




)LJXUD$0FRD[LDOOLVWDSDUDRSHUDU

  3DUD UHWLUDU OD DPHWUDOODGRUD SURFHGHU HQ VHQWLGR FRQWUDULR DO H[SOLFDGR
OLEHUDQGRDPEDVJXtDVGHVXVEORTXHRVWLUDQGRKDFLDIXHUDGHOERWyQ )LJXUD
Qž \SUHVLRQDQGRKDFLDDUULEDHOSHVWLOOR )LJXUDQž 

E([WUDFFLyQ

  6ROWDU\UHWLUDUODYHQWDQDUHJLVWURGHDFFHVRDODDPHWUDOODGRUD


  $EULU OD WDSD GHO FDMyQ GH PHFDQLVPRV \ UHWLUDU OD FLQWD GH PXQLFLyQ VL HVWi
SXHVWD


)LJXUD([WUDFFLyQGHOD 
DPHWUDOODGRUD   )LJXUD([WUDFFLyQGHOD$0  

  7LUDUKDFLDODL]TXLHUGDGHOSHVWLOORGHEORTXHR  GHODFRUUHGHUD\GHVSOD]DU
KDFLDDWUiVHOVRSRUWH  GHODFRUUHGHUDKDVWDTXHKDJDWRSHFRQHOUHVDOWH
GHOYiVWDJR  GHOVRSRUWHGHOFLHUUH  
  &RQ HO SXOJDU GH OD PDQR L]TXLHUGD HPSXMDU KDFLD DUULED HO SHVWLOOR   GH
ILMDFLyQGHODIXVWHHOiVWLFRDOVRSRUWHGHODFRUUHGHUD
  0DQWHQLpQGROR HQ HVD SRVLFLyQ FRQ OD PDQR GHUHFKD WLUDU GH OD SDODQFD GH
PRQWDU  KDFLDDWUiVDWRSHSDUDVDFDUODDPHWUDOODGRUDGHVXDORMDPLHQWRHQ
FXQD
  7RGRHOFRQMXQWRGHODDPHWUDOODGRUDVHGHVOL]DUiKDFLDDWUiVSRUODEDUUDJXtD
 
  &RJLHQGRFRQODPDQRL]TXLHUGDSRUODSDUWHFHQWUDOGHODOLPHQWDGRU  \FRQ
ODPDQRGHUHFKDSRUODSDODQFDGHPRQWDU  VHOHYDQWDHODUPD\VHH[WUDH


 
 
)LJXUD([WUDFFLyQGHOD$0   )LJXUD([WUDFFLyQGHOD$0  






)LJXUD([WUDFFLyQGHOD$0  


&$0%,2'(&$fÏ1




)LJXUD&DPELRGHFDxyQ



  5HWLUDUHOUHJLVWURGHDFFHVRDOD$0
  5HWLUDUODFLQWDGHPXQLFLyQ
  0RQWDUHODUPD )LJQž OOHYDQGRGHQXHYRODSDODQFDGHPRQWDUKDFLD
DGHODQWH
  &RORFDUHOVHJXUR  HQODSRVLFLyQ6
  6DFDU OD $0 GHO VRSRUWH GHODQWHUR GHO DIXVWH OOHYDUOD D OD SRVLFLyQ PiV
UHWUDVDGD
  *LUDU D FRQWLQXDFLyQ OD DPHWUDOODGRUD ž D OD L]TXLHUGD \ DSR\DUOD VREUH HO
WHWyQ GHUHFKR   GHO DIXVWH SDUD WHQHU DFFHVR DO ODWHUDO GHUHFKR GH OD
DPHWUDOODGRUD
  8QDYH]TXHWHQHPRVDFFHVRDODWDSDDEULUOD\SURFHGHUDOFDPELRGHFDxyQ
FRPRVHLQGLFDHQHO0DQXDO7pFQLFRGHODPLVPD



3(/,*52
86$5*8$17(6'(3527(&&,Ï1$/&$0%,$5/26&$f21(6&$/,(17(6
38('(1352'8&,548(0$'85$6*5$9(6


5(680(1

(QHVWDILFKDVHGHVFULEHQHLGHQWLILFDQORVHOHPHQWRVGHODDPHWUDOODGRUD0*6
1RVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6

6,78$&,Ï1,1,&,$/

$PHWUDOODGRUD FRD[LDO HQ XQD PHVD VLQ GHVSLH]DU 8Q 9&, FRQ ODV HVFRWLOODV GH OD
WRUUHDELHUWDV\FRQWRGRVORVSDQHOHVGHDFFHVRDODFiPDUDGHDUPDV\FDUJDGRUHV
FRORFDGRV /D EROVD GH DFFHVRULRV GH WRUUH VH HQFRQWUDUi HQ VX OXJDU &DGD
HYDOXDGR VXELUi DO SXHVWR GHO -HIH GH 9&, SDUD UHDOL]DU ODV RSHUDFLRQHV GH
FRORFDFLyQHQDIXVWHGHOD0*\FDPELRGHFDxyQ


$&&,21(6$5($/,=$5

0RQWDMH\GHVPRQWDMHGHODDPHWUDOODGRUDFRPSOHWD
0RQWDMHGHODDPHWUDOODGRUDHQVXDIXVWHGHO9&,
5HDOL]DUXQFDPELRGHFDxyQ


6,78$&,Ï1),1$/

/D DPHWUDOODGRUD 0*6 TXHGDUD LQVWDODGD HQ HO 9&, FRQ ORV SDQHOHV GH DFFHVR
FRORFDGRVWUDVKDEHUUHDOL]DGRXQFDPELRGHFDxyQ



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1081,&,21$0,(172'(/$$0(75$//$'25$0*

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVSRU7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV
3DUD OD SUiFWLFD VH FRORFDUi XQ YHKtFXOR HQ XQ OXJDU DSURSLDGR SDUD SRGHU PRYHU
OLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVXPRYLPLHQWR
(O WULSXODQWH VH VLWXDUi HQ HO SXHVWR GHO  -HIH GH 9HKtFXOR SDUD UHDOL]DU ODV
RSHUDFLRQHV GH DOLPHQWDFLyQ GH OD DPHWUDOODGRUD \ HQ OD SDUWH GH OD XQLGDG
WUDQVSRUWDGDSDUDPXQLFLRQDUORVFDUJDGRUHVHLQWURGXFLUORVHQVXFRPSDUWLPHQWRHQ
ODWRUUH


5(48,6,726$$/&$1=$5

(OWULSXODQWHGHEHVDEHUUHDOL]DUHOPXQLFLRQDPLHQWR\FDUJDGHODDPHWUDOODGRUD0*
6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

081,&,21$0,(172'(/$$0(75$//$'25$


3(/,*52
$3$*$5 /$ 7255( 7255( 2))  6,(035( 48( 6( ()(&7Ò(1
23(5$&,21(6 (1 /26 $/0$&(1(6 '( &$5*$ 3$5$ 6$&$5 2
,1752'8&,5/26&$5*$'25(6


D/OHQDGRGHORVFDUJDGRUHV



/RV FDUJDGRUHV KDQ GH OOHQDUVH FRPR PXHVWUD OD ILJXUD  FXLGDQGR GH VLWXDU HO
LQLFLRGHODFLQWDGRQGHVHPXHVWUDFHUUDQGRHOKXHFRGHOVHQVRUGHILQGHFLQWD'H
pVWH PRGR DO LQWURGXFLU HO FDUJDGRU HQ VX DORMDPLHQWR VH SLVD HO VHQVRU GH ILQ GH
FLQWD


)LJXUD&RORFDFLyQGHODFLQWDHQHOFDUJDGRU


127$
(Q FDVR GH HIHFWXDU XQD FDUJD SDUFLDO FLQWD GH  FDUWXFKRV SH  HIHFWXDU OD
RSHUDFLyQ FRPR VL GH XQD FDUJD FRPSOHWD VH WUDWDUD OOHQDQGR FRPSOHWDPHQWH ORV
FRPSDUWLPHQWRVRFXSDGRV


$/,0(17$&,Ï1'(/$$0(75$//$'25$

  *LUDUODWRUUHDODVSDUDTXHHODOPDFpQGHFDUJDTXHGHDFFHVLEOHGHVGHOD
FiPDUDGHO(&3
  3RQHUODWRUUHHQ2))
  $EULU OD SXHUWD GHO DOPDFpQ GH FDUJD )LJ  Qž  OLEHUDQGR ORV SHVWLOORV
)LJQž HLQWURGXFLUHOFDUJDGRUHQHODOPDFpQGHFDUJDHPSXMiQGRORD
WRSHKDVWDTXHTXHGHUHWHQLGRSRUHOSHVWLOORGHILMDFLyQ )LJQž 





)LJXUD$OLPHQWDFLyQGHODDPHWUDOODGRUD  

  &HUUDUODSXHUWDGHODOPDFpQGHFDUJDFRPSUREDQGRTXHTXHGDDVHJXUDGD\
JLUDUODWRUUHDODV
  $EULU \ UHWLUDU OD WDSD GH DFFHVR D OD $0 3RU HO KXHFR H[LVWHQWH PHWHU HO
EUD]R L]TXLHUGR \ FRJHU HO H[WUHPR GH OD FLQWD GH PXQLFLyQ GHO FDUJDGRU \
SDVDUODSRUODWROYDGHDOLPHQWDFLyQ )LJ 


)LJXUD$OLPHQWDFLyQGHODDPHWUDOODGRUD  

  3RQHUHOVHJXURPHFiQLFR )LJQž GHODDPHWUDOODGRUDHQ)
  /LEHUDUODSDODQFDGHPRQWDUSUHVLRQDQGRHOSHVWLOOR )LJQž \WLUDUGH
ODSDODQFDGHPRQWDU )LJQž SDUDPRQWDUHOFLHUUH/OHYDUQXHYDPHQWH
DGHODQWHODSDODQFDGHPRQWDU
  3RQHUGHQXHYRHOVHJXURGHODDPHWUDOODGRUDHQ6
  /HYDQWDUODWDSDGHOFDMyQGHORVPHFDQLVPRV  \FRORFDUODFLQWD VLQVRODSD
GHSULQFLSLRGHFLQWD HQODWHMD  \YROYHUDFHUUDUODWDSD(QDPERVFDVRVHO
SULPHUFDUWXFKRGHODFLQWDGHEHDVHQWDUVHHQHOWRSHGHODWHMD
 &RORFDU GH QXHYR HO VHJXUR HQ ) \ FHUUDU OD WDSD GH DFFHVR D OD
DPHWUDOODGRUD





)LJXUD$OLPHQWDFLyQGHODDPHWUDOODGRUD  


127$
/DDPHWUDOODGRUDQRSRGUiGLVSDUDUVHDOHVWDUVHOHFFLRQDGR6(*85 VHJXUR 

D 5HFDUJD GH OD DPHWUDOODGRUD KDELpQGRVH HQFHQGLGR HO LQGLFDGRU GH ILQ
GHFLQWD

D  6XVWLWXLUHOFDUJDGRUYDFtRSRUHOGHUHVSHWR
E  *LUDUODWRUUHDODV
F  3RU OD YHQWDQD GH DFFHVR D OD DPHWUDOODGRUD FRJHU \ WLUDU GH OD FLQWD GH
PXQLFLyQ GHO FDUJDGRU \ XQLU VX H[WUHPR FRQ HO H[WUHPR OLEUH GH OD FLQWD GH
PXQLFLyQ TXH DOLPHQWD OD DPHWUDOODGRUD 5HDOL]DU OD XQLyQ FRQ XQ FDUWXFKR
VXHOWR


&$-$6'(081,&,Ï1'($0(75$//$'25$

D0XQLFLyQGHODDPHWUDOODGRUDFRD[LDO

/DGRWDFLyQWRWDOGHPXQLFLyQGH[PPHVGHGLVSDURVGLVWULEXLGRVGH
ODVLJXLHQWHPDQHUD
 &DUJDGRUGHODUPDGLVSDURV
 &DUJDGRUGHUHVSHWRGLVSDURV
 &DMDVGHUHVSHWRGHGLVSDURVGLVSDURV

/D DPHWUDOODGRUD XWLOL]D PXQLFLyQ JHQpULFD 1$72  [  PP FX\RV SULQFLSDOHV
WLSRVVRQORVVLJXLHQWHV )LJ 






)LJXUD7LSRVGHPXQLFLyQ1$72[PP

'HWRGRVHOORVORVXWLOL]DGRVDFWXDOPHQWHWDQWRHQFLQWD'0FRPRHQ'0VRQHO
25',1$5,2\HO75$=$'25
/DDPHWUDOODGRUDFRD[LDOSXHGHGLVSDUDUWDQWRODPXQLFLyQHQFLQWD'0GHJXVDQLOOR
WUDPRV GH  FDUWXFKRV HPSDOPDEOHV  FRPR OD HQFLQWDGD '0 GH HVODEyQ
PHWiOLFR GHVLQWHJUDEOH eVWD ~OWLPD GHEHUi VHU OD XWLOL]DGD SUHIHUHQWHPHQWH \D TXH
VH VXPLQLVWUD HQ FDMDV GH  FDUWXFKRV HVODERQDGRV HQ XQD FLQWD FRQWLQXD HQ OD
SURSRUFLyQGHRUGLQDULRV\WUD]DGRU 
(O HPSOHR GH OD PXQLFLyQ '0 IDFLOLWD GH PDQHUD H[WUDRUGLQDULD ODV WDUHDV GH
PXQLFLRQDPLHQWR DGHPiV GH HYLWDU ORV SUREOHPDV GH DOLPHQWDFLyQ GHIHFWXRVD TXH
SXHGHQGDUVHFRQODFLQWD'0 GHJXVDQLOOR 

E&DUJDGRUHVGHPXQLFLyQ

/DDPHWUDOODGRUDFRD[LDOGLVSRQHGHGRVFDUJDGRUHVLJXDOHVGHFDUWXFKRVXQR
SDUDDOLPHQWDFLyQGHODUPD\XQVHJXQGRGHUHVSHWR(OSULPHURHVWiVLWXDGRHQXQ
DORMDPLHQWR HVSHFtILFR HQ OD FiPDUD GH DUPDV GH OD WRUUH )LJ  Qž  \ HO
VHJXQGRVHDOPDFHQDEDMRODFHVWDGHODWRUUH\VREUHHOSLVRGHOYHKtFXOR





)LJXUD$ORMDPLHQWRGHOFDUJDGRU

/RVFDUJDGRUHV )LJ GLVSRQHQGHXQDWDSD  FRQXQDYHQWDQDGHVDOLGDGHOD
PXQLFLyQFRQGRVURGLOORV  TXHIDFLOLWDQODVDOLGDGHODFLQWDORVFRUUHVSRQGLHQWHV
SHVWLOORVGHILMDFLyQGHODWDSD  \XQDVD  
,QWHUQDPHQWHHVWiQGLYLGLGRVHQFXDWURFRPSDUWLPHQWRV  SDUDHYLWDUHOYROWHR\HO
HQJDQFKHGHODPXQLFLyQGXUDQWHODPDUFKDGHOYHKtFXOR
/DWHUDOPHQWH HO FXHUSR GHO FDUJDGRU GLVSRQH GH GRV JXtDV   OD L]TXLHUGD WLHQH
VHQGRVRULILFLRVSDUDHODORMDPLHQWRGHOSHVWLOORGHEORTXHRGHOFRPSDUWLPHQWRGHOD
WRUUH  \SDUDHODORMDPLHQWRHQHOFDVFRFXDQGRHVGHUHVSHWR  $VLPLVPROOHYD
XQDSODFDLQGLFDGRUD  GHODFRORFDFLyQFRUUHFWDGHOILQGHFLQWD
/D SLH]D   GHO SULPHU FRPSDUWLPHQWR VLUYH SDUD ILMDU HO ILQ GH FLQWD GH PRGR TXH
SUHVLRQHHOVHQVRUGHILQGHFLQWDTXHDVRPDSRUHOKXHFR  




)LJXUD&DUJDGRU$0FRD[LDO





)LJXUD&RPSDUWLPHQWRGHOFDUJDGRUGHXVRLQPHGLDWRGHOD$0

 3XHUWDGHDFFHVR
 3HVWLOORGHEORTXHR


 7HWyQGHEORTXHR
 *XtDV
 3HVWLOORVSXHUWD
 ,QWHUUXSWRUGHOLQGLFDGRU³ILQGHFLQWD´


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ H LGHQWLILFDQ ORV HOHPHQWRV \ ORV SDVRV D VHJXLU SDUD HO
PXQLFLRQDPLHQWRGHORVFDUJDGRUHVGHXVRLQPHGLDWRGHODDPHWUDOODGRUD0*6\
ODDOLPHQWDFLyQGHODPLVPDQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORV
PLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVFRQWRGRVORVSDQHOHVGHDFFHVRDODFiPDUD
GHDUPDV\FDUJDGRUHVFRORFDGRV/DEROVDGHDFFHVRULRVGHWRUUHVHHQFRQWUDUiHQ
VXOXJDU(OYHKtFXORVHHQFRQWUDUiVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVHOD
WRUUHOLEUHPHQWH&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

0XQLFLRQDUiXQFDUJDGRUGH0*6 0XQLFLyQGHIRJXHR\FLQWDV 
&RORFDUiHOYHKtFXORDODVVHLVSDUDDFFHGHUDODOPDFpQGHFDUJDGRQGHLQWURGXFLUi
HOFDUJDGRU
&RORFDUi OD WRUUH D ODV GRFH \ HO WULSXODQWH RFXSDUi HO SXHVWR GHO -HIH GH 9HKtFXOR
SDUDUHDOL]DUODDOLPHQWDFLyQGHOD0*
([SOLFDUi ORV SDVRV SDUD UHDOL]DU OD DOLPHQWDFLyQ GH OD 0* TXLWDQGR HO SDQHO R
SDQHOHVGHDFFHVRQHFHVDULRV 


6,78$&,Ï1),1$/


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

/DWRUUHGHO9&,GHEHUiTXHGDUHQFODYDGDDODVGRFHFRQODVWULQFDVSXHVWDV/D0*
VHHQFRQWUDUiHQVXDIXVWHGHQWURGHOYHKtFXOR\ORVSDQHOHVGHDFFHVRFRORFDGRV(O
FDUJDGRU GH 0* GHEH HQFRQWUDUVH IXHUD GHO DOPDFpQ GH FDUJD \ OD PXQLFLyQ IXHUD
GHOPLVPR\ODSXHUWDGHDFFHVRFHUUDGD

 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1+202*(1(,=$&,Ï1'(/$$0(75$//$'25$

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
3UiFWLFD 9HKtFXOR3L]DUUR 3UiFWLFDPLQDOXPQR
*UXSRVSD[

$<8'$6$/$,16758&&,Ï1
9HKtFXOR 3L]DUUR %ROVD GH KHUUDPLHQWDV GH WRUUH &HQWUDGRU GH ERFD 3DQFDUWD R
EODQFRDP
%,%/,2*5$)Ë$
07 0DQXDO 7pFQLFR 9HKtFXOR 9&,& 3L]DUUR 0DQXDO GH OD 7ULSXODFLyQ
0RGLILFDGRHQ 



&21',&,21(6'((-(&8&,Ï1

/RV WULSXODQWHV VH GLYLGLUiQ HQ JUXSRV GH QR PiV GH   SRU 9&,& \ OD VHVLyQ
FRPHQ]DUiFRQXQDH[SRVLFLyQEUHYHSRUSDUWHGHOLQVWUXFWRU


5(48,6,726$$/&$1=$5

4XHHOWULSXODQWHVHDFDSD]GHKRPRJHQHL]DUODDPHWUDOODGRUD

/DWDUHDVHFRQVLGHUDUiFRUUHFWDPHQWHUHDOL]DGDVLVHREWLHQHHOGHDFLHUWRVHQ
ORVDVSHFWRVDHYDOXDU


'(6$552//27(Ï5,&2'(/&217(1,'2

+202*(1(,=$&,Ï1'(/$$0(75$//$'25$

 $O LJXDO TXH ORV HOHPHQWRV GH SXQWHUtD OD DPHWUDOODGRUD FRD[LDO VH SXHGH
KRPRJHQHL]DU VREUH SDQFDUWD D  PHWURV R VREUH XQ EODQFR D XQD GLVWDQFLD
GHWHUPLQDGD(QHVWH~OWLPRFDVRVHUHFRPLHQGDKDFHUORDXQDGLVWDQFLDGH
PHWURV,QWURGXFLUODGLVWDQFLDGHWLURHQOD8&3&%&
 /D 'LUHFFLyQ GH 7LUR GHEH HVWDU HQ PRGR +RPRJHQHL]DFLyQ  SDUD OR FXDO HO
7LUDGRUVHOHFFLRQDODDPHWUDOODGRUD\DFW~DVREUHHOSXOVDGRU+202GHOD8&3
&%&$SXQWDUHOUHWtFXORGH89/DOEODQFRHOHJLGRFRQORVPDQGRVPDQXDOHV
 0RQWDU HO FHQWUDGRU GH ERFD )LJ   HQ HO FDxyQ GH OD DPHWUDOODGRUD FRQ HO
YLVRUDFRGDGRKDFLDDUULED
 5HDOL]DUODVDOLQHDFLRQHVHQD]LPXW\HOHYDFLyQTXHVHGHVFULEHQDFRQWLQXDFLyQ



)LJXUD&HQWUDGRUGHERFDFRQYLVRUDFRGDGR

D$OLQHDFLyQHQD]LPXW )LJ 

ƒ$IORMDUHOWRUQLOOR  FRQXQDOODYHDOOHQ  GHOQž


ƒ*LUDUHODQLOORGHD]LPXW  HQHOVHQWLGRQHFHVDULRSDUDDOLQHDUODOtQHDYHUWLFDOGHO
UHWtFXORGHOSHULVFRSLRGHKRPRJHQHL]DFLyQFRQHOSXQWRHOHJLGRHQHOEODQFR
ƒ9ROYHUDDSUHWDUHOWRUQLOOR  FXDQGRVHKD\DFRQVHJXLGRODDOLQHDFLyQ













)LJXUD$OLQHDFLyQHQD]LPXW

E$OLQHDFLyQHQHOHYDFLyQ )LJ 

ƒ$IORMDUHOWRUQLOORGHEORTXHR  GHOFRQWUROGHHOHYDFLyQFRQODOODYHDOOHQ  GHOQž
ƒ&RQODPLVPDOODYHJLUDUHOWRUQLOORGHDMXVWH  SDUDDOLQHDUODOtQHDKRUL]RQWDOGHO
UHWtFXOR GH SXQWHUtD GHO SHULVFRSLR GH KRPRJHQHL]DFLyQ FRQ HO SXQWR HOHJLGR GHO
EODQFR *LUDQGR HO WRUQLOOR HQ VHQWLGR KRUDULR DSUHWDU  GHVFLHQGH OD ERFD GH IXHJR
GHODDPHWUDOODGRUDJLUiQGRORHQVHQWLGRFRQWUDULR DIORMDU ODERFDGHIXHJRVXEH















)LJXUD$OLQHDFLyQHQHOHYDFLyQ


ƒ9ROYHUDDSUHWDUDWRSHHOWRUQLOORGHEORTXHR  XQDYH]REWHQLGDODDOLQHDFLyQ
 )LQDOL]DGDODKRPRJHQHL]DFLyQGHODDPHWUDOODGRUDFRD[LDOYROYHUODGLUHFFLyQGH
WLUR D VX PRGR 1250$/ 3XOVDU (17(5 \ D FRQWLQXDFLyQ +202 (VWD GHEH
DSDJDUVH












)LJXUD3URFHVRGHDOLQHDFLyQGHODDPHWUDOODGRUD

F+RPRJHQHL]DFLyQVREUHSDQFDUWDDPHWURV



)LJXUD3URFHVRGHDOLQHDFLyQGHODDPHWUDOODGRUD

 (MHFXWDUODVPLVPDVDFFLRQHVTXHSDUDODKRPRJHQHL]DFLyQVREUHEODQFRFRQODV
VLJXLHQWHVVDOYHGDGHV
x &RORFDUODSDQFDUWDIUHQWHDORVHOHPHQWRVGHSXQWHUtD\SHUSHQGLFXODUDHOORV
x 'LVWDQFLDDODERFDGHOFDxyQPHWURV
x $OWXUDGHODFUX]HMHGHOFDxyQPHWURV
x ,QWURGXFLUPDQXDOPHQWHODGLVWDQFLDGHPHWURVHQOD8&3&%&
x $SXQWDUFDGDXQRGHORVHOHPHQWRVDODFUX]FRUUHVSRQGLHQWHHQODSDQFDUWD


5(680(1



(Q HVWD ILFKD VH GHVFULEHQ ORV SDVRV D VHJXLU SDUD OD KRPRJHQHL]DFLyQ GH OD
DPHWUDOODGRUDQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6

/RV WULSXODQWHV FRQ D\XGD GHO LQVWUXFWRU GHGLFDUiQ GRV VHVLRQHV SUiFWLFDV D
UHDOL]DUHQHOYHKtFXORODKRPRJHQHL]DFLyQGHODDPHWUDOODGRUD
6H LQWURGXFLUi XQ WULSXODQWH HQ HO SXHVWR GH 7LUDGRU \ RWUR FRQ HO FHQWUDGRU GH
ERFDHQODSDUWHIURQWDOGHODWRUUHSDUDKDFHUXVRGHOPLVPR


6,78$&,Ï1,1,&,$/

9&,FRQODVHVFRWLOODVGHODWRUUHDELHUWDVPDPSDURVGHODFiPDUDGHDUPDVSXHVWRV
\ DVHJXUDGRV FHVWDV SRUWyQ WUDVHUR \ HVFRWLOODV GH OD EDUFD]D FHUUDGDV \
DVHJXUDGDV
&HQWUDGRUGHERFD
7RUUHHQFHQGLGD
(OHPHQWRVGHOD'LUHFFLyQGHWLURHQFHQGLGR
6HUYRV$SDJDGRV
7ULQFDVTXLWDGDV
'HEHUtDQ KDFHUVH HQ XQD ]RQD GHVFXELHUWD VREUH XQD SODWDIRUPD KRUL]RQWDO FRQ
XQDSDQFDUWDREODQFRGHKRPRJHQL]DFLyQDP
(OLQVWUXFWRUVHVLWXDUDHQODSDUWHGHO9&,TXHPHMRUFRQWUROHODSUiFWLFD


5(48,6,726$$/&$1=$5

5HDOL]DUFRUUHFWDPHQWHODKRPRJHQL]DFLyQGHODDPHWUDOODGRUD


6,78$&,Ï1),1$/

(QFHQGLGRHOSXOVDGRUWHVWLJR+202HQOD8&3
6HOHFFLRQDGDSRVLFLyQ+202HQHO3DQHOGH&RQWUROGH0RQLWRUHV&iPDUD7pUPLFD
6HOHFFLRQDGD0*HQHO3&GHO-9\GHO7,5
&HQWUDGRUGHERFDSXHVWRHQOD0*


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1),1$/

&RORFDUHO3DQHOGHFRQWUROGHORVPRQLWRUHVHQ1250 6DOLUGHOPRGR+202 
3XOVDU HO ERWyQWHVWLJR GH +202 SDUD VDOLU GH OD PLVPD 7UDV KDEHU SXOVDGR HO
SXOVDGRUWHVWLJR(17(5 
4XLWDUHOFHQWUDGRUGHERFDGHOD$PHWUDOODGRUD\JXDUGDUORHQVXPDOHWtQ
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï16,67(0$/$1=$,1*(1,26

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQDOXPQR
$<8'$6$/$,16758&&,Ï1
6RSRUWHLQIRUPiWLFR&'GHD\XGDDODLQVWUXFFLyQPDQXDOHV9&,&\FRPSUREDGRU
GHGLVSDUR
%,%/,2*5$)Ë$

07 0DQXDO 7pFQLFR 9HKtFXOR 9&,& 3L]DUUR 0DQXDO GH OD 7ULSXODFLyQ
0RGLILFDGR 



&21',&,21(6'((-(&8&,Ï1

/DVHVLyQWHyULFDVHGDUiHQHODXODSURFXUDQGRGHMDUDILDQ]DGRVORVFRQRFLPLHQWRV
HVSHFLDOPHQWHORVUHIHUHQWHVDODVHJXULGDGPDQHMR\SXHVWDHQIXQFLRQDPLHQWRGH
VLVWHPD
/D VHVLyQ SUiFWLFD VH UHDOL]DUi D VHU SRVLEOH FRQ XQ FRPSUREDGRU GH GLVSDUR
UHDOL]DQGRWRGDVODVVHFXHQFLDVFRPRVLGHXQGLVSDURUHDOVHWUDWDUD


5(48,6,726$$/&$1=$5

4XHHOWULSXODQWHVHDFDSD]GH

x (IHFWXDU OD FDUJD GHVFDUJD \ GLVSDUR GHO VLVWHPD ODQ]DLQJHQLRV GH ORV
YHKtFXORV
x ([SOLFDUGHIRUPDVHQFLOODHOIXQFLRQDPLHQWRGHORVGLVWLQWRVPDQGRV
x &RPSUREDUHOIXQFLRQDPLHQWRGHOFLUFXLWRGHGLVSDUR

/DWDUHDVHFRQVLGHUDUiFRUUHFWDPHQWHUHDOL]DGDVLVHREWLHQHHOGHDFLHUWRVHQ
ORVDVSHFWRVDHYDOXDU


'(6$552//27(Ï5,&2'(/&217(1,'2

0(','$6'(6(*85,'$'&215(63(&72$/26/$1=$,1*(1,26

9HUILFKD1RUPDVGHVHJXULGDG\$QH[R$GHHVWHPDQXDO



*(1(5$/,'$'(6&215(63(&72$/26/$1=$,1*(1,26

/D WRUUH HVWi HTXLSDGD FRQ XQ VLVWHPD ODQ]DLQJHQLRV )LJ   IRUPDGR SRU 
WXERV ODQ]DGRUHV GH  PP DJUXSDGRV HQ  EDWHUtDV GH WUHV ODQ]DGRUHV VLWXDGRV
GRV D GRV HQ DPERV FRVWDGRV GH OD WRUUH \ FRQ FDSDFLGDG GH ODQ]DPLHQWR GH
DUWLILFLRVIXPtJHQRV\GHJUDQDGDVGHIUDJPHQWDFLyQR+(FRQWUDSHUVRQDO/DVGRV
EDWHUtDV GHODQWHUDV   \   VyOR SXHGHQ GLVSDUDU DUWLILFLRV IXPtJHQRV \ ODV GRV
WUDVHUDV  \  DPERVWLSRVGHLQJHQLRV
&DGD SRUWDWXER HVWi PRQWDGR FRQ XQ iQJXOR GLIHUHQWH SHUIHFWDPHQWH HVWXGLDGR
SDUDFXEULUDYDQJXDUGLDWRGRHODEDQLFRGHSURWHFFLyQQHFHVDULR\WRGRVORVWXERV
WLHQHQXQiQJXORGHGLVSDURGHž
6XFRQWUROVHUHDOL]DGHVGHHOLQWHULRUGHODPLVPDPHGLDQWHXQDFDMDGHFRQWURO  


)LJXUD6LWXDFLyQGHODVEDWHUtDVODQ]DLQJHQLRV

D&DUDFWHUtVWLFDV

&DOLEUHPP
0RGDOLGDGHVGHWLUR
 &RQDUWLILFLRVIXPtJHQRV6DOYDGHDUWLILFLRVGHOPLVPRFRVWDGR
 &RQ JUDQDGDV GH IUDJPHQWDFLyQ 'LVSDUR D GLVSDUR VyOR ODV GRV EDWHUtDV
SRVWHULRUHV
&REHUWXUD
 6DOYDGHJUDQDGDVGHIUDJPHQWDFLyQƒDrP


 6DOYDGHDUWLILFLRVIXPtJHQRVƒDrP VDOYDVGHDUWLILFLRVSRU
FRVWDGR 




)LJXUD$OFDQFH\FREHUWXUDGHORVLQJHQLRV

E'RWDFLyQGHPXQLFLyQ

(Q ODV FDMDV H[WHULRUHV VLWXDGDV HQ OD SDUWH WUDVHUD GH OD WRUUH VH WUDQVSRUWDQ 
JUDQDGDV SXGLpQGRVH LQFUHPHQWDU HVWH Q~PHUR KDVWD  HQ FRQGLFLRQHV GH
FRPEDWHOOHYDQGRSUHFDUJDGDVHQORVWXERVFRUUHVSRQGLHQWHV

'(6&5,3&,Ï1'(/26(/(0(1726'(/6,67(0$/$1=$,1*(1,26

D'HVFULSFLyQGHORVWXERVODQ]DLQJHQLRV



)LJXUD7XERODQ]DGRU   
)LJXUD7XERODQ]DGRU  

1ž '(120,1$&,Ï1 )81&,Ï1


 7$3$'(*20$ 3URWHJHU GH SROYR VXFLHGDG \ KXPHGDG HO LQWHULRU GHO
WXER
 78%2 &XHUSRGHOODQ]DGRU
 623257( &ROJDUODWDSDSDUDSHUPLWLUHOGLVSDUR
 &,(55( 2EWXUDU HO WXER URVFDGR SRU VX SDUWH WUDVHUD ,QFRUSRUD
XQWRSHLQWHULRUSDUDILMDUODSRVLFLyQGHOERWHRJUDQDGD
 %$//(67,//$ )LMDU OD SRVLFLyQ GHO FLHUUH SDUD LPSHGLU VX DSHUWXUD
LQYROXQWDULD
 3257$78%2 $FRSODU HO WXER HQ HO VRSRUWH GHO FRQMXQWR ODQ]DGRU
GHUHFKRRL]TXLHUGR
 &217$&726 (VWDEOHFHUODFRQH[LyQHOpFWULFDFRQODEDQGDGHFRQWDFWR
(/e&75,&26 GHOERWHGHKXPRRGHODJUDQDGDGHIUDJPHQWDFLyQSDUD
SURYRFDUHOGLVSDUR(OWHUFHUFRQWDFWRHVSDUDODPDVD



127$
/RVWXERVGHODVGRVEDWHUtDVGHODQWHUDVVyOROOHYDQFRQH[LyQHOpFWULFDSDUDODQ]DU
DUWLILFLRVIXPtJHQRV


E'HVFULSFLyQGHODFDMDGHFRQWURO



)LJXUD&DMDGHFRQWURO





1ž '(120,1$&,Ï1 )81&,Ï1
 ,17(5583725'( &RQHFWDURGHVFRQHFWDUODDOLPHQWDFLyQDOVLVWHPD
$/,0(17$&,Ï1  21$OLPHQWDFLyQFRQHFWDGD
 2))$OLPHQWDFLyQGHVFRQHFWDGD
 ',63$5$'257(67,*2 6HHQFLHQGHDODFWLYDU 21 HOLQWHUUXSWRU  
)8(*2 6L VH RSULPH XQD YH] HQFHQGLGR VH HIHFWXDUi HO
GLVSDUR GH DFXHUGR FRQ OD SRVLFLyQ GHO FRQPXWDGRU
 
 &21087$'25 6HOHFFLRQDUHOWLSRGHGLVSDURRHOWXERDGLVSDUDUDO
SRVLFLRQDUORHQODVGLVWLQWDVRSFLRQHV


127$
6HFRQVLGHUDHOWXERFRPRHOPiVDGHODQWDGR


&20352%$'25'(',63$52

(VWH HOHPHQWR VLUYH SDUD FRPSUREDU HO IXQFLRQDPLHQWR GHO VLVWHPD LQWURGXFLpQGROR
HQ FDGD XQR GH ORV WXERV FRPR VL GH XQ LQJHQLR VH WUDWDUD \ UHDOL]DQGR WRGDV ODV
RSHUDFLRQHVGHGLVSDUR$OSUHVLRQDUHOGLVSDUDGRU)8(*2VHHQFHQGHUiODOX]URMD
RYHUGHVHJ~QHOWLSRGHPXQLFLyQTXHVHHVWpVLPXODQGR



)LJXUD&RPSUREDGRUGHOFLUFXLWRGHGLVSDUR

1ž '(120,1$&,Ï1 )81&,Ï1
 3LORWR+802 URMR  &RPSUREDUHOIXQFLRQDPLHQWRGHORVFLUFXLWRVGHGLVSDURGH
ORVERWHVIXPtJHQRV
 $VD 3DUDWUDQVSRUWHHLQVWDODFLyQHQHOODQ]DGRU
 3LORWR)5$* &RPSUREDUHOIXQFLRQDPLHQWRGHORVFLUFXLWRVGHGLVSDURGH
YHUGH  JUDQDGDVGHIUDJPHQWDFLyQ
 7RPDGHFRUULHQWH 3DUDFXDQGRVLPXODERWHVIXPtJHQRV
 7RPDGHPDVD &LHUUHGHOFLUFXLWR
 7RPDGHFRUULHQWH 3DUDFXDQGRVLPXODJUDQDGDVGHIUDJPHQWDFLyQ


0$1(-2'(/6,67(0$/$1=$,1*(1,26

D&RPSUREDFLyQGHOFLUFXLWRGHGLVSDUR



x 3RQHUHOLQWHUUXSWRU0$67(5%$77(5<HQ21
x &RPSUREDUTXHORVWXERVODQ]DDUWLILFLRVQRHVWiQFDUJDGRVHLQWURGXFLUDWRSH
HOFRPSUREDGRUGHGLVSDURHQXQRGHORVWXERV
x $FFLRQDU HO LQWHUUXSWRU GH DOLPHQWDFLyQ GH OD FDMD GH PDQGR 'HEH
HQFHQGHUVHHOWHVWLJRGLVSDUDGRU
x /HYDQWDU \ JLUDU HO FRQPXWDGRU VHOHFWRU KDFLD OD L]TXLHUGD D OD SRVLFLyQ
)80Ë*(12
x $FFLRQDU HO SXOVDGRU GH GLVSDUR 'HEH LOXPLQDUVH HO SLORWR YHUGH GHO
FRPSUREDGRU
x *LUDUHOFRQPXWDGRUVHOHFWRUKDFLDODGHUHFKDDODSRVLFLyQ)5$* VyORFRQ
ORVWXERVGHODVEDWHUtDVSRVWHULRUHV 
x $FFLRQDU HO SXOVDGRU GH GLVSDUR 'HEH LOXPLQDUVH HO SLORWR URMR GHO
FRPSUREDGRU
x 5HSHWLUHOSURFHVRFRQHOUHVWRGHORVODQ]DDUWLILFLRV

E&DUJDGHORVWXERV


3(/,*52
&21 2%-(72 '( 0,1,0,=$5 (/ 5,(6*2 '( '(6&$5*$6
(/(&752(67È7,&$6/$0$1,38/$&,Ï1'(/$57,),&,2'(%(5($/,=$56(
6,(035( (9,7$1'2 72&$5 /26 &217$&726 (67$ 6(&8(1&,$ '(
23(5$&,21(6'(%(6(55($/,=$'$325/$0,60$3(5621$

/DVHFXHQFLDGHRSHUDFLyQHVODVLJXLHQWH
  ([WUDHU HO DUWLILFLR GHO HVWXFKH \ HPSXxDUOR HYLWDQGR WRFDU OD ]RQD GH ORV
DQLOORVGHFRQWDFWR iUHDQRSLQWDGD 
  5HWLUDUHOSOiVWLFRSURWHFWRUGHORVDQLOORVGHFRQWDFWR\YHULILFDUTXHODOiPLQD
PHWiOLFDTXHDFW~DFRPRFRUWRFLUFXLWRGHVHJXULGDGVHKDGHVSUHQGLGR
  ,QWURGXFLU HO DUWLILFLR FRQ OD FDEH]D ]RQD GH DQLOORV GH FRQWDFWR  KDFLD DEDMR
PDQWHQLHQGR HO FXHUSR DOHMDGR GHO HMH GH SUR\HFFLyQ £(UURU 1R VH
HQFXHQWUDHORULJHQGHODUHIHUHQFLD 
  $VHJXUDUODWDSDGHJRPDGHODEDVHVREUHHOSHUtPHWURGHOWXERGHIRUPDTXH
TXHGHXQDXQLGDGHVWDQFDDODJXD





)LJXUD&DUJDGHODUWLILFLRHQHOWXER

E  2%6(59$&,21(63$5$(/(03/(2

$17(6'(/$&$5*$
 &HUFLRUDUVH GH TXH HO LQWHUUXSWRU GH OD XQLGDG GH PDQGR VLWXDGD HQ HO
YHKtFXORHVWiGHVFRQHFWDGD\HOWXERODQ]DGRUHVWiOLPSLR
 $VHJXUDUVH TXH ORV FRQWDFWRV HOpFWULFRV VLWXDGRV HQ OD SDUWH LQWHULRU VH YHQ
VREUHVDOLUGHODSDUWHLQIHULRUGLULJLGRVKDFLDHOFHQWUR

5(7,5$'$'(/$57,),&,2'(/78%2/$1=$'25
 'HVDFWLYDUHOPHFDQLVPRGHGLVSDUR\HVSHUDUDOPHQRVXQPLQXWRDQWHVGH
HIHFWXDUFXDOTXLHUPDQLSXODFLyQHQHOWXERRHQHODUWLILFLR
 ([WUDHU HO DUWLILFLR HYLWDQGR WRFDU OD FDEH]D \ GHSRVLWDULR HQ VX HVWXFKH
FHUUiQGRORFRQVXWDSD
 3DUDVXSRVWHULRUDOPDFHQDPLHQWRYROYHUDDSOLFDUHOSURWHFWRUGHSOiVWLFR\OD
OiPLQD GH FRUWRFLUFXLWR GH VHJXULGDG (VWD RSHUDFLyQ GHEH VHU UHDOL]DGD HQ
FRQGLFLRQHVGHVHJXULGDGIUHQWHDGHVFDUJDVHOHFWURVWiWLFDV

F'LVSDUR

8QDYH]FDUJDGRVORVWXERVFRQODPXQLFLyQGHVHDGDERWHVGHKXPRRJUDQDGDVGH
IUDJPHQWDFLyQ
  &RPSUREDUTXHHOLQWHUUXSWRUGHDOLPHQWDFLyQGHODFDMDGHFRQWURO )LJ
Qž HVWiHQ2))
  4XLWDUODVWDSDVSURWHFWRUDVGHORVWXERVODQ]DGRUHV
  &HUUDUWRGDVODVHVFRWLOODVGHOYHKtFXOR
  6LWXDUHQ21HOLQWHUUXSWRUJHQHUDOGHWRUUH 7255(212)) 
  3UHVLRQDU 21  HO SXOVDGRU 6(592 212)) 7LHQH TXH SHUPDQHFHU
HQFHQGLGRSDUDSRGHUKDFHUIXHJRVLQRHVDVtFRPSUREDUTXHODVHVFRWLOODV
HVWpQELHQFHUUDGDV



  3RQHU HO LQWHUUXSWRU GH DOLPHQWDFLyQ )LJ  Qž   GH OD FDMD GH FRQWURO HQ
21(OGLVSDUDGRUWHVWLJR)8(*2 )LJQž VHHQFHQGHUi
  7LUDU \ JLUDU HO FRQPXWDGRU )LJ  Qž   KDVWD FRORFDUOR HQ OD SRVLFLyQ
GHVHDGDGHSHQGLHQGRGHOWLSRGHGLVSDURTXHVHYD\DDHIHFWXDU

)80,*(12
3DUDGLVSDUDUXQDVDOYDGHERWHVGHKXPRGH
$17(5,25
ODEDWHUtDGHODQWHUDGHUHFKD )LJQž 
'(5(&+2
)80,*(12
3DUDGLVSDUDUXQDVDOYDGHERWHVGHKXPRGH
3267(5,25
ODEDWHUtDWUDVHUDGHUHFKD )LJQž 
'(5(&+2
)80,*(12
3DUD GLVSDUDU VDOYD GH  ERWHV GH KXPR GH OD
$17(5,25
EDWHUtDGHODQWHUDL]TXLHUGD )LJQž 
,=48,(5'2
)80,*(12
3DUD GLVSDUDU VDOYD GH  ERWHV GH KXPR GH OD
3267(5,25
EDWHUtDWUDVHUDL]TXLHUGD )LJQž 
,=48,(5'2
+( 3DUD GLVSDUDU LQGLYLGXDOPHQWH ODV JUDQDGDV GH
'(5(&+2 IUDJPHQWDFLyQ YHU127$ GHORVWXERVR
R  GHODEDWHUtDWUDVHUDGHUHFKD )LJQž 
+( 3DUD GLVSDUDU LQGLYLGXDOPHQWH ODV JUDQDGDV GH
,=48,(5'2 IUDJPHQWDFLyQGHORVWXERVRGHODEDWHUtD
R  WUDVHUDL]TXLHUGD )LJQž 

  3UHVLRQDUHOGLVSDUDGRUWHVWLJR)8(*2


127$
3DUD TXH HQ HVWDV SRVLFLRQHV VH SXHGD DFWLYDU HO ODQ]DPLHQWR GH XQD JUDQDGD VH
WLHQHTXHKDEHULQWURGXFLGRIRU]RVDPHQWHXQDJUDQDGDGHIUDJPHQWDFLyQVLSRUHUURU
VHKDLQWURGXFLGRXQERWHGHKXPRpVWHQRVDOGUi\YLFHYHUVD

G)DOORHQODLQLFLDFLyQRHQHOGLVSDUR

(OUHWDUGRHQODWRPDGHIXHJRVHSURGXFHDOUHWUDVDUVHODLQLFLDFLyQGHODFDUJDGH
SUR\HFFLyQRGHELGRDXQIDOORWHPSRUDOHQGLFKDFDUJD&XDQGRRFXUUDHVWRHVSHUDU
 VHJXQGRV H LQWHQWDU GH QXHYR HO GLVSDUR 6L QR VH GLVSDUD HO ERWH KDEUi TXH
FRQVLGHUDUTXHH[LVWHXQIDOORHQHOGLVSDUR

8Q IDOOR HQ HO GLVSDUR GH XQ ERWH GH KXPR R JUDQDGD GH IUDJPHQWDFLyQ SXHGH VHU
GHELGR D XQ IDOOR GHO WXER ODQ]DDUWLILFLR &XDQGR HVWR RFXUUD KDEUi TXH HVSHUDU 
VHJXQGRVHLQWHQWDUHOGLVSDURQXHYDPHQWH6LHOERWHQRVHSXHGHGLVSDUDUHVSHUDU
DO PHQRV  PLQXWRV DQWHV GH UHWLUDUOR GHO WXER ODQ]DDUWLILFLR \ FRORFDUOR D XQRV
GRVFLHQWRV PHWURV GH GLVWDQFLD GHO SHUVRQDO \ HTXLSR &RPXQLFDU DO SHUVRQDO
HVSHFLDOL]DGRODFDQWLGDGORFDOL]DFLyQ\WLSRGHERWHVVLQH[SORVLRQDU


081,&,21(6



/DVPXQLFLRQHVDFWXDOPHQWHHQVHUYLFLRVRQ
 $UWLILFLRIXPtJHQR$)29(&+
 $UWLILFLRIXPtJHQRJDPDYLVLEOHLQIUDUURMD$)29(&3

D$UWLILFLRIXPtJHQR$)29(&+

$UWLILFLRSDUDFUHDFLyQLQPHGLDWDGHXQDFRUWLQDGHKXPRSDUDRFXOWDFLyQHQHOYLVLEOH
FRQXQWLHPSRGHHIHFWLYLGDGGH\HQHOLQIUDUURMRWpUPLFREDQGDFRQXQWLHPSR
GH HIHFWLYLGDG GH  (O DUWLILFLR VH LQLFLD D XQD GLVWDQFLD DSUR[LPDGD GH  P GHO
ODQ]DGRU GLVHPLQDQGR HQ XQD ]RQD FLUFXODU GH  P DSUR[ GH UDGLR XQD OOXYLD GH
SDUWtFXODV LQFDQGHVFHQWHV (VWi IRUPDGR SRU XQ FXHUSR PHWiOLFR TXH FRQWLHQH XQD
PH]FOD IXPtJHQD GH IyVIRUR URMR TXH VH GLVSHUVD WUHV VHJXQGRV GHVSXpV GHO
ODQ]DPLHQWRDFLHUWDDOWXUDGHOVXHORSURGXFLpQGRVHGHPRGRLQPHGLDWRXQDQXEHGH
KXPRTXHRFXOWDDOYHKtFXORTXHORKDODQ]DGR

E$UWLILFLRIXPtJHQRJDPDYLVLEOHLQIUDUURMD$)29(&3

$UWLILFLRSDUDFUHDFLyQLQPHGLDWDGHXQDFRUWLQDGHKXPR(ODUWLILFLRVHLQLFLDDXQD
GLVWDQFLDDSUR[LPDGDGHPGHOODQ]DGRUJHQHUDQGRXQDQXEHGHKXPRTXHRFXOWD
DOYHKtFXORTXHORKDODQ]DGR



)LJXUD$UWLILFLRV3\+


F2WURVDUWLILFLRV

(O VLVWHPD HV FDSD] GH XVDU GLVWLQWRV DUWLILFLRV H[LVWHQWHV HQ HO PHUFDGR FX\DV
FDUDFWHUtVWLFDVJHQpULFDVVHH[SRQHQDFRQWLQXDFLyQ

F  *5$1$'$'()5$*0(17$&,Ï1&2175$3(5621$/

/D JUDQDGD GH IUDJPHQWDFLyQ SRVHH XQ UDGLR GH DFFLyQ GH DSUR[  P  (VWD
JUDQDGD HV FRPSDWLEOH FRQ ORV ~OWLPRV UHTXLVLWRV GH SURWHFFLyQ IUHQWH D ULHVJRV
HOHFWURPDJQpWLFRV



F  *5$1$'$'(,16758&&,Ï1

/DV GLPHQVLRQHV GH OD JUDQDGD GH LQVWUXFFLyQ VRQ LGpQWLFDV D OD GH JXHUUD \ ODV
FRQGLFLRQHV GH HPSOHR VRQ HTXLYDOHQWHV /D JUDQDGD GH LQVWUXFFLyQ HV FRPSDWLEOH
FRQWRGRVORVODQ]DGRUHVGHPPHQVHUYLFLR
3URGXFH XQD VLPXODFLyQ SHUIHFWD GH OD JUDQDGD GH IUDJPHQWDFLyQ HQ FXDQWR D ORV
HIHFWRV GH KXPR GHVWHOOR \ HVWDOOLGR 6X FRPSRVLFLyQ HV  GRORPLWD 7UDV OD
GHWRQDFLyQ VH SURGXFH OD UHDFFLyQ FRPSOHWD HQ OD DWPyVIHUD QR GHMDQGR UHVLGXRV
SLURWpFQLFRVQLIUDJPHQWRVPHWiOLFRVSXQ]DQWHVHQODVXSHUILFLH

F  *5$1$'$)80Ë*(1$,1)5$552-$

8QR GH ORV PiV QRYHGRVRV LQJHQLRV HV OD JUDQDGD IXPtJHQD ,5 '0  TXH
SURSRUFLRQD SURWHFFLyQ FRPSOHWD IUHQWH D OD GHWHFFLyQ YLVXDO H LQIUDUURMD PX\ ~WLO
FRQWUDODGHWHFFLyQSRUFiPDUDVWpUPLFDV

G(PSDTXHV\HPEDODMHV$)29(&+\3

(PEDODMH\SURWHFFLyQ&DGDDUWLILFLRYDSURWHJLGRLQGLYLGXDOPHQWHSRUXQHVWXFKHGH
FDUWyQKLGURIXJDGRKHUPpWLFR&DGDGLH]DUWLILFLRVYDQHQXQHPSDTXHGHPDGHUD
HQVDPEODGD SLQRXRNXPHQWUHVFDSDV 0HGLGDVGHOHPSDTXHFDMDGH[[
PP\NJDSUR[
 &RQVHUYDFLyQ'HEHPDQWHQHUVHHQVLWLRIUHVFR\VHFRDWHPSHUDWXUDPHGLD
 9LGD~WLODxRVDSDUWLUGHODIHFKDGHIDEULFDFLyQ
 &yGLJR5LHVJR\&RPSDWLELOLGDG27$1+





)LJXUD(PSDTXHGHORVDUWLILFLRV


5(680(1

(QHVWDILFKDVHGHVFULEHQHOVLVWHPDGHODQ]DLQJHQLRVFRPSUREDFLyQ\GLVSDURGHO
PLVPRQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6




/RVWULSXODQWHVHQJUXSRVQRPD\RUHVGHSRUYHKtFXORFRQODD\XGDGHOLQVWUXFWRU
GHEHQLGHQWLILFDUFDGDXQRGHORVHOHPHQWRVFLWDGRVHQODILFKDUHSDVDQGRODIXQFLyQ
GHFDGDXQRGHHOORV

$ FRQWLQXDFLyQ EDMR OD VXSHUYLVLyQ GHO LQVWUXFWRU \ XVDQGR HO FRPSUREDGRU GH
GLVSDUR VH SRQGUi HQ SUiFWLFD ORV SURFHGLPLHQWRV H[SOLFDGRV HQ OD ILFKD SDUD
FRPSUREDU HO FLUFXLWR GH GLVSDUR FDUJDU GLVSDUDU \ GHVFDUJDU HO VLVWHPD GH
ODQ]DDUWLILFLRV

)LQDOPHQWH \ HQ IXQFLyQ GHO FUpGLWR GH IXPtJHQRV \ JUDQDGDV GLVSRQLEOH VH
UHDOL]DUiQSUiFWLFDVFRQPXQLFLyQUHDODSURYHFKDQGRDOJXQDVDOLGDDOFDPSR

(V QHFHVDULR UHDOL]DU ODV SUiFWLFDV HQ XQD ]RQD HQ OD TXH QR H[LVWD PDOH]D
FRPEXVWLEOH SDUD HYLWDU DVt HO SHOLJUR GH LQFHQGLRV 6LHPSUH GHEHQ PDQWHQHUVH
FHUUDGDVWRGDVODVHVFRWLOODVGXUDQWHHOODQ]DPLHQWR/DVJUDQDGDVGHEHQFDUJDUVH
HQ HO FDPSR GH SUiFWLFDV LQPHGLDWDPHQWH DQWHV GH VX XWLOL]DFLyQ \ DQWHV GH
DEDQGRQDUHOFDPSRVHSURFHGHUiDODGHVFDUJD


6,78$&,Ï1,1,&,$/

9&, FRQ ODV HVFRWLOODV GH OD WRUUH DELHUWDV FHVWDV SRUWyQ WUDVHUR \ HVFRWLOODV GH OD
EDUFD]DFHUUDGDV\DVHJXUDGDV
(OPRWRUDUUDQFDGR
7RUUHDSDJDGD
7ULQFDVTXLWDGDV
5RWDWLYRSXHVWR
&RPSUREDGRUGHGLVSDUR
'HEHUi KDFHUVH FRQ XQ FRPSUREDGRU GH GLVSDUR UHDOL]DQGR WRGDV ODV VHFXHQFLDV
FRPRVLGHXQGLVSDURUHDOVHWUDWDUD
(OLQVWUXFWRUVHVLWXDUDHQHO3XHVWRGHO7LUDGRUHLPSHGLUiTXHQDGLHDFFHGDREDMH
GHOYHKtFXORVLQVXH[SUHVDDXWRUL]DFLyQ(QHOFDVRGHXQHMHUFLFLRGHIXHJRUHDOVH
REVHUYDUDQ HVWULFWDPHQWH ODV PHGLGDV GH  VHJXULGDG 3XGLHQGR OLPLWDU HO DFFHVR DO
YHKtFXOR GH XQ WULSXODQWH SRU YHKtFXOR \ HYDOXDFLyQ R SUiFWLFD VL HO LQVWUXFWRU OR YH
QHFHVDULR SDUD JDUDQWL]DU ODV PHGLGDV GH VHJXULGDG GXUDQWH OD UHDOL]DFLyQ GHO
PLVPR 


5(48,6,726$$/&$1=$5

,GHQWLILFDUHQODFiPDUDGHFRPEDWHORVSODIRQHVHOHPHQWRVGHLOXPLQDFLyQFDMDGH
LQWHUUXSWRUHVYiOYXODGHVREUHSUHVLyQ\FRQWDGRUGHFLHUUHDWUiV
,GHQWLILFDUHQODFiPDUDGHDUPDVORVYHQWLODGRUHVGHH[WUDFFLyQGHJDVHV


6,78$&,Ï1),1$/

7RUUHHQFHQGLGD
6HUYRVHQFHQGLGRV
6LVWHPDGHODQ]DLQJHQLRVHQFHQGLGR



),&+$'(7$5($

&Ï',*2

 '(6&5,3&,Ï1 ',5(&&,Ï1 '( 7,52 0. '(6&5,3&,Ï1 <
&20321(17(6

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFD  PLQXWRV SRU
7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV
3DUDODSUiFWLFDVHFRORFDUiXQYHKtFXORHQXQOXJDUDSURSLDGRGHOSDWLRRKDQJDU(O
WULSXODQWHVHVLWXDUiHQHOSXHVWRGHO7LUDGRUSDUDTXHFXDQGRVHOHVLQGLTXHYD\DQ
HQXPHUDQGRLQGLFDQGR\GHVFULELHQGRVLQWLWXEHDUORVHOHPHQWRVGHOD'7

5(48,6,726$$/&$1=$5

4XHHOWULSXODQWHVHDFDSD]GHUHFRQRFHUORFDOL]DU\H[SOLFDUODVSDUWHVRIXQFLyQGH
WRGRVORVFRPSRQHQWHVGHOD'7

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2

&20321(17(6'(/$'7

(O VLVWHPD SULQFLSDO GH SXQWHUtDV HVWi FRQVWLWXLGR SRU XQD GLUHFFLyQ GH WLUR (126$
0. GH GLVHxR PRGXODU \ TXH VH FRPSRQH GH ORV VLJXLHQWHV HOHPHQWRV
SULQFLSDOHV
 3HULVFRSLRGHO7LUDGRU
 &iPDUDWpUPLFDFRQVXVPRQLWRUHVSDUD-9\7LUDGRU
 &RPSXWDGRUEDOtVWLFRGLJLWDO
 8QLGDGGH&RQWURO3ULQFLSDO 8&3 
 6HQVRUGHLQFOLQDFLyQ



)LJXUD'LDJUDPDGHFRPSRQHQWHVGHOVLVWHPDSULQFLSDOGHSXQWHUtDV


D(VTXHPDJHQHUDOGHODLQVWDODFLyQ




)LJXUD(VTXHPDGHODLQVWDODFLyQ


E,QVWDODFLyQHQHOYHKtFXOR



)LJXUD,QVWDODFLyQHQHOYHKtFXORGHFRPSRQHQWHVGHOD'7  



1ž '(120,1$&,Ï1 )81&,Ï1
 3HULVFRSLRGHO (OHPHQWRSULQFLSDOGHSXQWHUtDGHOWLUDGRU&RPSUHQGH
7LUDGRU  &DEH]DGHHVSHMR
 0RQWXUDGHSHULVFRSLRGHREVHUYDFLyQGLUHFWDFRQ
YHQWDQD[
 0RQLWRUGHYLVLyQ 3UHVHQWDULPDJHQWpUPLFD\FRQWUROGHEULOORGHLPDJHQ\
WpUPLFDGHO7LUDGRU UHWtFXOR
 8QLGDG9LVXDO/iVHU (OHPHQWR SULQFLSDO GH SXQWHUtD GLXUQD \ PHGLFLyQ GH
GLVWDQFLD&RPSUHQGH
'HVSOD]DGRUUHWtFXORHQD]LPXW
9LVRUGLXUQRGHSXQWHUtD
/ODYHOiVHU
&RQPXWDGRUDWHQXDGRUOiVHU
&RQPXWDGRUILOWURV
&RQPXWDGRUSULPHUR~OWLPRHFR
 8QLGDG(OHFWUyQLFD  *HQHUDU DOLPHQWDFLyQ GH EDMD WHQVLyQ SDUD HO
GH&iPDUD7pUPLFD VHQVRUGHOD&iPDUD7pUPLFD
8(&7   *HQHUDUFRQWUROGHLQIRUPDFLyQGHUHWtFXORV


)LJXUD,QVWDODFLyQHQHOYHKtFXORGHFRPSRQHQWHVGHOD'7  

1ž '(120,1$&,Ï1 )81&,Ï1
 8QLGDGGH&RQWURO (OHPHQWRGHFRQWUROGHFRPSXWDGRU\VLVWHPD3HUPLWH
3ULQFLSDO 8&3   ,QWURGXFLU\SUHVHQWDULQIRUPDFLyQ
 &RQWUROGHVHQVRUHV
 +DFHUDMXVWHV



 0DQGRHPSXxDGXUD 3HUPLWH
GHO7LUDGRU  &RQWUROHOpFWULFRWRUUH
([WHUQRDOD'7   'LVSDUROiVHU\SUHGLFFLyQODWHUDO
 3XOVDGRUDO]DGHFRPEDWH
 'LVSDURGHODUPDVHOHFFLRQDGD
 &RPSXWDGRUEDOtVWLFR 3URFHVD OD LQIRUPDFLyQ TXH UHFLEH GH PDQGRV \
VHQVRUHVSURSRUFLRQDQGR
 ,QIRUPDFLyQGHVDOLGDGHHOHYDFLyQGHHVSHMR
 ,QIRUPDFLyQ GH VDOLGD GHO GHVSOD]DPLHQWR GHO
UHWtFXORD]LPXW
 6HQVRUGHLQFOLQDFLyQ 3HUPLWH LQWURGXFLU DXWRPiWLFDPHQWH ODV FRUUHFFLRQHV
GHELGDV D OD LQFOLQDFLyQ ODWHUDO GH OD WRUUH HMH GH
PXxRQHV 



)LJXUD,QVWDODFLyQHQHOYHKtFXORGHFRPSRQHQWHVGHOD'7  

1ž '(120,1$&,Ï1 )81&,Ï1
 3DQHO&RQWUROGH0RQLWRUHVGH &RQWURODU OD WHUPRJUDItD SDUD DPERV
YLVLyQWpUPLFD 3&0  WULSXODQWHV VDOYREULOOR\EULOORUHWtFXOR 
 0DQGRHPSXxDGXUDGHO-9FRQ 6LUYHSDUD
SULRULGDGVREUHHOGHO7  &RQWUROHOpFWULFRGHODWRUUH
([WHUQRDOD'7   3XOVDGRU GLVSDUR OiVHU \ SUHGLFFLyQ
ODWHUDO
 3XOVDGRUDO]DGHFRPEDWH
 'LVSDURGHODUPDVHOHFFLRQDGD
 0RQLWRUGHYLVLyQWpUPLFDGHO-9 3UHVHQWDULPDJHQWpUPLFD\FRQWUROGHEULOOR
LPDJHQ\EULOORUHWtFXOR
 6HQVRUGHFiPDUDWpUPLFD &DSWDU\JHQHUDUODLPDJHQWpUPLFD

F6HQVRUGHLQFOLQDFLyQGHOHMHGHPXxRQHV



3URSRUFLRQD DO FRPSXWDGRU EDOtVWLFR ORV GDWRV QHFHVDULRV SDUD LQWURGXFLU
DXWRPiWLFDPHQWHODVFRUUHFFLRQHVGHELGDVDODLQFOLQDFLyQODWHUDOGHODWRUUH HMHGH
PXxRQHV 
&DUDFWHUtVWLFDV
5DQJRRSHUDFLyQrž
3UHFLVLyQƒ

H&RPSXWDGRUEDOtVWLFR

(O FRPSXWDGRU EDOtVWLFR UHDOL]D HO FiOFXOR PDWHPiWLFR QHFHVDULR SDUD OD
GHWHUPLQDFLyQ GH ORV iQJXORV GH WLUR \ OD SUHGLFFLyQ HQ D]LPXW SDUWLHQGR GH ORV
SDUiPHWURVLQWURGXFLGRVHQHOVLVWHPDWDQWRGHIRUPDPDQXDOFRPRSRUPHGLRGHOD
LQIRUPDFLyQ VXPLQLVWUDGD SRU ORV WUDQVGXFWRUHV /RV UHVXOWDGRV REWHQLGRV GH ORV
FiOFXORV EDOtVWLFRV FRQ FRUUHFFLRQHV GHELGDV D ORV SDUDODMHV \ FRUUHFFLRQHV
VLVWHPiWLFDV VRQ WUDQVPLWLGRV D OD OtQHD GH PLUD &RQWLHQH OD HOHFWUyQLFD GH
DGDSWDFLyQ SDUD ORV WUDQVGXFWRUHV \ OD HOHFWUyQLFD GH DWHQFLyQ D ORV LQWHUUXSWRUHV
SURFHGHQWHVGHODVFRQVRODVSHULIpULFDV

H6LVWHPDVH[WHUQRVGHOD'7

6RQ VLVWHPDV TXH VLQ IRUPDU SDUWH GH OD '7 LQWHUYLHQHQ HQ HO IXQFLRQDPLHQWR GHO
VLVWHPDGHSXQWHUtDV
 0DQGRVHPSXxDGXUDGHFRQWUROGHPRYLPLHQWR\GLVSDURGHO-9\7LUDGRU
 6HUYRVLVWHPDVGHDFFLRQDPLHQWRWRUUHFDxyQ
 &DMDGHFRQWUROHOHFWUyQLFR
 &DMDGHGLVWULEXFLyQGHSRWHQFLD


5(680(1

(OVLVWHPDSULQFLSDOGHSXQWHUtDVHVWiFRQVWLWXLGRSRUXQDGLUHFFLyQGHWLUR(126$
0.GHGLVHxRPRGXODU\TXHVHFRPSRQHGHORVVLJXLHQWHVHOHPHQWRV
SULQFLSDOHV
x 3HULVFRSLRGHO7LUDGRU
x &iPDUDWpUPLFDFRQVXVPRQLWRUHVSDUD-9\7LUDGRU
x &RPSXWDGRUEDOtVWLFRGLJLWDO
x 8QLGDGGH&RQWURO3ULQFLSDO 8&3 
x 6HQVRUGHLQFOLQDFLyQ


35È&7,&$6

6,78$&,Ï1,1,&,$/

8Q9&,FRQHVFRWLOODVGHODWRUUHDELHUWDV&DGDWULSXODQWHVXELUiDOSXHVWRGHO
7LUDGRUGHO9&,


$&&,21(6$5($/,=$5


),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1',5(&&,Ï1'(7,520.)81&,21$0,(172 , 

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFR±3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFD  PLQXWRV SRU
7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV
3DUD OD SUiFWLFD VH FRORFDUi XQ YHKtFXOR HQ XQ OXJDU DSURSLDGR SDUD HQ FDVR
QHFHVDULRSRGHUPRYHUOLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVX
PRYLPLHQWR(OWULSXODQWHVHVLWXDUiHQHOSXHVWRGHO7LUDGRUSDUDTXHFXDQGRVHOHV
LQGLTXHSRQJDQHQIXQFLRQDPLHQWRORVFRPSRQHQWHVGHOD'7


5(48,6,726$$/&$1=$5

(OWULSXODQWHGHEHGHVHUFDSD]GHSRQHUHQIXQFLRQDPLHQWRHO3HULVFRSLRGHO7LUDGRU
\OD&iPDUD7pUPLFDDVtFRPRVXXWLOL]DFLyQ

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

3(5,6&23,2'(/7,5$'25

(OSHULVFRSLRGHO7LUDGRUFRPRSULQFLSDOOOHYDDFRSODGRHOUHWtFXORGHSXQWHUtDGHOD
'LUHFFLyQGH7LURFRQWURODGRSRUHOFRPSXWDGRUEDOtVWLFR

D(OHPHQWRVTXHORFRPSRQHQ




 &DEH]D GH SHULVFRSLR TXH FRQWLHQH HO HVSHMR \ ODV YHQWDQDV WDQWR SDUD ORV
HOHPHQWRV GLXUQRV FRPR SDUD OD FiPDUD WpUPLFD 7DPELpQ LQFOX\H HO
VHUYRVLVWHPDQHFHVDULRSDUDLQWURGXFLUHOiQJXORGHVXSHUHOHYDFLyQFDOFXODGR
SRUHOFRPSXWDGRUEDOtVWLFR(VWiXQLGRPHFiQLFDPHQWHFRQHOFRQMXQWRFDxyQ
PDVDRVFLODQWH 
 0RQWXUD
 &XHUSRGHSHULVFRSLRTXHLQFOX\H
o /D8QLGDG9LVXDO/iVHU 89/ HOHPHQWRSULQFLSDOGHSXQWHUtDGLXUQD\
PHGLFLyQGHGLVWDQFLDVTXHLQFOX\HHORFXODUGHSXQWHUtDGLXUQRFRQHO
UHWtFXOR \ ORV GDWRV GH GLVWDQFLD HO WHOpPHWUR OiVHU \ OD XQLGDG GH
FRQWURO GH GHVSOD]DPLHQWR HQ D]LPXW GHO UHWtFXOR TXH LQWURGXFH ODV
SUHGLFFLRQHV  FDOFXODGDV SRU HO FRPSXWDGRU EDOtVWLFR HQ IXQFLyQ GH OD
YHORFLGDGGHOEODQFR
o (OVHQVRUGHODFiPDUDWpUPLFD



 )LJXUD&RQMXQWRSHULVFRSLRYLVWD
)LJXUD&RQMXQWRSHULVFRSLRYLVWD SRVWHULRU
DQWHULRU
 &DEH]DGH(VSHMR  8QLGDG9LVXDO/iVHU 89/ 
 0RQWXUDGHO3HULVFRSLR  6HQVRUGHOD&iPDUD7pUPLFD
 
E&DEH]DGHHVSHMRGHOSHULVFRSLRGHOWLUDGRU

/D&DEH]DGH(VSHMR )LJ LQFRUSRUDORVVHUYRPHFDQLVPRVGHPRYLPLHQWRGH
ODOtQHDGHPLUDHQHOHYDFLyQHLQFOX\HXQDFXELHUWDEDOtVWLFDFRQGRVYHQWDQDVXQD
GHJHUPDQLR  SDUDSHUPLWLUHOSDVRGHODUDGLDFLyQ,5KDFLDHO6HQVRUGHOD&7\
ODRWUDGHYLGULRSDUDODYHQWDQDSDQRUiPLFD[  \ORVFDQDOHVGtDOiVHU  
(O HVSHMR   HQOD]D PHFiQLFDPHQWH FRQ HO DUPD D WUDYpV GHO PHFDQLVPR GH
VXSHUHOHYDFLyQSHUPLWLHQGRHOSRVLFLRQDPLHQWRGHODOtQHDGHPLUDHQWRGRHOUDQJR
GH UHFRUULGR GHO FDxyQ \ HO GHVSOD]DPLHQWR GH OD HVFHQD QHFHVDULR SDUD OD
LQWURGXFFLyQGHOiQJXORGHVXSHUHOHYDFLyQUHTXHULGRSDUDEDWLUHOREMHWLYR




)LJXUD&DEH]DGHHVSHMR
 7RUQLOORGHEDUULGR  &DUWXFKRGHVHFDQWHFRQLQGLFDGRUGH
 9HQWDQD,5GHO6HQVRUGHOD KXPHGDG
&iPDUDWpUPLFD  &RORUD]XO6HFR
 9HQWDQDSDQRUiPLFD[  &RORUURVD+XPHGDG&DPELDU
 (VSHMR FDUWXFKRGHVHFDQWH ž
 9HQWDQD8QLGDG9LVXDO/iVHU (VFDOyQ 
 9iOYXODGHSUHVXUL]DFLyQ

F0RQWXUDGHOSHULVFRSLR

/D0RQWXUDGH3HULVFRSLR 03  )LJV\ HVODHVWUXFWXUDGRQGHVHDFRSODQ
SRUODSDUWHVXSHULRUOD&DEH]DGH(VSHMR &( \SRUODLQIHULRUOD89/\HO6HQVRUGH
OD&7$VLPLVPRSHUPLWHHODFRSODPLHQWRGHOFRQMXQWRGHOSHULVFRSLRFRQODWRUUHGHO
YHKtFXOR,QFRUSRUDODYHQWDQDGHREVHUYDFLyQ[FRQVXILOWURGHSURWHFFLyQOiVHU





)LJXUD0RQWXUDGHOSHULVFRSLR




)LJXUD0RQWXUDGHOSHULVFRSLR


127$
/D 03 GLVSRQH GH XQ ILOWUR GH VHJXULGDG LQVWDODGR HQ HO FDQDO GH REVHUYDFLyQ [
TXHSURWHJHDORSHUDGRUGHODUDGLDFLyQOiVHU


G8QLGDGYLVXDOOiVHU 89/ 

/D8QLGDG9LVXDO/iVHU )LJV\ LQFRUSRUDODVVLJXLHQWHVIXQFLRQHV
 2EVHUYDFLyQGHODHVFHQDHQHOHVSHFWURYLVLEOH\DGTXLVLFLyQGHREMHWLYRVVL
ODVFRQGLFLRQHVGHYLVLELOLGDGVRQDGHFXDGDV
 0HGLFLyQGHGLVWDQFLDV WHOpPHWUROiVHU 
 ,QWHJUDXQPHFDQLVPRGHGHVSOD]DPLHQWRGHODOtQHDGHPLUDHQDFLPXW


 3UHVHQWDODLQIRUPDFLyQGHOD'7HQHORFXODUGHOD89/



)LJXUD8QLGDG9LVXDO/iVHU  

1ž'(120,1$&,Ï1 )81&,Ï1
 $32<$)5(17( 
 2&8/$5 5HDOL]DUSXQWHUtDV
 0$1'2(1)248( $MXVWDUGLRSWUtDV
 ,/805(7 5HyVWDWRGHLOXPLQDFLyQGHOUHWtFXOR
 ,17(5583725 6HOHFFLRQDHOHFRTXHVHUiXWLOL]DGRSDUDFDOFXODUOD
35,0(52Ò/7,02 GLVWDQFLDDOEODQFR
 //$9(/È6(5 &RQHFWDRGHVFRQHFWDHOOiVHU
 ,1',&$'25'( ,QGLFDVLKDHQWUDGRKXPHGDGHQHOLQWHULRUGHOD
+80('$' XQLGDG&RQWLHQHXQFDUWXFKRGHVHFDQWH
&RORUD]XO6HFR
&RORUURVD+XPHGDG&DPELDUFDUWXFKRGHVHFDQWH
ž( 
 9È/98/$'( 3HUPLWHSUHVXUL]DUHOSHULVFRSLRPDQWHQLHQGROD
35(685,=$&,Ï1 HVWDQTXHLGDG
 &21087$'25 6HOHFFLRQDPRGR1250$/SDUDGLVSDUROiVHUFRQ
'(/$7(18$'25 SOHQRDOFDQFHRPRGR(175(1$0,(172SDUD
/È6(5 GLVSDUROiVHUFRQHQHUJtDDWHQXDGD
 0$1'2'(/26 ,QWURGXFLUILOWURVHQODySWLFDGHDFXHUGRFRQODV
),/7526 FRQGLFLRQHVGHLOXPLQDFLyQDPELHQWDOHV
 326,&,Ï1,/80,1$&,Ï1),/752
&/$5$12
1(%/,1$1(8752
62/$5$=8/&/$52





)LJXUD8QLGDG9LVXDO/iVHU  


3(/,*52
(/ +$= /È6(5 (6 3(/,*5262 < 38('( &$86$5 &(*8(5$ 6, 12 6(
87,/,=$1 *$)$6 '( 6(*85,'$' /È6(5 12 $3817$5 181&$ (/
7(/e0(752/È6(5+$&,$(/3(5621$/
6, (/ +$= /È6(5 (6 5()/(-$'2 325 81$ 683(5),&,( 3/$1$ <
%5,//$17( 38('( &$86$5 &(*8(5$ $ 0(126 48( 6( 87,/,&(1 *$)$6
'(6(*85,'$'/È6(5


127$
/D 89/ GLVSRQH LQWHUQDPHQWH GH XQ ILOWUR GH VHJXULGDG LQVWDODGR HQ HO RFXODU GHO
FDQDOYLVXDOTXHSURWHJHDORSHUDGRUGHODUDGLDFLyQOiVHUGH1G<$* QP 

H5HWtFXORGHOSHULVFRSLRGHO7LUDGRU




)LJXUD5HWtFXORGHOSHULVFRSLRGHOWLUDGRU



(OWLSRGHPXQLFLyQVHOHFFLRQDGDDSDUHFHHQSDQWDOODPHGLDQWHXQDOHWUDFODYH

7,32'(081,&,Ï1 $/=$'(&20%$7( &/$9((1
HQ+0 3$17$//$
(UURU1LQJXQR  (
0*  $
03737+(,  *
$3)6'6  3


)LJXUD'HWDOOHGHOUHWtFXORGHSXQWHUtD

/DV FDUDFWHUtVWLFDV WpFQLFDV GH ORV GLVWLQWRV HOHPHQWRV VH H[SRQHQ HQ HO 0DQXDO
7pFQLFRFRUUHVSRQGLHQWHDOYHKtFXOR


127$
/RVWLSRVGHPXQLFLyQVHH[SOLFDQHQODILFKDGHHVWHPDQXDO


&È0$5$7e50,&$

/D FiPDUD WpUPLFD SHUPLWH OD YLVLyQ WDQWR GH GtD FRPR GH QRFKH \ HQ FXDOTXLHU
FLUFXQVWDQFLDGHWLHPSRPHWHRUROyJLFR

D(OHPHQWRVTXHODFRPSRQHQ

 6HQVRU WpUPLFR LQVWDODGR HQ HO FXHUSR GHO SHULVFRSLR  TXH D WUDYpV GH OD
YHQWDQD FRUUHVSRQGLHQWH HQ OD FDEH]D GHO SHULVFRSLR FDSWD \ JHQHUD OD
LPDJHQWpUPLFD
 8QLGDGHOHFWUyQLFDGHODFiPDUDWpUPLFDTXHJHQHUD ODDOLPHQWDFLyQGHEDMD
WHQVLyQ\HOFRQWUROGHLQIRUPDFLyQGHUHWtFXORV
 'RV PRQLWRUHV SDQWDOODV  SDUD HO -HIH GH 9HKtFXOR \ 7LUDGRU TXH SUHVHQWDQ
ODVLPiJHQHVWpUPLFDVHOUHWtFXOR\DPERVGLVSRQHQGHPDQGRVGHFRQWUROGH
EULOORWDQWRGHLPDJHQFRPRGHOUHWtFXOR
 3DQHO GH &RQWURO GH 0RQLWRUHV 3&0  TXH GLVSRQH GH ORV PDQGRV TXH
FRQWURODQODWHUPRJUDItDSDUDDPERVWULSXODQWHVVDOYREULOOR\UHWtFXOR



E0RQLWRUGHODFiPDUDWpUPLFD

$PERVPRQLWRUHVHOGHO-9\HOGHO7LUDGRUVRQLJXDOHV



)LJXUD0RQLWRU

1ž '(120,1$&,Ï1 )81&,Ï1
 0RQLWRU 3UHVHQWDUODLPDJHQWpUPLFD
 0DQGRGH%5,//2 &RQWUROEULOORGHODLPDJHQ
 0DQGRGH%5,//25(7,&8/ &RQWUROEULOORGHOUHWtFXOR


F3DQHOGH&RQWUROGH0RQLWRUHVGHODFiPDUDWpUPLFD 3&0 



)LJXUD3DQHOGH&RQWUROGHORV0RQLWRUHV  

1ž '(120,1$&,Ï1 )81&,Ï1


 0DQGR&2175$67( &RQWUROGHJDQDQFLDHQWRGRVORVFDQDOHV
 ,QWHUUXSWRUGH 3RVLFLRQHV
32/$5,'$'  %/$1&2 &$/,(17( /RV FXHUSRV PiV
FDOLHQWHVVHREVHUYDUiQPiVEULOODQWHV
 1(*52 &$/,(17( /RV FXHUSRV PiV
FDOLHQWHVVHREVHUYDUiQPiVRVFXURV
 ,QWHUUXSWRU&$032 (OHJLUHOFDPSRGHYLVLyQ
 $1&+2SDUDREVHUYDFLyQ
 (675(&+2SDUDHOWLUR
 ,QWHUUXSWRU9,6,Ï1 (QFHQGHU 21 RDSDJDU 2)) HO6LVWHPDGH&iPDUD
7e50,&$ 7pUPLFD
 ,QWHUUXSWRU(1)248( $MXVWDUHOHQIRTXHGHOD&iPDUD
 /(-26
 &(5&$


)LJXUD3DQHOGH&RQWUROGHORV0RQLWRUHV  

1ž '(120,1$&,Ï1 )81&,Ï1
 0DQGR6,67(0$ 6HOHFFLRQDUODIRUPDGHIXQFLRQDPLHQWRGHOD
&iPDUD
 7(67$XWRWHVW
 1250$/1RUPDO
 +202+RPRJHQHL]DFLyQ
 ,QGLFDGRU$&7,92 6HHQFLHQGHFXDQGRWRGDVODVWHQVLRQHVGH
$/,0(17$&,Ï1 DOLPHQWDFLyQJHQHUDGDVHQOD8(&7DOFDQ]DQVX
QLYHOQRUPDO



 ,QGLFDGRU$&7,92 6HHQFLHQGHFXDQGRORVGHWHFWRUHVDOFDQ]DQVX
6(1625 WHPSHUDWXUDGHIXQFLRQDPLHQWR . PLQXWRV
GHVSXpVGHHQFHQGHUVHDSUR[LPDGDPHQWH
 &RQPXWDGRUDUWLFXODGR 3HUPLWLUODKRPRJHQHL]DFLyQGHOVLVWHPDPRYLHQGR
PDQGR+202*(1 HOUHWtFXOR$55,%$$%$-2,=4'$<'&+$
)XQFLRQDFRPRXQMR\VWLFN 

G5HWtFXORVGHODFiPDUDWpUPLFD

/DFiPDUDWpUPLFDSHUPLWHWUDEDMDUHQGRVPRGRV
F  0RGR2EVHUYDFLyQORFDOL]DFLyQGHEODQFRV
G  0RGR3XQWHUtD
$PERV PRGRV SXHGHQ VHOHFFLRQDUVH FRQ HO LQWHUUXSWRU &$032 )LJ  Qž 
$PEDVLPiJHQHVRIUHFHQODVLJXLHQWHLQIRUPDFLyQ



)LJXUD,PDJHQHQFDPSRDQFKR

 'LVWDQFLDHQ   $O]DGHFRPEDWHRGLVWDQFLDDOWHUQDWLYD
GHFiPHWURV
 7LSRVGHPXQLFLyQ   )DOORGHOVLVWHPD
$$PHWUDOODGRUD   5HWtFXORLQGLFDQGRHOiUHDDEDUFDGDHQ
*0373+(, FDPSRDQFKR
3$3)6'6   HURƒ(&2
  3XQWRVHFRVP~OWLSOHV





)LJXUD,PDJHQHQFDPSRHVWUHFKR

 'LVWDQFLDHQGHFiPHWURV   )DOORGHOVLVWHPD
 7LSRVGHPXQLFLyQ   5HWtFXORPyYLO
$$PHWUDOODGRUD     5HWtFXORILMR
*73+(,03   HU
 Rƒ(&2
3$3)6'6   3XQWRVHFRVP~OWLSOHV
 $O]DGHFRPEDWHRGLVWDQFLD   
DOWHUQDWLYD


5(680(1

(QHVWDILFKDVHGHVFULEHQHLGHQWLILFDQORVHOHPHQWRVGHREVHUYDFLyQ\SXQWHUtDGHO
7LUDGRUSHUWHQHFLHQWHVDODGLUHFFLyQGHWLUR0.QRVHFRQVLGHUDFRQYHQLHQWH
UHDOL]DUXQUHVXPHQGHORVPLVPRV

35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVH
ODWRUUHOLEUHPHQWH\FRQURWDWLYRSXHVWRHQFDVRQHFHVDULR(O9&,GHEHHQFRQWUDUVH
FRQ PRWRU DSDJDGR DXQTXH SDUD HVWDV RSHUDFLRQHV VH SRGUi RUGHQDU TXH VH
DUUDQTXH R TXH VH HQFKXIH XQD IXHQWH GH DOLPHQWDFLyQ H[WHUQD (9,7521  &DGD
HYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

([SOLFDFLyQGHSHULVFRSLRGHOWLUDGRUIXQFLyQODVHU\UHWtFXORV
3XHVWDHQIXQFLRQDPLHQWRGHOD&7IXQFLyQPRGRVGHIXQFLRQDPLHQWR\UHWtFXORV


6,78$&,Ï1),1$/

7RUUHHQFHQGLGD&7\89/HQIXQFLRQDPLHQWR



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1',5(&&,Ï1'(7,520.)81&,21$0,(172 ,, 

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFD  PLQXWRV SRU
7ULS
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV
3DUD OD SUiFWLFD VH FRORFDUi XQ YHKtFXOR HQ XQ OXJDU DSURSLDGR SDUD HQ FDVR
QHFHVDULRSRGHUPRYHUOLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVX
PRYLPLHQWR(OWULSXODQWHVHVLWXDUiHQHOSXHVWRGHO7LUDGRUSDUDTXHFXDQGRVHOHV
LQGLTXHSRQJDQHQIXQFLRQDPLHQWRORVFRPSRQHQWHVGHOD'7


5(48,6,726$$/&$1=$5

(OWULSXODQWHGHEHGHVHUFDSD]GHSRQHUHQIXQFLRQDPLHQWROD8&3\VDEHUXWLOL]DUOD
\VHUFDSD]GHSRQHUHQPDUFKDOD'LUHFFLyQ7LURGHOYHKtFXOR

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV


'(6$552//27(Ï5,&2'(/&217(1,'2

81,'$''(&21752/35,1&,3$/ 8&3 

6H WUDWD GH XQ SDQHO TXH GLVSRQH GH ORV GLVWLQWRV LQWHUUXSWRUHV SXOVDGRUHV H
LQGLFDGRUHV SDUD HO PDQHMR \ IXQFLRQDPLHQWR GHO FRPSXWDGRU 3HUPLWH LQWURGXFLU \
SUHVHQWDULQIRUPDFLyQFRQWUROGHVHQVRUHV\HIHFWXDUDMXVWHV




)LJXUD8QLGDGGH&RQWURO3ULQFLSDO  


1ž '(120,1$&,Ï1 )81&,Ï1
 &RQPXWDGRU DUWLFXODGR 0RYHU HO UHWtFXOR GH SXQWHUtD DUULED DEDMR GHUHFKD R
+202*(1(,=$&,Ï1 L]TXLHUGDGXUDQWHODVRSHUDFLRQHV MR\VWLFN 
 7HVWLJR3:5 6HHQFLHQGH YHUGH FXDQGRHOLQWHUUXSWRUSULQFLSDOHVWi
HQ21
 ,QWHUUXSWRUSULQFLSDO &RQHFWDU 21  R DSDJDU 2))  OD 8&3 \ OD 'LUHFFLyQ
GH7LUR
 7HVWLJR)$//2 ,QGLFD GH IRUPD OXPLQRVD HQ URMR  XQ IDOOR TXH QR
SHUPLWDODRSHUDWLYLGDGGHOVLVWHPD
 3XOVDGRU7(67 9HULILFDHOIXQFLRQDPLHQWRGHODVOiPSDUDV ORVWHVWLJRV
SHUPDQHFHQ HQFHQGLGRV PLHQWUDV VH PDQWLHQH HO
LQWHUUXSWRUHQSRVLFLyQ7(67SUHVLRQDQGRKDFLDDEDMR 
8QDYH]VROWDGRYXHOYHDVXSRVLFLyQLQLFLDOYHULILFDQGR
HOVLVWHPDHQVHJXQGRV
 3XOVDGRU+202 3HUPLWHLQWURGXFLUFRUUHFFLRQHVGHKRPRJHQHL]DFLyQ
 3XOVDGRU&(52 3HUPLWHLQWURGXFLU\FRPSUREDUORVHUURUHVVLVWHPiWLFRV
GHODPXQLFLyQ
 3XOVDGRU',67$ F 3XOViQGROR SHUPLWH LQWURGXFLU QRUPDOPHQWH OD
GLVWDQFLD
G 6L VH HQFLHQGH DXWRPiWLFDPHQWH LQGLFD IDOOR HQ HO
IXQFLRQDPLHQWR GHO WHOpPHWUR OiVHU (QWUD
DXWRPiWLFDPHQWH HO DO]D GH FRPEDWH GHO DUPD
VHOHFFLRQDGD





)LJXUD8QLGDGGH&RQWURO3ULQFLSDO  

1ž '(120,1$&,Ï1 )81&,Ï1
 3XOVDGRU6(16$1*8 F  $O SXOVDUOR SRQH IXHUD GH VHUYLFLR DO VHQVRU \
 DXWRPiWLFDPHQWH LQWURGXFH HO YDORU ³´ FRPR
iQJXORGHLQFOLQDFLyQ
G  $OLOXPLQDUVHDXWRPiWLFDPHQWHLQGLFDDQXODFLyQ
SRU PRYLPLHQWR R SRU IDOOR HQ HO VHQVRU GH
LQFOLQDFLyQGHYHKtFXOR
 3XOVDGRU&/($5 %RUUDUHOYDORUQXPpULFRTXHVHxDOHODSDQWDOOD
 3XOVDGRU(17(5 ,QWURGXFLUORVGDWRVPRVWUDGRVHQODSDQWDOOD
 7HVWLJRVGHPXQLFLyQ 3UHVHQWDQWLSRGHPXQLFLyQVHOHFFLRQDGR
 3XOVDGRU9,(17 3HUPLWH OD LQWURGXFFLyQ PDQXDO GH HVWH SDUiPHWUR
PHGLDQWHHOWHFODGRQXPpULFR
 3XOVDGRU$/7, ,QWURGXFLUPDQXDOPHQWHODDOWLWXG
 3XOVDGRU7(03$,5( ,QWURGXFLUPDQXDOPHQWHODWHPSHUDWXUDDPELHQWH
 0DQGRGHEULOOR 3RWHQFLyPHWURSDUDFRQWURODUHOEULOORGHOD8&3
 7HFODGRQXPpULFR 3HUPLWH LQWURGXFLU ORV GDWRV FRUUHVSRQGLHQWHV FXDQGR
VHRSULPHDOJ~QSXOVDGRUGHOWDEOHUR
 3DQWDOOD F  3UHVHQWDHOYDORUQXPpULFRTXHVHLQWURGX]FDHQ
HO FRPSXWDGRU PHGLDQWH HO WHFODGR R HO YDORU
PHGLGR DO UHDOL]DU ORV DMXVWHV GHO YLVRU /RV
WHVWLJRVGHDEDMRPDUFDGRVFRQIOHFKDVLQGLFDQ
HO VHQWLGR TXH WRPDQ ORV YDORUHV
FRUUHVSRQGLHQWHVGH$=,087\(/(9$&,21
G  3RU GHIHFWR PXHVWUD HO WLSR GH PXQLFLyQ
VHOHFFLRQDGD


38(67$(1)81&,21$0,(172'(/$'7

D3XHVWDHQVHUYLFLRGHOD'LUHFFLyQGH7LUR

D  $55$148('(/6,67(0$




8QD YH] SXHVWR HQ  HO ,17 35,1 %$7(5,$6 VREUH HO SDQHO GH LQVWUXPHQWRV GHO
FRQGXFWRU\HQ21HOLQWHUUXSWRUJHQHUDO7255(VREUHHO3DQHOGH&RQWURO3ULQFLSDO
GHODWRUUH

  (QHOSDQHOGHOD8QLGDGGH&RQWURO3ULQFLSDOGHOD'LUHFFLyQGH7LUR 8&3 
 3RQHUHQ21HOLQWHUUXSWRUJHQHUDO6HHQFLHQGHODOiPSDUD3:5
  (QHOSHULVFRSLRGHO7LUDGRU 89/ 
 ,QWURGXFLUODOODYHGHOWHOpPHWUROiVHU\SDVDUDODSRVLFLyQ21
  6LIXHUDDXVDUVHODFiPDUDWpUPLFD
HQHO3DQHOGH&RQWUROGH0RQLWRUHV
GHODFiPDUDWpUPLFD 3&0 
 3RQHU HQ 21 HO LQWHUUXSWRU 9,6,21 7(50,&$ \ HVSHUDU HQWUH  \  PLQ
KDVWDDOFDQ]DUODWHPSHUDWXUDGHIXQFLRQDPLHQWR
 $MXVWDU(1)248(\VHOHFFLRQDU&$032\32/$5,'$'

D  358(%$'(/6,67(0$ )LJ 

(QOD8&3SUHVLRQDUHOSXOVDGRU7(67  KDFLDDEDMR\FRPSUREDUORVLJXLHQWH


)LJXUD3UXHEDGHOVLVWHPD

  7RGDV ODV OiPSDUDV GH OD 8&3 VH LOXPLQDQ PLHQWUDV HVWp SXOVDGD OD WHFOD
7(67
  /DSDQWDOODGHOD8&3  LQGLFDHQODSUXHEDGHOiPSDUDV
  (QHORFXODUGHOSHULVFRSLR GHOWLUDGRUDSDUHFHODLQGLFDFLyQ  \ODV
WUHVOXFHV  GHGHEDMRGHOLQGLFDGRUGHGLVWDQFLDVHLOXPLQDQ
  (QHOVLVWHPDGHYLVLyQWpUPLFDVLHO3&0HVWiHQFHQGLGRHQSRVLFLyQ7(67
 
D /DVSDQWDOOD  LQGLFDQ
E 6HLOXPLQDQORVLQGLFDGRUHV  GHHVWDGRGHOVLVWHPD WHPSHUDWXUDGHO
VLVWHPD\YHUVLyQGHOVRIWZDUH 



7DQ SURQWR FRPR VH VXHOWD OD WHFOD 7(67   FRPLHQ]D OD SUXHED DXWRPiWLFD 6L
GHVSXpV GH FLQFR VHJXQGRV QR VH LOXPLQD OD OiPSDUD )$//2   HO VLVWHPD KD
SDVDGR OD SUXHED (O VLVWHPD YHULILFD FRQWLQXDPHQWH SRVLEOHV IDOORV R DYHUtDV
GXUDQWHHOIXQFLRQDPLHQWRQRUPDOSRUORTXHSXHGHRFXUULUTXHODOiPSDUD)$//2VH
LOXPLQHGHIRUPDFRQWLQXDDXQQRKDELpQGRVHSXOVDGRODWHFOD7(67(QHOFDVRTXH
VHLOXPLQHODOiPSDUD)$//2LQGLFDXQDDYHUtDJUDYH6HGHEHUiDSDJDUHOVLVWHPD
\XWLOL]DUHOVLVWHPDVHFXQGDULRGHSXQWHUtD

E$MXVWH\SXHVWDDSXQWRGHORVHOHPHQWRVGHSXQWHUtD

E  ,1752'8&&,Ï1'('$726(1/$8&3




)LJXUD,QWURGXFFLyQGHGDWRV

3XOVDU HO ERWyQ FRUUHVSRQGLHQWH DO SDUiPHWUR GHVHDGR 6H HQFLHQGH OD OX] GHO
SXOVDGRU \ DSDUHFH HQ OD SDQWDOOD HO YDORU FRUUHVSRQGLHQWH DO SDUiPHWUR
LQWURGXFLGR
 6L VH GHVHD FDPELDU HO GDWR GH WHPSHUDWXUD DWPRVIpULFD VH SXOVD HO ERWyQ
7(03 $,5( )LJ  Qž   VH HQFLHQGH OD OX] \ DSDUHFH HQ OD SDQWDOOD HO
~OWLPRYDORUFRUUHVSRQGLHQWHDODWHPSHUDWXUDDWPRVIpULFDSRUHMHPSORž&
 6L QR VH GHVHD FDPELDU HO SDUiPHWUR TXH DSDUHFH HQ SDQWDOOD VH SXOVD OD
WHFOD(17(5 )LJQž \VHDSDJDODOX]GHOERWyQSXOVDGRU\ODOHFWXUD
GHODSDQWDOODYXHOYHDPRVWUDUHOWLSRGHPXQLFLyQ
 6LVHGHVHDFDPELDUHOYDORUGHXQDYDULDEOH\DHOHJLGDVHXWLOL]DQODVWHFODV
QXPpULFDVGHOWHFODGRTXHYDQGHODOODFRPDGHFLPDO\HOVLJQRPHQRV
 6L VH GHVHD FDPELDU HO SDUiPHWUR GH WHPSHUDWXUD DWPRVIpULFD GHO YDORU TXH
DSDUHFH HQ SDQWDOOD SRU HMHPSOR GH  D ž & VH SXOVDUiQ ODV WHFODV
QXPpULFDV\\DSDUHFHUiHQSDQWDOODHOYDORU$FRQWLQXDFLyQSDUDTXH
GLFKR GDWR TXHGH LQWURGXFLGR HQ HO FRPSXWDGRU VH GHEH SXOVDU OD WHFOD
(17(5
 6LVHKDFRPHWLGRXQHUURUDOSXOVDUODVWHFODVQXPpULFDVVHSXOVDUiODWHFOD
&/($5 )LJQž FRQORTXHDSDUHFHUiGHQXHYRHQODSDQWDOODHOGDWR
RULJLQDO SHUPLWLHQGR OD LQWURGXFFLyQ GHO QXHYR GDWR 3RU HMHPSOR VL HQ OXJDU
GH PDUFDU  HO RSHUDGRU KD PDUFDGR  SXOVDQGR OD WHFOD &/($5 HQ OD
SDQWDOOD YROYHUi D DSDUHFHU HO YDORU RULJLQDO   PDUFiQGRVH GH QXHYR HO
YDORUGHVHDGR\SXOVDQGRDFWRVHJXLGRODWHFOD(17(5


 6L VH LQWHQWD LQWURGXFLU XQ YDORU IXHUD GH ORV OtPLWHV SHUPLWLGRV HO ERWyQ
SXOVDGRU \ OD SDQWDOOD HQWUDUiQ HQ LQWHUPLWHQFLD \ FRQWLQXDUiQ DVt KDVWD
TXH VH SXOVH &/($5 GHVSXpV GH OR FXDO VH YROYHUi D LQWURGXFLU HO GDWR
FRUUHFWR 'HVGH HO PRPHQWR TXH VH SXOVH XQD GH ODV WHFODV GH SDUiPHWURV
KDVWD TXH HO GDWR VH KD LQWURGXFLGR VDWLVIDFWRULDPHQWH HQ HO FRPSXWDGRU QR
VHSXHGHQHOHJLURWUDVWHFODVGHSDUiPHWURVGLVWLQWRV

(Q OD WDEOD VLJXLHQWH DSDUHFHQ ODV YDULDEOHV TXH VH SXHGHQ PRGLILFDU HQ OD 8&3
HPSOHDQGRHOWHFODGR\VXVUHVSHFWLYDVXQLGDGHVGHUHVROXFLyQ\OtPLWHV

3$5È0(752 81,'$' 9$/25 9$/25 5(62/8&,Ï1 9$/25325
0È; 0Ë1 '()(&72

'LVWDQFLD PHWURV    $O]DGHFRPEDWH

9LHQWRWUDQVYHUVDO PVHJ    &HUR

$OWLWXG PHWURV    ÒOWLPDLQWURGXFLGD


7HPSHUDWXUDDLUH ƒ&    ÒOWLPDLQWURGXFLGD
0XQLFLyQ QLQJXQD    
3XHVWDDFHUR  PLOpVLPDV    ÒOWLPDLQWURGXFLGD
+RPRJHQHL]DFLyQ PLOpVLPDV    ÒOWLPDLQWURGXFLGD

)DOORV



)LJXUD)DOORVHQOD'7

'RV VHQVRUHV HO WHOpPHWUR OiVHU \ HO VHQVRU GH iQJXOR GH LQFOLQDFLyQ VH YHULILFDQ
FRQWLQXDPHQWHUHVSHFWRDSRVLEOHVIDOORV6LVHSURGXFHXQIDOORVHHQFHQGHUiXQR
GH ORV SXOVDGRUHV ',67$ R ELHQ 6(16 $1*8 GH OD 8&3 UHVSHFWLYDPHQWH 
LQGLFDQGRTXHKDIDOODGRHOVHQVRU/DOiPSDUD)$//2HQOD8&3QRVHHQFHQGHUi
HQFDVRGHTXHVHSURGX]FDXQIDOORRDYHUtDGHHVWHWLSR
6LVHLOXPLQDODWHFODGH',67$GHELGRDXQIDOORHQHO7HOpPHWURVHSXHGHLQWURGXFLU
PDQXDOPHQWH GDWRV FRUUHVSRQGLHQWHV D OD GLVWDQFLD HVWLPDGD (Q FDVR FRQWUDULR
DSDUHFHUiFRPRGLVWDQFLDODGHO³$O]DGHFRPEDWH´GHODPXQLFLyQVHOHFFLRQDGD
1R REVWDQWH GHVSXpV GH SXOVDU (17(5 HO SXOVDGRU FRUUHVSRQGLHQWH SHUPDQHFHUi
LOXPLQDGRLQGLFDQGRXQDFLUFXQVWDQFLDGHIDOOR


3UHVLRQDQGRODWHFOD6(16$1*8VHDQXODHOVHQVRUGHiQJXORLQFOLQDGRSHURQR
VHSXHGHQKDFHULQWURGXFFLRQHVPDQXDOHV3RUHOFRQWUDULRVLVHSURGXFHXQIDOORR
HO YHKtFXOR VH HQFXHQWUD LQFOLQDGR PiV GH ž VH LQWURGXFH DXWRPiWLFDPHQWH HO
YDORUFHURHQHOFRPSXWDGRUGLJLWDO
6LHOYHKtFXORHVWiHQPRYLPLHQWRHOVHQVRUVHDQXODSHURYXHOYHDDFWLYDUVHFXDQGR
VHUHFXSHUDODVLWXDFLyQGHUHSRVRHQHOYHKtFXOR6LQHPEDUJRVLKDVLGRDQXODGR
PDQXDOPHQWH DQWHV GH SRQHUVH HQ PRYLPLHQWR QR VH UHFXSHUDUi DO GHWHQHUVH HO
YHKtFXOR
6L QR H[LVWHQ IDOORV QL DYHUtDV QR VH LOXPLQDUi QLQJXQD GH ODV WHFODV ',67$ R
6(16$1*8 1R REVWDQWH HQFDVRV HVSHFLDOHV VL VH GHVHDUD VXSULPLU XQ VHQVRU
VHSXOVDUiODWHFODFRUUHVSRQGLHQWH&XDQGRVHWUDWHGHGDWRVGHGLVWDQFLDVHSXHGH
LQWURGXFLUPDQXDOPHQWHODGLVWDQFLDHVWLPDGD


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ H LGHQWLILFDQ ORV HOHPHQWRV \ ORV SDVRV D VHJXLU SDUD HO
IXQFLRQDPLHQWR GH OD GLUHFFLyQ GH WLUR 0. QR VH FRQVLGHUD FRQYHQLHQWH UHDOL]DU
XQUHVXPHQGHORVPLVPRV


35È&7,&$6

6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVH
ODWRUUHOLEUHPHQWHHQFDVRQHFHVDULR(O9&,GHEHHQFRQWUDUVHFRQPRWRUDSDJDGR
DXQTXHSDUDHVWDVRSHUDFLRQHVVHSRGUiRUGHQDUTXHVHDUUDQTXHRTXHVHHQFKXIH
XQDIXHQWHGHDOLPHQWDFLyQH[WHUQD (9,7521 &DGDHYDOXDGRVXELUiDOSXHVWRGHO
7LUDGRUGHO9&,FRQHOLQVWUXFWRUTXHRFXSDUiHOGH-HIHGH9HKtFXOR

$&&,21(6$5($/,=$5

([SOLFDFLyQ GH WRGRV ORV PDQGRV H LQGLFDGRUHV GH OD 8&3 DVt FRPR GH OD
LQWURGXFFLyQGHGDWRVHQODPLVPD
3XHVWDHQIXQFLRQDPLHQWRGHOD'7
,QWURGXFFLyQGHGDWRVHQOD8&3


6,78$&,Ï1),1$/

'7DSOHQRIXQFLRQDPLHQWR


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

4XHGDUiQDSDJDGRVWRGRVORVFRPSRQHQWHVGHOD'7DGHPiVGHOD7RUUHGHO9&,
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1',5(&&,Ï1'(7,520.+202*(1(,=$&,Ï1<38(67$
$&(52

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\&DPSR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVSRU9&,
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
3DQFDUWDGH+RPRJHQHL]DFLyQ
&HQWUDGRUGHERFD
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



'(6$552//27e&1,&2'(/&217(1,'2

3ULPHUR OD H[SOLFDFLyQ WHyULFD VH UHDOL]DUi HQ XQ DXOD \ SRVWHULRUPHQWH VREUH XQ
YHKtFXOR \ HQ HO FDPSR VH SURFHGHUi D OD UHDOL]DFLyQ SUiFWLFD WHQLHQGR GRV
WULSXODQWHVSRULQVWUXFWRU\YHKtFXOR8QRGHORVWULSXODQWHVVHVLWXDUiHQHOSXHVWRGHO
7LUDGRU\HORWURVHHQFRQWUDUiFRQHOFHQWUDGRUGHERFD


5(48,6,726$$/&$1=$5

(O WULSXODQWH GHEH VHU FDSD] GH UHDOL]DU OD KRPRJHQHL]DFLyQ GH OD '7 (Q
FRPELQDFLyQFRQHOUHVWRGHODWULSXODFLyQ \ODSXHVWDDFHUR'HEHVDEHUKDFHUOD
FRPSHQVDFLyQ GH OD GHULYD \ UHDOL]DU OD SXQWHUtD GH ODV DUPDV VHJ~Q ORV GLIHUHQWHV
SURFHGLPLHQWRVH[LVWHQWHV

6HFRQVLGHUDUiTXHHOWULSXODQWHKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2


+202*(1(,=$&,Ï1

(OSURFHGLPLHQWRGHKRPRJHQHL]DFLyQFRQVLVWHHQKDFHUFRLQFLGLUHOHMHGHXQDUPD
FRQ OD OtQHD GH PLUD GHO R ORV HOHPHQWRV GH SXQWHUtD DVRFLDGRV D XQD GLVWDQFLD
GHWHUPLQDGD



/DKRPRJHQHL]DFLyQVHOOHYDUiDFDERVLHPSUHDQWHVGHRSHUDFLRQHVRHMHUFLFLRVHQ
ODVTXHVHSUHYHDHOHPSOHRGHOVLVWHPDGHDUPDV
/DKRPRJHQHL]DFLyQGHODVDUPDVFRQORVVLVWHPDVGHSXQWHUtDVSXHGHUHDOL]DUVH
D  6REUHXQEODQFRDP
E  &RQODSDQFDUWDGHKRPRJHQHL]DFLyQ

D3URFHVRJHQHUDOVREUHEODQFRDP )LJ 

&RQHOYHKtFXORHQSRVLFLyQVHQVLEOHPHQWHKRUL]RQWDO
  3RQHUHQVHUYLFLROD'7 YHUILFKDGHHVWHPDQXDO 
  (IHFWXDUODSUXHEDGHOVLVWHPD YHUILFKDGHHVWHPDQXDO 
  &RORFDUXQFHQWUDGRUGHERFDHQHOFDxyQSDUDGHILQLUVXHMH
  /RFDOL]DUXQEODQFRSDUDKRPRJHQHL]DUVLWXDGRDXQDGLVWDQFLDDSUR[LPDGD
GHPHWURVGHELHQGRHVWDUYHKtFXOR\EODQFRHQWHUUHQRKRUL]RQWDO


 127$
(O VLVWHPD SXHGH KRPRJHQHL]DU D FXDOTXLHU GLVWDQFLD FRPSUHQGLGD HQWUH  \
 PHWURV VH UHFRPLHQGD D  PHWURV SRU VHU HO FiOFXOR GH SDUDODMH D HVWD
GLVWDQFLDPHQRUDPLOpVLPDV 

  $SXQWDUHOUHWtFXORGHSXQWHUtDGHOFDQDOGLXUQRGHOWLUDGRUDOEODQFR\GLVSDUDU
HO OiVHU FRPSUREDQGR OD YDOLGH] GH OD GLVWDQFLD 'HMDU LQWURGXFLGD HVD
GLVWDQFLD


127$
'XUDQWH HO SURFHVR GH KRPRJHQHL]DFLyQ HV GH YLWDO LPSRUWDQFLD HYLWDU
LQIOXHQFLDV H[WHUQDV 1R UHDOL]DU PRYLPLHQWRV GH SHUVRQDO VREUH HO YHKtFXOR
PDQWHQHUHOYHKtFXORFRQHOPRWRUSDUDGRQRDSR\DUVHHQHOFDxyQ«

  3XOVDUODWHFOD+202   VHHQFHQGHUi GHOD8&3
  6LWXDU HQ +202 HO PDQGR 6,67(0$   GHO 3DQHO GH &RQWURO GH 0RQLWRUHV
3&0 



)LJXUD+RPRJHQHL]DFLyQGHOD'7  



  &RQ ORV PDQGRV PDQXDOHV DSXQWDU HO HMH GHO FDxyQ DO EODQFR GH
KRPRJHQHL]DFLyQ   5HDOL]DU OD SXQWHUtD ILQDOL]DQGR HO PRYLPLHQWR GH
L]TXLHUGDDGHUHFKD\GHDEDMRKDFLDDUULED
  5HDOL]DUHO7(67GHžHQHOFHQWUDGRUGHERFD*LUDUžHOFHQWUDGRUGH
ERFD \ FRPSUREDU TXH VH PDQWLHQH OD SXQWHUtD VREUH HO EODQFR GH
KRPRJHQHL]DFLyQ (Q FDVR FRQWUDULR   FRUUHJLU SRU PHGLR GH ORV PDQGRV
GHOYLVRUDFRGDGR D\XGiQGRVHGHOGHVWRUQLOODGRUGHFDEH]D3KLOOLSV ODPLWDG
GHOHUURUDQJXODU  
9ROYHU D DSXQWDU HO HMH GHO FDxyQ DO EODQFR GH KRPRJHQHL]DFLyQ FRQ ORV
PDQGRVPDQXDOHV)LQDOL]DUHOPRYLPLHQWRGHL]TXLHUGDDGHUHFKD\GHDEDMR
KDFLDDUULED



)LJXUD

 3RU PHGLR GHO FRQPXWDGRU DUWLFXODGR GH DMXVWH GHO UHWtFXOR HQ OD 8&3  
GHVSOD]DUHOUHWtFXORGHOSHULVFRSLRGHOWLUDGRU RFXODUGLXUQR KDVWDFRORFDUOR
VREUH HO EODQFR GH KRPRJHQHL]DFLyQ (Q OD SDQWDOOD GH OD 8&3 DSDUHFHUi HO
YDORUGHOiQJXOR\ODVIOHFKDVGHORVSLORWRVGHDEDMRQRVLQGLFDUiQHOVHQWLGR
GHPLVPR3RVLWLYR
 'HUHFKDDUULED
 1HJDWLYR,]TXLHUGDDEDMR
 8WLOL]DQGRHOFRQPXWDGRU+202*(1GHO3&0  GHVSOD]DUHOUHWtFXORGHORV
PRQLWRUHV GH FiPDUD WpUPLFD KDVWD VLWXDUOR VREUH HO EODQFR GH
KRPRJHQHL]DFLyQ
 9ROYHU D OD SRVLFLyQ 1250$/ HO PDQGR 6,67(0$ GHO 3&0 /D OHFWXUD
TXHGDUiPHPRUL]DGD
 3XOVDU ODV WHFODV (17(5 \ +202 VH DSDJDUi  GH OD 8&3 4XHGDUi
PHPRUL]DGDODOHFWXUD
 +RPRJHQHL]DUHO3HULVFRSLRGHO-9 YHUILFKDGHHVWHPDQXDO 
 +RPRJHQHL]DUODDPHWUDOODGRUD YHUILFKDGHHVWHPDQXDO 
 $QRWDUHQHOOLEURGHILOLDFLyQORVYDORUHVOHtGRVHQOD8&3


127$
2SFLRQDOPHQWH FXDQGR VH FRQRFHQ ORV YDORUHV GH KRPRJHQHL]DFLyQ VH SXHGHQ
LQWURGXFLUPHGLDQWHHOWHFODGRQXPpULFRHQOXJDUGHXWLOL]DUHOFRQPXWDGRUDUWLFXODGR
XWLOL]DQGR HO VLJQR PHQRV   SDUD GHVSOD]DU HO UHWtFXOR KDFLD DEDMR \R KDFLD OD
L]TXLHUGD






)LJXUD,PDJHQHQPRGRKRPRJHQHL]DFLyQ


 'DWRVHQPLOpVLPDVGHHOHYDFLyQGHO   'LVWDQFLDHQGHFiPHWURV
UHWtFXOR
 'DWRVHQPLOpVLPDVGHD]LPXWGHO   7LSRVGHPXQLFLyQ
UHWtFXOR $$PHWUDOODGRUD  
 5HWtFXOR27$1  *73+(,03
 $O]DGHFRPEDWHRGLVWDQFLD  3$3'6)6
DOWHUQDWLYD
 HURƒ(&2 

E+RPRJHQHL]DFLyQGHODDPHWUDOODGRUD

9HUILFKDGHHVWHPDQXDO

F3URFHVRJHQHUDOVREUHSDQFDUWDGHKRPRJHQL]DFLyQ

3DUDHOORFRQHOYHKtFXORHQSRVLFLyQVHQVLEOHPHQWHKRUL]RQWDO
&RORFDU OD SDQFDUWD GH KRPRJHQHL]DFLyQ D P GHO HMH GH PXxRQHV HO HMH GH
PXxRQHVGLVWDPGHODERFDGHOFDxyQHVWDQGRODERFDGHOFDxyQDPGHOD
SDQFDUWD SHUSHQGLFXODUD ODOtQHDGHPLUD\FRQ ODFUX]FRUUHVSRQGLHQWHDOHMHGHO
FDxyQDODPLVPDDOWXUD P  )LJ 





)LJXUD3DQFDUWDGHKRPRJHQHL]DFLyQ

(MHFXWDUORVPLVPRVSDVRVTXHHQHOFDVRGHEODQFRDP


38(67$$&(52

(VWH DMXVWH GHEH UHDOL]DUVH LQGHSHQGLHQWHPHQWH SDUD FDGD XQR GH ORV WLSRV GH
PXQLFLyQTXHYD\DQDVHUXWLOL]DGRVSRUHODUPDSULQFLSDO

D&RQGLFLRQHVLQLFLDOHV

  /RVVLVWHPDVGHSXQWHUtDV\GHDUPDVHVWiQKRPRJHQHL]DGRV
  /DV WDEODV GH WLUR GH OD PXQLFLyQ GH FDGD FDUJDGRU HVWiQ FDUJDGDV HQ HO
3DQHOGH&RQWUROGHDUPDVGHO-9 YHUILFKDGHHVWHPDQXDO 

E3URFHGLPLHQWR

  6LWXDU XQ EODQFR FDSD] GH UHFRJHU ORV LPSDFWRV GH ORV GLVSDURV D XQD
GLVWDQFLDDSURSLDGDGHOYHKtFXOR PVSDUDPXQLFLyQ73\PVSDUD
PXQLFLyQ$3)6'6 YHKtFXOR\EODQFRHQWHUUHQRKRUL]RQWDO
  &RPSUREDUFRQHOOiVHUODGLVWDQFLDDOEODQFRHLQWURGXFLUODFRPRSDUiPHWUR





)LJXUD3XHVWDDFHURGHOD'7

  $SXQWDUHOSHULVFRSLRGHO7LUDGRUDOEODQFR
  5HDOL]DUXQDVHULHGHWUHVDFLQFRGLVSDURVYROYLHQGRDDSXQWDUDOFHQWURGHO
EODQFR GHVSXpV GH FDGD XQR GHWHUPLQDQGR SRVWHULRUPHQWH HO FHQWUR GH
LPSDFWRV
  'HVSXpVGHO~OWLPRGLVSDURYROYHUDDSXQWDUGHQXHYRDOFHQWURGHOEODQFRSRU
PHGLRGHORVPDQGRVPDQXDOHV
  3UHVLRQDUODWHFOD&(52 VHHQFHQGHUi GHOD8&3 )LJQž 
  3RU PHGLR GHO FRQPXWDGRU DUWLFXODGR GHO DMXVWH GH UHWtFXOR )LJ  Qž  
GHVSOD]DUHOUHWtFXORGHOYLVRUKDVWDHOFHQWURGHLPSDFWRV
  3XOVDUODWHFOD(17(5 VHDSDJDUiODWHFOD&(52  )LJQž 




)LJXUD3XHVWDDFHUR


&203(16$&,Ï1'(/$'(5,9$'(/*,5Ï6&232

3DUD OD XWLOL]DFLyQ GH OD SUHGLFFLyQ ODWHUDO TXH SURSRUFLRQD OD 'LUHFFLyQ GH 7LUR VH
UHTXLHUHSURFHGHUSUHYLDPHQWHDUHDOL]DUODFRPSHQVDFLyQGHGHULYDSUHVLRQDQGRHO
FRUUHVSRQGLHQWHSXOVDGRU&203'(5,VLWXDGRHQHOSDQHOGHPDQGRSULQFLSDOGHOD
WRUUH'HEHUiQHVWDUHQ21ORVLQWHUUXSWRUHV7255(6(592\(67$%
(VWHSXOVDGRUVHGHEHUiPDQWHQHUSUHVLRQDGRXQRVVHJXQGRV(QHVWHWLHPSROD
FRPSHQVDFLyQ GHOJLUyVFRSRVHUiPHGLGD\ ORVYDORUHVREWHQLGRVDOPDFHQDGRVHQ
PHPRULD SRU HO FRPSXWDGRU EDOtVWLFR (VWD RSHUDFLyQ GHEH KDFHUVH WUDQVFXUULGRV


HQWUH  \  PLQXWRV GHVGH KDEHU FRQHFWDGR HQ 21  ORV SXOVDGRUHV 6(592 \
(67$%\UHSHWLUVHFDGDGRVKRUDV


5(680(1

(QHVWDILFKDVHGHVFULEHQHLGHQWLILFDQORVHOHPHQWRV\ORVSDVRVDVHJXLUSDUDHO
IXQFLRQDPLHQWRGHODGLUHFFLyQGHWLUR0.QRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DU
XQUHVXPHQGHORVPLVPRV


35È&7,&$6

6,78$&,Ï1,1,&,$/

9&, HQ &DPSR GH PDQLREUDV 3DQFDUWD GH KRPRJHQHL]DFLyQ D  PHWURV \ HQ
FDVRGH3XHVWDD&HURSDQFDUWDDODGLVWDQFLDGHPSDUDPXQLFLyQ0373
\PSDUD$3)6'6R$3'6
&DGD9&,UHDOL]DUiHOSURFHGLPLHQWRGH+RPRJHQHL]DFLyQSRU7ULSXODFLRQHV


$&&,21(6$5($/,=$5

&RORFDUHOYHKtFXORDODGLVWDQFLDGHPGHODSDQFDUWDGHKRPRJHQHL]DFLyQ
5HDOL]DUODKRPRJHQHL]DFLyQHQOD'7
5HDOL]DUODKRPRJHQHL]DFLyQGHO3
([SOLFDUiORVSDVRVSDUDUHDOL]DUOD3XHVWDD&HUR
5HDOL]DODFRPSHQVDFLyQGHGHULYD


6,78$&,Ï1),1$/


$&&,21(63$5$5(67,78,5/$6,78$&,Ï1,1,&,$/

/DWRUUHGHO9&,GHEHUiTXHGDUHQFODYDGDDODVGRFHFRQODVWULQFDVSXHVWDV/D'7
TXHGDUiDSDJDGD\HO9&,TXHGDUiHQXQDSRVLFLyQGHHVSHUDLQLFLDOSDUDRFXSDUOD
GLVWDQFLDGH+RPRJHQHL]DFLyQ
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï10$1(-2'(/266,67(0$6'($50$6

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRV
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGD7ULSFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

(QSULPHUOXJDUODH[SOLFDFLyQWHyULFDVHUHDOL]DUiHQHODXOD\SRVWHULRUPHQWHVREUH
HOYHKtFXORHOLQVWUXFWRUH[SOLFDUiODVHVLyQSRUSDUHMDVGHQWURGHODWRUUH

/DSDUWHWHyULFDVHUHDOL]DUiHQHODXODFRQHOJUXSRGHWULSXODQWHVUHXQLGRV

3DUD OD SUiFWLFD VH FRORFDUi XQ YHKtFXOR HQ XQ OXJDU DSURSLDGR SDUD SRGHU PRYHU
OLEUHPHQWHODWRUUHVLQTXHQLQJ~QREMHWRSXHGDLQWHUIHULUVXPRYLPLHQWR(OWULSXODQWH
VH VLWXDUi HQ HO SXHVWR GHO  -HIH GH 9HKtFXOR SDUD UHDOL]DU ODV RSHUDFLRQHV GH
DOLPHQWDFLyQ GH OD DPHWUDOODGRUD \ HQ OD SDUWH GH OD XQLGDG WUDQVSRUWDGD SDUD
PXQLFLRQDUORVFDUJDGRUHVHLQWURGXFLUORVHQVXFRPSDUWLPHQWRHQODWRUUH

5(48,6,726$$/&$1=$5

(O HYDOXDGR GHEH GH VHU FDSD] GH PDQHMDU ORV GLIHUHQWHV VLVWHPDV GH DUPDV GHO
YHKtFXOR

6HFRQVLGHUDUiTXHHOHYDOXDGRKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2

6(/(&&,Ï1'(/$50$<081,&,Ï1

D6HOHFFLyQGHODUPD )LJ 




3DUDSRGHUVHOHFFLRQDUXQDGHODVGRVDUPDVGHEHHVWDUSUHYLDPHQWHHOVLVWHPDHQ
SRVLFLyQ 6(*852 6L QR HV DVt RSULPLU HO SXOVDGRU 6(*852   /D VHOHFFLyQ VH
UHDOL]DLQGLVWLQWDPHQWHGHVGHFXDOTXLHUDGHODVGRV8QLGDGHVGH&RQWURO
 $PHWUDOODGRUD0*PHGLDQWHHOSXOVDGRU0*  
 &DxyQ00
o $OLPHQWDFLyQGHVGHFDUJDGRUGHUHFKRSXOVDGRU&'(5  
o $OLPHQWDFLyQGHVGHFDUJDGRUL]TXLHUGRSXOVDGRU&,=4  



)LJXUD3DQHOGH&RQWUROGH
DUPDVGHO7LUDGRU


E6HOHFFLyQGHOWLSRGHWLUR\ORQJLWXGGHUiIDJD )LJV\ 

3UHVLRQDQGR/21*5$) )LJQž VXFHVLYDPHQWHVHSXHGHLUYDULDQGRHOWLSR
GHWLURRGHUiIDJDGHODUPDVHOHFFLRQDGDTXHLUiLOXPLQiQGRVHHQODSDQWDOOD )LJ
 
 3DUDODDPHWUDOODGRUDFRD[LDO0*PPSXHGHQVHOHFFLRQDUVH
o 5iIDJDVGHGLVSDURV 0*5$) 
o )XHJRFRQWLQXR 0*5$)&217 FRQWURODGRSRUHOGLVSDUDGRU

 3DUDHOFDxyQGHPPSXHGHQVHOHFFLRQDUVH
o 7LURDWLUR 0077 
o 5iIDJDVGHGLVSDURV 005$) 
o 5iIDJDVGHGLVSDURV 005$) 
o 5iIDJDVGHGLVSDURV 005$) 

(OFDPELRGHUiIDJDSXHGHKDFHUVHHQODVSRVLFLRQHV6(*852R)8(*2SHURQR
GXUDQWHHOFLFORGHGLVSDUR3DUDHIHFWXDUXQDQXHYDUiIDJDGHEHVROWDUVH\YROYHUD
SUHVLRQDU RWUD YH] HO GLVSDUDGRU GHVSXpV GH TXH KD\D WHUPLQDGR HO FLFOR GH OD
UiIDJDSUHFHGHQWH






)LJXUD3DQWDOODGHLQIRUPDFLyQ


$50$'2'(/&$fÏ1


35(&$8&,Ï1
$UUDQFDU HO PRWRU R FRQHFWDU XQD IXHQWH GH DOLPHQWDFLyQ H[WHUQD SDUD
HIHFWXDUHVWDSUXHED


35(&$8&,Ï1
8Q XVR DEXVLYR GHO VLVWHPD GH UHDPH SXHGH SURYRFDU XQ
VREUHFDOHQWDPLHQWR PDOIXQFLRQDPLHQWR R DYHUtD GHO VROHQRLGH GH
GHVEORTXHR (Q HMHUFLFLRV GH LQVWUXFFLyQ HYLWDU HO VREUHFDOHQWDPLHQWR GHO
VROHQRLGH

(OFDxyQVHDUPDFRPRFXDOTXLHUDUPDDXWRPiWLFDOOHYDQGRHOFLHUUHDWUiVPHGLDQWH
HO PHFDQLVPR GH UHDUPH TXH SHUPLWH HIHFWXDUOR HOpFWULFDPHQWH R PDQXDOPHQWH HQ
FDVRGHDYHUtD
(QHOSULPHUFDVRSXHGHHIHFWXDUVHGHGRVPDQHUDV
 5($50(1250$/
 5($50('(6(59,&,2

D5HDUPHQRUPDO

6H DFWLYD SRU PHGLR GHO SXOVDGRU 5($51250 HQ HO 3DQHO GH &RQWURO 3ULQFLSDO \
VLJXHHOVLJXLHQWHSURFHVR
 (OPHFDQLVPRGHUHDUPHVHPXHYHKDFLDDWUiVDUUDVWUDQGRDOFLHUUH
 (OFLHUUHTXHGDUHWHQLGRSRUHOPHFDQLVPRGHGLVSDUR
 (OPHFDQLVPRGHUHDUPHUHJUHVDDODSRVLFLyQGHUHSRVR GHODQWH 

/DVHxDOHVDFHSWDGDVLHOFDxyQQRHVWi\DDUPDGR FLHUUHDWUiV\HOPHFDQLVPRGH
UHDUPHGHODQWHSRVLFLyQGHUHSRVR 




127$
&XDQGRHOFLHUUHQRTXHGDUHWHQLGRDWUiVHOPHFDQLVPRGHUHDUPHQRLQGLFDQLQJ~Q
HUURU SXHV HQ HVWH FDVR HO PHFDQLVPR GH UHDUPH UHJUHVD D OD SRVLFLyQ GHODQWHUD
MXQWRFRQHOFLHUUH

&RPSOHWDGR HO SURFHVR ORV LQGLFDGRUHV 5($5 1250 \ 5($56(59 HVWDUiQ
DSDJDGRV\VHLOXPLQDUiHQODVSDQWDOODVGHLQIRUPDFLyQGHORV3DQHOHVGH&RQWURO
GH-9\7LUDGRU&,(55($75$6
(OSURFHVRVHSXHGHLQWHUUXPSLUTXHGDQGRDWUiVHOFLHUUH\HOPHFDQLVPRGHUHDUPH
\ HQFHQGLpQGRVH 5($5 1250 YHUGH  5($5 6(59 URMR  \ &,(55( $75È6
iPEDU SRUODVVLJXLHQWHVFLUFXQVWDQFLDV
  (O'$/QRHVWiHQVXSRVLFLyQFHQWUDOHQFX\RFDVRSUHVLRQDU6(*852
o 6L HO '$/ YD DO FHQWUR KDEUi TXH SUHVLRQDU 5($5 6(59 SDUD TXH
FRQWLQ~HHOSURFHVR
ƒ 6LWRGRYDELHQHOSURFHVRVHWHUPLQD\VHDSDJD5($56(59
ƒ 6LQRVHDSDJDHVTXHKD\XQIDOORHQHOPHFDQLVPRGHUHDUPH
o 6LHO'$/QRYDDOFHQWURHVTXHKD\XQHUURUHQHO'$/
  +D\ XQ HUURU HQ HO '$/ SDUSDGHD 326,1&$/,0  KDEUi TXH VXEVDQDU HO
HUURU\YROYHUDDSDJDU\HQFHQGHUHOVLVWHPDGHHQFHQGLGRGHWRUUH
  +D\ XQ IDOOR HQ HO PHFDQLVPR GH UHDUPH SDUSDGHDQ 5($51250 \
5($56(59 KDEUiTXHVXEVDQDUHOHUURU\YROYHUDSXOVDU5($56(59

E5HDUPHGHVHUYLFLR

(OPRYLPLHQWRGHOPHFDQLVPRGHUHDUPHVHUHDOL]DHQXQ~QLFRVHQWLGR ELHQKDFLD
GHODQWHRKDFLDDWUiV \DOILQDOGHOUHFRUULGRVHGHWLHQH
6H DFWLYD SRU PHGLR GHO SXOVDGRU 5($56(59 HQ HO 3DQHO GH &RQWURO 3ULQFLSDO \
VLJXHHOVLJXLHQWHSURFHVR
 (Q FDVR GH HQFRQWUDUVH HQ VX SRVLFLyQ WUDVHUD HO PHFDQLVPR GH UHDUPH VH
PXHYHKDFLDODSRVLFLyQGHUHSRVR GHODQWH GHMDQGRHOFLHUUHDWUiV
 (QFXDOTXLHURWURFDVRHOPHFDQLVPRGHUHDUPHYDKDFLDDWUiVDUUDVWUDQGRHO
FLHUUHH[FHSWRFXDQGRVHSURGXFHXQHUURU
&RQGLFLRQHVHQODVTXHQRVHSXHGHDFWLYDUHOUHDUPH
 0LHQWUDVVHPXHYHHO'$/
 &XDQGRHOPHFDQLVPRGHUHDUPHHVWiDWUiVHVWDQGRHO'$/HQXQDSRVLFLyQ
GHDOLPHQWDFLyQ
(O UHDUPH VH GHWHQGUi LQPHGLDWDPHQWH FXDQGR VH SURGX]FD XQ HUURU GXUDQWH HO
IXQFLRQDPLHQWRGHVXPHFDQLVPRGHUHDUPHTXHGDQGRSDUDGRHQWUHVXVPi[LPDV
SRVLFLRQHVGHODQWHUD\WUDVHUD

E  5(67$%/(&,0,(172'(/0(&$1,602'(5($50(

'HVGH XQD SRVLFLyQ LQWHUPHGLD HQWUH ODV Pi[LPDV GHODQWHUD \ WUDVHUD IUXWR GH XQ
HUURUSXHGHDFWLYDUVHHVWHPHFDQLVPRSUHVLRQDQGR 5($56(59(O SURFHVRHV HO
VLJXLHQWH
 (OPHFDQLVPRGHUHDUPHWHUPLQDUiVLHPSUHGHFRPSOHWDUVXPRYLPLHQWRHQHO
VHQWLGR HQ HO FXDO VH HVWDED PRYLHQGR DQWHV GH OD SDUDGD GHWHQLpQGRVH
FXDQGRDOFDQFHHOH[WUHPRKDFLDHOTXHVHHVWDEDPRYLHQGRQRLQYLUWLHQGRVX
PRYLPLHQWR YXHOWDDOH[WUHPRLQLFLDO WDOFRPRKDFHHQHOUHDUPHQRUPDO1R


LQYLHUWHVXPRYLPLHQWRDXQTXHHOIDOORSUHFHGHQWHVHKD\DSUHVHQWDGRGXUDQWH
HOSURFHVRGHUHDUPHQRUPDO\UHFRUULGRKDFLDDWUiV

E  /,%(5$&,Ï1'(/&,(55(&8$1'26(/(0$17,(1($75È6&215($56(59

6RQFRQGLFLRQHVSUHYLDVTXHVHGHEHQFXPSOLUSDUDTXHHOFLHUUHSXHGDVHUOLEHUDGR
GHVGHVXSRVLFLyQWUDVHUDTXH
 (O'$/GHEHHVWDUHQSRVLFLyQFHQWUDOHVGHFLUHQPRGR6(*852
 (O PHFDQLVPR GH UHDUPH GHEH HVWDU DWUiV \ SRU WDQWR QR SXHGH DYDQ]DU HO
FLHUUH
 (OFLHUUHHVWDUiDWUiVWHVWLJR&,(55($75$6HQFHQGLGR
3DUD OLEHUDU HO FLHUUH \ TXH DYDQFH D OD YHORFLGDG GHO UHDUPH VH SUHVLRQDUi HO
GLVSDUDGRU GH XQR GH ORV PDQGRVHPSXxDGXUD \ D FRQWLQXDFLyQ VLQ VROWDU HO
GLVSDUDGRUSUHVLRQDU5($56(59&RQHVRVHOLEHUDUiHOFLHUUHTXHLUiOHQWDPHQWH
KDFLDDGHODQWH\DTXHHOPHFDQLVPRGHUHDUPHORLUiUHWHQLHQGR


$&78$&,Ï1(1&$62'()$//2'(/',63$52

9HUILFKDGHHVWHPDQXDO


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ H LGHQWLILFDQ ORV HOHPHQWRV \ ORV SDVRV D VHJXLU SDUD HO
FRUUHFWRPDQHMRGHORVVLVWHPDVGHDUPDVQRVHFRQVLGHUDFRQYHQLHQWHUHDOL]DUXQ
UHVXPHQGHORVPLVPRV


35È&7,&$6

(O LQVWUXFWRU KDFH XQD GHPRVWUDFLyQ GH OD VHOHFFLyQ GHO DUPD \ PXQLFLyQ \
FRPSUXHEDTXHORVVROGDGRVORUHDOL]DQDFRQWLQXDFLyQ

(O LQVWUXFWRU UHDOL]D HO DUPDGR GHO FDxyQ HQ WRGDV VXV YDULDQWHV LQVSHFFLRQDQGR
SRVWHULRUPHQWHVXUHDOL]DFLyQSRUORVVROGDGRV LQGLYLGXDOPHQWH 


6,78$&,Ï1,1,&,$/

9&,FRQHVFRWLOODVGHODWRUUHDELHUWDVFRQWRGRVORVSDQHOHVGHDFFHVRDODFiPDUD
GHDUPDV\FDUJDGRUHVFRORFDGRV/DEROVDGHDFFHVRULRVGHWRUUHVHHQFRQWUDUiHQ
VXOXJDU(OYHKtFXORVHHQFRQWUDUiVLWXDGRHQXQOXJDUHQHOTXHSXHGDPRYHUVHOD
WRUUHOLEUHPHQWH&DGDHYDOXDGRVXELUiDXQ9&,FRQHOLQVWUXFWRUSDUDODPLVPD


$&&,21(6$5($/,=$5

0XQLFLRQDUiXQFDUJDGRUGH0*6 0XQLFLyQGHIRJXHR\FLQWDV 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1(/7,52

,'(17,),&$&,Ï1
1,9(/,,,QGLYLGXDO(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRV
$<8'$6$/$,16758&&,Ï1
3UR\HFWRUGH3&3UHVHQWDFLRQHV3RZHU3RLQW
9&,&FDGDWULSXODQWHVFRPRPi[LPR
&'D\XGDVDOD,QVWUXFFLyQ
%,%/,2*5$)Ë$
070DQXDO7pFQLFR9HKtFXOR9&,&3L]DUUR0DQXDOGHOD7ULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

(QHODXODVHUHDOL]DUiXQDH[SOLFDFLyQWHyULFDGHOSURFHGLPLHQWRSDUDODUHDOL]DFLyQ
GHO7LURFRQODVDUPDVGHOYHKtFXOR3RVWHULRUPHQWH\VREUHHOYHKtFXORHQHOSDWLRR
HQHOFDPSRHOLQVWUXFWRUVXELUiFRPRPi[LPRGRVVROGDGRVDODWRUUH\SURFHGHUiD
ODUHDOL]DFLyQGHODVDFWLYLGDGHVDQWHULRUPHQWHH[SOLFDGDV

5(48,6,726$$/&$1=$5

(OVROGDGRGHEHVHUFDSD]GHUHDOL]DUHOWLURFRQFXDOTXLHUDGHODVDUPDVH[LVWHQWHV
HQHOYHKtFXOR $00*\&DxyQGHPP 

6HFRQVLGHUDUiTXHHOHYDOXDGRKDVXSHUDGRODSUXHEDVLREWLHQHFRPRPtQLPRXQ
GHDFLHUWRV

'(6$552//27(Ï5,&2'(/&217(1,'2

35(3$5$&,Ï13$5$(/&20%$7(

D&RQGLFLRQHVLQLFLDOHV

 (OYHKtFXORHVWiPXQLFLRQDGR
 /RVFDUJDGRUHVGHOFDxyQ\DPHWUDOODGRUDHVWiQFDUJDGRV
 (OFDxyQHVWiDODV WHVWLJR=21$,17(5',5(&&DSDJDGR 
 /DVHVFRWLOODVGHOFDVFRHVWiQFHUUDGDV WHVWLJR(6&27$%,(DSDJDGR 
 /D WRUUH HVWi HQ VHUYLFLR \ SDVDGRV ORV WHVWV YHU ILFKD  GH HVWH
PDQXDO 
 /D '7 HVWi HQ VHUYLFLR \ SDVDGR HO WHVW YHU ILFKD  GH HVWH
PDQXDO 


 /RVHOHPHQWRVGHSXQWHUtD\ODVDUPDVHVWiQKRPRJHQHL]DGRV
 (OVLVWHPDKDDGRSWDGRVXFRQILJXUDFLyQLQLFLDO YHUILFKDGHHVWH
PDQXDO 
 /RVVHUYRVHVWiQDFWLYDGRV WHVWLJR6(5926LOXPLQDGR 
 /DHVWDELOL]DFLyQHVWiDFWLYDGD WHVWLJR(67$%LOXPLQDGR 
 6HKDHMHFXWDGRODFRPSHQVDFLyQGHODGHULYDGHOJLUyVFRSR
 (OFLHUUHHVWiHQSRVLFLyQGHUHSRVR GHODQWH 

E3UHSDUDFLyQGHORVHOHPHQWRVGHSXQWHUtD

  (Q 8QLGDG GH &RQWURO 3ULQFLSDO 8&3  GH OD '7 ,QWURGXFLU ORV GDWRV GH
FRQGLFLRQHVDPELHQWDOHV YHUILFKDGHHVWHPDQXDO 
  $MXVWDUHOSHULVFRSLRGHO7LUDGRU 89/  YHUILFKDGHHVWHPDQXDO 
  $MXVWDUODFiPDUDWpUPLFD YHUILFKDGHHVWHPDQXDO 


127$
'HVGHTXHODWHFODGHXQSDUiPHWURHVSXOVDGDKDVWDTXHHOGDWRHVLQWURGXFLGRHQ
OD PHPRULD GH OD 8&3 QR SXHGHQ VHU VHOHFFLRQDGRV QXHYRV SDUiPHWURV 'H OD
PLVPDIRUPDPLHQWUDVQRKD\DVLGRVHOHFFLRQDGDODWHFODGHDOJ~QSDUiPHWURWRGD
LQWURGXFFLyQGHGDWRVQXPpULFRVVHUiLJQRUDGD


127$
6LHOYHKtFXORHVWiHQPDUFKDHOVHQVRUGHiQJXORGHLQFOLQDFLyQVHDQXODUi\HQOD
8&3HOLQGLFDGRU³6(16$1*8´HVWDUiHQFHQGLGR


F3UHSDUDFLyQGHODVDUPDV

 $OLPHQWDU \ PRQWDU OD DPHWUDOODGRUD WLUDQGR GH OD SDODQFD GH PRQWDU SDUD
PRQWDUHOFLHUUHSUHVLRQDQGRHOSHVWLOORGHEORTXHR\GHYROYLHQGRODSDODQFDD
VXSRVLFLyQGHUHSRVR DGHODQWDGD 
 8QD YH] PRQWDGD HO DUPD &(55$5 (/ 3$1(/ '( $&&(62 $ /$
$0(75$//$'25$
 6HOHFFLRQDUHODUPD\WLSRGHUiIDJD YHUILFKDGHHVWHPDQXDO 
 3UHVLRQDU XQR GH ORV SXOVDGRUHVLQGLFDGRUHV )8(*2 HQ HVH PRPHQWR
RFXUULUiTXH
o 6HLOXPLQDUi)8(*2\VHDSDJDUiHOLQGLFDGRU6(*852
o '$/ VH GHVSOD]DUi D OD SRVLFLyQ VHOHFFLRQDGD VL VH KD VHOHFFLRQDGR
FDxyQ
o (O H[WUDFWRU GH DLUH GH OD FiPDUD GH DUPDV GH OD WRUUH VH SRQGUi
DXWRPiWLFDPHQWHHQPDUFKD
o (OWHVWLJR326,1&$/,0VHLOXPLQDUiHQODVSDQWDOODVGHODV8QLGDGHV
GH &RQWURO GHO -9 \ 7 KDVWD TXH HO '$/ HVWp HQ OD SRVLFLyQ
VHOHFFLRQDGD DSDJiQGRVH HQWRQFHV \ DFWLYiQGRVH OD DOLPHQWDFLyQ GH
FRUULHQWHDORVHOHFWURLPDQHVGHGLVSDUR
 3DUDTXHODVHFXHQFLDDQWHULRUVHHMHFXWHGHEHUiFXPSOLUVH
o (OLQGLFDGRU),1&,17$GHEHUiHVWDUDSDJDGR


o /DV HVFRWLOODV GHEHQ HVWDU FHUUDGDV R DFWLYDGR HO LQWHUUXSWRU $18/$5
6(*852(6&27,//$6GHO3DQHOGH&RQWURO3ULQFLSDOGHODWRUUH
o (O FLHUUH DWUiV \ VLVWHPD GH UHDUPH GHODQWH VL VH KD VHOHFFLRQDGR
FDxyQ


127$
6L HO GREOH DOLPHQWDGRU QR VH VLW~D HQ OD SRVLFLyQ VHOHFFLRQDGD GH DOLPHQWDFLyQ HO
LQGLFDGRU326,1&$/,0GHODVSDQWDOODVGHORV3DQHOHVGH&RQWUROGHO-9\7LUDGRU
SDUSDGHDUi SRU XQ IDOOR PHFiQLFR HQ HO GHVSOD]DPLHQWR GHO DOLPHQWDGRU 7DPELpQ
SDUSDGHDUiVLH[LVWHXQIDOORGHOVHQVRU


(-(&8&,Ï1'(/$3817(5Ë$<)8(*2


3(/,*52
$17(6 '( ()(&78$5 (/ )8(*2 $6(*85$56( '( 48( 72'26 /26
3$1(/(6'($&&(62$/$&È0$5$'($50$6,1&/8,'26&$5*$'25(6
< $&&(62 $/ &$-Ï1 '( 5(&2*,'$ '( 9$,1$6 (67È1 &2/2&$'26 <
$6(*85$'26

D2EVHUYDFLyQ\GHWHFFLyQGHEODQFRV

3DUD OD REVHUYDFLyQ \ GHWHFFLyQ GH EODQFRV HV FRQYHQLHQWH XWLOL]DU ORV HOHPHQWRV
ySWLFRVGHFDPSRDQFKR&7HQFDPSRDQFKRSUHIHUHQWHPHQWHRELHQODVYHQWDQDV
[ GH ORV SHULVFRSLRV GHO 7LUDGRU \ -9 6yOR VL HO VHFWRU GH WLUR DVLJQDGR HV PX\
OLPLWDGRHQD]LPXWSRGUtDUHVXOWDUFRQYHQLHQWHXWLOL]DUSDUDODGHWHFFLyQGHEODQFRVOD
&7HQFDPSRHVWUHFKRHORFXODUGHOD89/
/D FiPDUD WpUPLFD HV HO HOHPHQWR PiV LQGLFDGR SDUD OD GHWHFFLyQ GH EODQFRV
DXQTXH OD LGHQWLILFDFLyQ GHO PLVPR UHVXOWD PiV GLItFLO (VWD FLUFXQVWDQFLD GHEH
WHQHUVH HQ FXHQWD HQ VLWXDFLRQHV FRQIXVDV GHO FRPEDWH SDUD HYLWDU KDFHU IXHJR
VREUHREMHWLYRVSURSLRV

E3XQWHUtD\IXHJRFRQHOVLVWHPDSULQFLSDO

(Q HO FDVR QRUPDO GHWHFWDGR LGHQWLILFDGR \ HOHJLGR HO EODQFR HO 7LUDGRU GHEH
HIHFWXDUODVHFXHQFLDVLJXLHQWH
  $SXQWDUDO EODQFRFRQHOUHWtFXORGHOD&7 XRFXODUGHOD89/\VLHOEODQFR
HVWi HQ PRYLPLHQWR HIHFWXDU XQ VHJXLPLHQWR GHO PLVPR KDVWD TXH VHD
XQLIRUPH
  (IHFWXDU XQ GLVSDUR OiVHU HO UHWtFXOR VH GHVSOD]DUi  \ VLQ VROWDU HO SXOVDGRU
OiVHU HO 7LUDGRU YXHOYH D DSXQWDU DO EODQFR \ XQD YH] FHQWUDGR HIHFW~D HO
GLVSDUR'HEHSURFXUDUTXHHOWLHPSRWUDQVFXUULGRGHVGHHOGLVSDURGHOOiVHUDO
GLVSDURGHODUPDVHDHOPtQLPRSRVLEOHGHELGRDTXHHOGLVSDURGHOOiVHUHV
VXVFHSWLEOHGHVHUGHWHFWDGRSRUHOHQHPLJR\VREUHWRGRSDUDPLQLPL]DUHO
HUURUGHOiQJXORGHSUHGLFFLyQ






)LJXUD3XOVDGRUHV

  (O IXHJR VH SURGXFH DO SUHVLRQDU HO FRUUHVSRQGLHQWH GLVSDUDGRU WHQLHQGR
DSUHWDGRSUHYLDPHQWHHOSXOVDGRUGHWRPDGHFDUJDGHODHPSXxDGXUD
  (QHOPRGRIXHJRDQWHODSXOVDFLyQGHGLVSDURSURYHQLHQWHELHQGHO7LUDGRU R
GHO -9  WRGR HV FRUUHFWR HO VLVWHPD HPSLH]D D GLVSDUDU &RQVWDQWHPHQWH VH
UHDOL]DXQFRQWHRGHOQ~PHURGHGLVSDURVUHDOL]DGRVDVtFRPRODLQGLFDFLyQGH
FXDOTXLHULQWHUUXSFLyQHQHOSURFHVRGHIXHJR
  (O 7LUDGRU GHEH UHFRUGDU TXH OD HPSXxDGXUD GHO -9 WLHQH SULRULGDG VREUH OD
VX\D
  (OSXOVDGRUGHWRPDGHFDUJDWLHQHTXHSHUPDQHFHUDSUHWDGRGXUDQWHWRGRHO
FLFOR GH IXHJR GHMDU GH DSUHWDU GLFKR SXOVDGRU VXSRQH HO LQPHGLDWR DOWR HO
IXHJR
  (O -9 SXHGH GDU SRU ILQDOL]DGR XQ FLFOR GH IXHJR TXH HVWp UHDOL]DQGR HO
7LUDGRUDSUHWDQGRHOSXOVDGRUGHWRPDGHFDUJDGHVXHPSXxDGXUD


127$
6L DO SXOVDU IXHJR H[LVWH XQ IDOOR HQ HO FLUFXLWR HO LQGLFDGRU VHJXUR SHUPDQHFHUi
HQFHQGLGR\HOLQGLFDGRUIXHJRSDUSDGHDUi

/DVYDULDFLRQHVVREUHHVWDVHFXHQFLDSXHGHQFRQVLVWLUHQORVLJXLHQWH
 1HFHVLGDG GH WHQHU TXH YDULDU HO (&2 35,0(52Ò/7,02  GHO OiVHU VL VH
SUHYpQ IDOVRV HFRV DQWHULRUHV R SRVWHULRUHV DO EODQFR HOHJLGR (Q pVWH FDVR
VHLOXPLQDUiHOLQGLFDGRUGHHFRHQODSDQWDOODGHOD&7RHORFXODUGHOD89/
 6LQRVHXWLOL]DHOOiVHUSDUDODPHGLFLyQGHGLVWDQFLD OODYHHQ2)) LQWURGXFLU
PDQXDOPHQWHODGLVWDQFLDRELHQSXOVDUHOERWyQGHDO]DFRPEDWHHQHOPDQGR
GHGLUHFFLyQ
 6L VH XWLOL]D DO]D GH FRPEDWH VREUH EODQFRV HQ PRYLPLHQWR \ VH HIHFW~D HO
VHJXLPLHQWR GHO EODQFR GHEH DSUHWDUVH HO ERWyQ GHO OiVHU \ PDQWHQHUOR
DSUHWDGRSDUDLQWURGXFLUODSUHGLFFLyQODWHUDO


,1&,'(1&,$6(1(/7,52



D,QKLELFLyQGHGLVSDUR

(OGLVSDURSXHGHLQKLELUVHSRU
 (VFRWLOODDELHUWD(OLQGLFDGRU(6&27$%,(5HQ3DQHOGH&RQWURO3ULQFLSDOGH
ODWRUUH3DUDHYLWDUORFHUUDUHVFRWLOODV
 )DOOR HQ ORV H[WUDFWRUHV GH OD FiPDUD GH DUPDV 6L SRU QHFHVLGDGHV GHO
FRPEDWHIXHUDQHFHVDULRHIHFWXDUHOIXHJRDFWLYDUHOLQWHUUXSWRUGHDQXODFLyQ
GHODLQKLELFLyQ

E'LVSDURPHFiQLFRGHHPHUJHQFLD

&XDQGR SRU DYHUtD X RWUD UD]yQ ODV DUPDV QR VH SXHGDQ GLVSDUDU HOpFWULFDPHQWH
GHVGHORVPDQGRVGHO-HIHGH9HKtFXORRGHO7LUDGRUWDQWRHOFDxyQ0.FRPR
OD$0FRD[LDOSXHGHQGLVSDUDUVHPDQXDOPHQWH/DGXUDFLyQGHODUiIDJDGHSHQGHUi
GHOWLHPSRTXHVHDFW~HVREUHHOGLVSDUDGRUGHODUPD

E  ',63$52'((0(5*(1&,$'(/&$fÏ1

3DUDSRGHUUHDOL]DUHOGLVSDURPDQXDOGHHPHUJHQFLDRSHUDUFRPRVLJXH

 &2/2&$5(/'$/(168326,&,Ï1&(175$/
  ,QVHUWDU OD OODYH GH YDVR GH  PP )LJ  Qž   GH OD EROVD GH
KHUUDPLHQWDVHOSURORQJDGRUODUJR )LJQž \ODOODYHGH FDUUDFD
GH FDEH]D KH[DJRQDO )LJ  Qž   HQ HO FXDGUDGLOOR GHO PDQGR
PDQXDO GHO '$/ )LJ  Qž   \ JLUDUOR HQ OD GLUHFFLyQ FRQYHQLHQWH
KDVWDGHMDUORDSUR[LPDGDPHQWHFHQWUDGR


)LJXUD%ROVDGHKHUUDPLHQWDV






)LJXUD&XDGUDGLOORSDUDPRYLPLHQWRGHO'$/

  &RPSUREDU HO FHQWUDGR FRQ OD JDOJD )LJ  Qž   PLGLHQGR VREUH HO
SXHQWHGH PDQGRGHOPRGRTXHVHPXHVWUDHQ ODILJXUD/DJDOJD
GHEH HQWUDU SRU VX ODGR PiV HVWUHFKR  PP  HQ DPERV ODGRV \ QR
HQWUDUSRUVXODGRPiVDQFKR PP (QpVHPRPHQWRHO'$/HVWDUi
FHQWUDGR\SRGUHPRVSURFHGHUDODUPDGRPDQXDOGHOFLHUUH



)LJXUD&HQWUDGRGHO'$/


 $50$50$18$/0(17((/&,(55( )LJ 
  *LUDUODSDODQFD  GHOPHFDQLVPRGHEORTXHRDODSRVLFLyQ'(6%/24
% SDUDGHMDUOLEUHHOPHFDQLVPRGHUHDUPH



  ,QWURGXFLU OD PDQLYHOD )LJ  Qž   GHO ORWH GH D ERUGR HQ HO
FXDGUDGLOOR   \ JLUDU OD PDQLYHOD HQ HO VHQWLGR GH ODV DJXMDV GHO UHORM
SDUDGHVSOD]DUHOFLHUUHKDFLDDWUiV
  8QD YH] UHWHQLGR HO FLHUUH SRU HO PHFDQLVPR GH GLVSDUR LQYHUWLU HO
PRYLPLHQWRGHJLURGHODPDQLYHODSDUDOOHYDUHOVLVWHPDGHUHDUPHDVX
SRVLFLyQPiVDGHODQWDGD UHSRVR 



)LJXUD$UPDGRPDQXDOGHOFLHUUH

 ',63$5$50$18$/0(17(
  6LWXDU HO '$/ FRQ HO PHFDQLVPR PDQXDO HQ SRVLFLyQ GH DOLPHQWDFLyQ
GHUHFKDRL]TXLHUGDHQIXQFLyQGHOFDUJDGRUTXHYD\DPRVDXVDU 
  /D SDODQFD VHOHFWRUD PDQXDO )LJ  Qž   TXH VH HQFRQWUDUi HQ OD
SRVLFLyQ GH 5$)$*$ VLHPSUH HQ pVD SRVLFLyQ SDUD SRGHU HIHFWXDU HO
GLVSDUR HOpFWULFR  GHEHUi VLWXDUVH HQ OD GH 7,52 $ 7,52 VL VH TXLHUH
HIHFWXDU HO GLVSDUR HQ HVWD PRGDOLGDG HQ FDVR FRQWUDULR PDQWHQHU OD
SRVLFLyQ5$)$*$
  ,QWURGXFLUODSDODQFDGHGLVSDURGHHPHUJHQFLD )LJQž GHIRUPD
TXHHQJDQFKHORVWHWRQHV )LJQž GHOEDODQFtQGHGLVSDUR )LJ
Qž 





 )LJXUD$FFLRQDPLHQWRPDQXDOGHO
)LJXUD$FFLRQDPLHQWRPDQXDO PHFDQLVPRGHGLVSDUR  
GHOPHFDQLVPRGHGLVSDUR  


  $SDODQFDUKDFLDDGHODQWHFRQODSDODQFDGHGLVSDURSDUDKDFHUEDVFXODU
HO EDODQFtQ GH GLVSDUR \ GHVSOD]DU OD FDGHQD )LJ  Qž   GHO
PHFDQLVPR GH GLVSDUR SDUD TXH DFW~H VREUH GLFKR PHFDQLVPR
OLEHUDQGRHOFLHUUH\SURGXFLHQGRHOGLVSDUR )LJ 
  3DUD OOHYDU HO FLHUUH KDFLD DGHODQWH VLQ HIHFWXDU HO GLVSDUR FDEHQ GRV
SRVLELOLGDGHV
D 6LHOPHFDQLVPRGHUHDUPHHVWiDWUiVGLVSDUDUPDQXDOPHQWHWDO\
FRPR VH H[SOLFD HQ HO VLJXLHQWH DSDUWDGR SDUD OLEHUDU HO FLHUUH \
FRQ OD PDQLYHOD OOHYDU HO FLHUUH KDFLD GHODQWH JLUDU HQ VHQWLGR
FRQWUDULRDODVDJXMDVGHOUHORM 
E 6L HO PHFDQLVPR GH UHDUPH HVWi GHODQWH OOHYDUOR KDFLD DWUiV \
HMHFXWDUODRSHUDFLyQDQWHULRU

F,QWHUUXSFLRQHVGHOWLURGHOFDxyQ

F  &21'8&7$$6(*8,5(1&$62'(,17(5583&,Ï1

(Q HO FDVR GH SURGXFLUVH XQD LQWHUUXSFLyQ HQ HO IXHJR SRU OD FDXVD TXH VHD GHEH
DVXPLUVHTXHSXHGHKDEHUXQGLVSDURHQODUHFiPDUD


3(/,*52
6, 6( 352'8&( 81$ ,17(5583&,Ï1 < (/ 78%2 (67È 08< &$/,(17( 6(
&216,'(5$08<&$/,(17('(638e6'(',63$5$50È6'(',63$526
(10(',$+25$ 38('(352'8&,56(/$$872,*1,&,Ï1'(/$ &$5*$6,
(;,67(81',63$52(1/$5(&È0$5$





3(/,*52
6,(/&,(55(6((1&8(175$(181$326,&,Ï1,1'(7(50,1$'$<(;,67(
81 ',63$52 (1 /$ 5(&È0$5$ 2 (1 (/ '2%/( $/,0(17$'25 38('(
352'8&,56((/',63$52,1(63(5$'$0(17(


3(/,*52
48('$ 727$/0(17( 352+,%,'2 (/ '(60217$5 (/ 78%2 '(/ &$fÏ1
'(/ &$-Ï1 '( 0(&$1,6026 2 (/ &$fÏ1 '( /$ &81$ 6, (;,67( 81
',63$52(1/$5(&È0$5$2(1(/'2%/($/,0(17$'25


127$
6DOYRHQRSHUDFLRQHVHVDFRQVHMDEOHTXHODRSHUDFLyQGHH[WUDFFLyQGHXQGLVSDUR
GHODUHFiPDUDVHHIHFW~HSRUHOž(VFDOyQ

(QHVWHFDVR\KDVWDTXHVHUHVWDEOH]FDQODVFRQGLFLRQHVGHVHJXULGDG
  0DQWHQHUHO9&,HQVXSRVLFLyQ
  'HVSHMDUHOiUHDSHOLJURVD
  0DQWHQHUDSXQWDGRHOFDxyQDSXQWDGRDVXREMHWLYR
  6LHOFDxyQHVWiPX\FDOLHQWHHVSHUDUDOPHQRVPLQXWRVDQWHVGHSURFHGHU
DVROXFLRQDUHOSUREOHPD

/DVDFFLRQHVFRUUHFWLYDVDHMHFXWDUVRQODVVLJXLHQWHV
  ([WUHPDUODVSUHFDXFLRQHV
  6LWXDUHOFLHUUH0$18$/0(17(HQSRVLFLyQUHWUDVDGD
  5HWLUDUODPXQLFLyQGHOGREOHDOLPHQWDGRU
  /HYDQWDUHOGREOHDOLPHQWDGRU
  'HWHUPLQDUHOWLSRGHLQWHUUXSFLyQ
 9DLQDDWDVFDGDHQODUHFiPDUD
 9DLQDURWD VLQFXORWH 
 'LVSDURHQODUHFiPDUD
 &LHUUHDWDVFDGR
  5HYLVDU \ GHVSHMDU ODV JXtDV GHO FLHUUH HOLPLQDQGR FXDOTXLHU HOHPHQWR TXH
SXGLHVHLPSHGLUHOIXQFLRQDPLHQWRQRUPDOGHOPLVPR
  5HYLVDU OD UHFiPDUD FRPSUREDQGR TXH HVWi OLEUH GH FXDOTXLHU HOHPHQWR
H[WUDxR(QFDVRFRQWUDULR
D  0RQWDU HO NLW GH OLPSLH]D WDO \ FRPR PXHVWUD OD ILJXUD  FRQ OD
ERTXLOODSRUWDWUDSRV  HQSULPHUOXJDU\DFRQWLQXDFLyQORVWUDPRVGH
YDULOOD  \ILQDOPHQWHHOPDQHUDO  





)LJXUD.LWGHOLPSLH]D

E  6LWXiQGRVHIXHUDGHODOtQHDGHIXHJR\PLUDQGRKDFLDHOREMHWLYR
LQWURGXFLU GHVSDFLR HO ~WLO HQ HO WXER DJDUUDQGR GRV KRPEUHV HO
PDQHUDOSRUVXVDVDVODWHUDOHVKDVWDKDFHUWRSH8VDUJXDQWHV
F  6L H[LVWH XQ SUR\HFWLO HQ OD UHFiPDUD OD EDTXHWD VH LQWURGXFLUi
KDVWD OD PDUFD URMD  VL HO IUHQR GH ERFD HVWi SXHVWR R KDVWD OD
PDUFDURMDVLQRORHVWXYLHUD
G  6L OR TXH H[LVWH HQ OD UHFiPDUD HV XQD YDLQD OD EDTXHWD VH
LQWURGXFLUiKDVWDODPDUFD FRQIUHQRGHERFD RKDVWDODPDUFD
 VLQIUHQRGHERFD 
H  6LODEDTXHWDVHLQWURGXFHPiVDOOiGHODVPDUFDVURMDV y VLQ
OOHJDUDODVEODQFDV y QRVHQFRQWUDPRVFRQXQGLVSDURFRQ
SDUWHGHXQSUR\HFWLO
  ([WUDHUORVHOHPHQWRVH[WUDxRV HQHOFDVRGHXQSUR\HFWLOFRPSOHWRDYLVDUDO
ž(VFDOyQTXHGLVSRQHGHODERTXLOODDGHFXDGDSDUDLQVHUWDUHQODEDTXHWD 
PHGLDQWH XQRV FXDQWRV JROSHV FRUWRV SHUR SRWHQWHV 6L VH QHFHVLWDVH HO
H[WUDFWRUGHYDLQDVDYLVDUDOž(VFDOyQ
  /LPSLDUODUHFiPDUDFRQORVHOHPHQWRVGHOLPSLH]D
 6L HO FLHUUH QR TXHGDUD HQ SRVLFLyQ UHWUDVDGD GHWHUPLQDU OD SRVLFLyQ GHO
FLHUUH
 6L HVWXYLHUD HQ SRVLFLyQ DGHODQWDGD FRPSUREDU ORV SHVWLOORV GH
EORTXHR
 6L ORV SHVWLOORV GH EORTXHR QR HVWXYLHVHQ DWDVFDGRV FRPSUREDU HO
PHFDQLVPRGHUHDUPH
 (QFDVRFRQWUDULREXVFDUODFDXVD\SURFHGHUDVXFRUUHFFLyQ
 (QFDVRGHGXGDDYLVDUDOž(VFDOyQ

F  &21087$'25'(02'2)8(*26(*852

&RQGLFLRQHVSRUODVTXHHOVLVWHPDSDVDDXWRPiWLFDPHQWHDPRGR6(*852 VH
LOXPLQDQORVSXOVDGRUHV6(*852HQODV8QLGDGHVGH&RQWUROGHO-9\7 
 6L VH DEUH DOJXQD HVFRWLOOD VH LOXPLQDUi HO LQGLFDGRU (6&27 $%,(5 HQ HO
3DQHOGH&RQWURO3ULQFLSDOGHODWRUUH&HUUDUODHVFRWLOODRDFWLYDUHOLQWHUUXSWRU
$18/$56(*(6&7



 'HVSXpVGHXQHUURUHQHOFDxyQSDUSDGHDUiQORVSXOVDGRUHV)8(*2ORTXH
SXHGHVHUGHELGRD
o )DOORHQHOHOHFWURLPiQGHGLVSDUR
o 7LHPSRGHUHJUHVRGHOFLHUUH!PV
o &LFORGHIXHJR!V
 &RPSUREDU HO VLVWHPD GH DOLPHQWDFLyQ GH PXQLFLyQ \ VDOLGD GH HVODERQHV
VXEVDQDUHOHUURU\DSDJDU\YROYHUDHQFHQGHUODWRUUH
 3RU XQ HUURU HQ HO '$/ SDUSDGHDUiQ ORV WHVWLJRV 326 ,1& $/,0 GH ODV
SDQWDOODV GH ORV 3DQHOHV GH &RQWURO GH DUPDV GH -9 \ 7 6XEVDQDU HUURU \
DSDJDU\YROYHUDHQFHQGHUODWRUUH


127$
$OSRQHUVHHODUPDHQ6(*852HO'$/VHPXHYHDVXSRVLFLyQFHQWUDO

Condiciones para conmutar de nuevo a modo FUEGO


3DUDODDPHWUDOODGRUD0*QRKD\QLQJXQDFRQGLFLyQSUHYLD
3DUDHOFDxyQ0.3DUDTXHODOyJLFDDXWRULFHODSRVLFLyQGHFDUJDGRUGHUHFKR
RFDUJDGRUL]TXLHUGRGHEHUiFRPSUREDUVHSUHYLDPHQWHTXH
 (O FLHUUH HVWi DWUiV HO FDxyQ GHEH HVWDU DUPDGR  6H HQFLHQGH &,(55(
$75È6
 (O'$/RFXSDVXSRVLFLyQFHQWUDO
 (O PHFDQLVPR GH UHDUPH HVWi GHVFRQHFWDGR \ HQ VX SRVLFLyQ GH GHVFDQVR
GHODQWH 
6HSDVDD)8(*2SUHVLRQDQGRGLFKRSXOVDGRUHQHVHPRPHQWR
 6LOD0*HVWiVHOHFFLRQDGDHO'$/SHUPDQHFHHQVXSRVLFLyQFHQWUDO
 6L HVWi VHOHFFLRQDGR HO FDxyQ HO '$/ VH PXHYH D XQD SRVLFLyQ GH
DOLPHQWDFLyQ GHSHQGLHQGRGHOFDUJDGRUVHOHFFLRQDGR 




)LJXUD)LQGHFLQWDHQOD8&GHO7LUDGRU

F  ),1'(&,17$ )LJ 



(O LQGLFDGRU ),1 &,17$ LQGLFD TXH HQ HO FDUJDGRU GHO DUPD VHOHFFLRQDGD TXHGDQ
VRODPHQWHORV~OWLPRVGLVSDURVSDUDHQODFH(OLQWHUUXSWRUGHOFDUJDGRUHVDFFLRQDGR
SRU OD FLQWD FXDQGR OD FLQWD GH DOLPHQWDFLyQ TXH UHVWD HV GHPDVLDGR FRUWD /RV
LQGLFDGRUHV),1&,17$  GHO3DQHOGH&RQWUROGHO7LUDGRUVHLOXPLQDUiHQ³URMR´
6L HO LQWHUUXSWRU GHO FDUJDGRU DFW~D GXUDQWH XQD UiIDJD OD DFFLyQ GH pVWH
LQWHUUXPSLUiODPLVPD
/D GHVDFWLYDFLyQ GH HVWD VHxDO \ SRU WDQWR OD UHFXSHUDFLyQ GH OD SRVLELOLGDG GH
GLVSDURVHSURGXFH
 6LODVHxDOGH),1&,17$FHVDDOUHFDUJDUHODUPD
 6LVHVHOHFFLRQDRWUDDUPDXRWURFDUJDGRU
3UHVLRQDQGR HO LQGLFDGRU ),1 &,17$ FRQ OR TXH SXHGH FRQWLQXDUVH HO IXHJR KDVWD
FRQVXPLU HO ~OWLPR GLVSDUR GH OD FLQWD VDELHQGR TXH HVWD RSFLyQ GLILFXOWDUi OD
SUy[LPDUHFDUJD

F  $&808/$&,Ï1'(9$,1$6

$XQTXHODFDSDFLGDGGHODOPDFpQGHYDLQDVHVWiDGHFXDGDDOYROXPHQGHPXQLFLyQ
GH HPSOHR LQPHGLDWR H[LVWH OD SRVLELOLGDG GH TXH GXUDQWH HO GLVSDUR FRQ iQJXORV
FHUFDQRV D OD Pi[LPD HOHYDFLyQ GHO FDxyQ \ HQ UiIDJDV GH  GLVSDURV SXHGDQ
SURGXFLUVH LQWHUUXSFLRQHV DOHDWRULDV SRU UHERWH YHUWLFDO GH XQD YDLQD DO DOFDQ]DU HO
DXWRPDWLVPRGHOFLHUUH
(VWH KHFKR VH SXHGH VXEVDQDU LQPHGLDWDPHQWH FRQ HO UHDUPH QRUPDO R UHDUPH GH
VHUYLFLR
/D SRVLELOLGDG GH LQWHUUXSFLyQ QR GHEH SUHVHQWDUVH QL HQ ODV FRQGLFLRQHV PiV
DGYHUVDV DQWHV GH GLVSDUDU DO PHQRV  FDUWXFKRV $Vt SXHV SDUD TXH HVWD
LQWHUUXSFLyQ QR VH SURGX]FD EDMR QLQJ~Q FRQFHSWR VH UHFRPLHQGD FDVR GH VHU
WiFWLFDPHQWHSRVLEOHODH[WUDFFLyQGHYDLQDV\HVODERQHVFXDQGRVHKD\DQUHDOL]DGR
GLFKRQ~PHURGHGLVSDURV


35(&$8&,Ï1
$O YDFLDU HO DOPDFpQ GH YDLQDV FRPSUREDU TXH QR TXHGHQ HVODERQHV
GHSRVLWDGRV HQ OD SDUWH VXSHULRU GHO DFFLRQDPLHQWR GH HOHYDFLyQ SXHGHQ
SURGXFLUVHLQWHUUXSFLRQHVHQHOGLVSDUR


G'LVSDURGHHPHUJHQFLDGHODDPHWUDOODGRUD

3DUD GLVSDUDU OD DPHWUDOODGRUD HQ FDVR GH HPHUJHQFLD QR KD\ PiV TXH DFFLRQDU
PDQXDOPHQWHHOGLVSDUDGRU
(QFDVRGHTXHFRQWLQ~HODLQWHUUXSFLyQVHUiQHFHVDULRGHVPRQWDUODDPHWUDOODGRUD


5(680(1

(QHVWDILFKDVHGHVFULEHQORVSDVRVDVHJXLUSDUDUHDOL]DFLyQFRUUHFWDGHOWLURQRVH
FRQVLGHUDFRQYHQLHQWHUHDOL]DUXQUHVXPHQGHORVPLVPRV


35È&7,&$6


FICHA DE TAREA

1. CÓDIGO. 612-400-054.

2. DESCRIPCIÓN. PUESTO DEL JEFE DE VEHÍCULO.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4.TIPO 5. LUGAR. 6. DURACIÓN.


Teórica - Practica Aula y Vehículo. Teórica: 15 min. en el VCI
Práctica: 10 min./alumno
7. AYUDAS A LA INSTRUCCIÓN.

Soporte informático, manuales, CD ayudas a la Instrucción, Vehículo Pizarro, llave


apertura escotillas.
8. BIBLIOGRAFÍA.

MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

Es necesario disponer de un vehículo por cada 6 tripulantes como máximo en la


clase práctica.

Vehículo con el motor parado, con las escotillas de la torre cerradas, resto de
escotillas, celosías y portón trasero pueden estar abiertos. (Atención a las medidas
de seguridad si se va a mover la torre en modo mecánico).

La práctica será realizada por dos tripulantes introduciéndose en cada uno de los
puestos de la torre, debido a la similitud de estos elementos en ambos puestos.

10. REQUISITOS A ALCANZAR.

Que el Jefe de vehículo sea capaz de:


x Identificar las escotillas.
x Abrir y cerrar las escotillas desde el exterior y desde el interior.
x Sabrá poner el seguro de las escotillas de la torre para la no apertura desde
el exterior de las mismas.
x Conocerá el manejo del asiento tanto del puesto del JV como del TIR.

La tarea se considerará correctamente realizada si se obtiene el 80 % de aciertos en


los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. DESCRIPCIÓN (Fig. 54.1).

2-445
)LJXUD3XHVWRGHO-9

1. Periscopio de observación del JV


2. Contador de disparos
3. Plafón de luz del JV
4. Caja de control de las baterías lanzaingenios
5. Mando del escudo de protección balística periscopio
JV
6. Ajuste de apoyafrente del periscopio de puntería del
JV
7. Cabeza del periscopio de puntería del JV

2-446
8. Panel de Control Principal
22. Ventana registro acceso al cañón *
23. Panel de acceso a la cuna del cañón *
24. Ventana registro acceso a la ametralladora *
25. Mando-empuñadura del JV
26. Panel de Control de armas del JV
27. Monitor de visión térmica del JV
28. Ventana de acceso a la guía flexible del cargador
izquierdo*
29. Trinca de bloqueo en elevación del cañón
30. Cargador izquierdo

* Ventanas y paneles desmontables

)LJXUD(OHPHQWRVSULQFLSDOHVGHO-9

1. Periscopio de puntería 3. Monitor de la cámara térmica


2. Mando empuñadura 4. Panel de Control de armas del JV

11.2. MANEJO DE LA COMPUERTA DE LA ESCOTILLA DEL JEFE DE VEHÍCULO.

2-447
La estructura de las escotillas de la torre responde a un diseño similar a las
existentes en el casco. Las correspondientes a JV y Tirador no son iguales sino
simétricas (Figs. 54.3 y 54.4).
Su movimiento de apertura y cierre se ve facilitado por una barra de torsión laminar
(Fig. 54.3. nº1) en uno de cuyos extremos lleva una serie de muescas (Fig. 54.3. nº
6) correspondientes a las distintas posiciones en las que puede enclavarse la
escotilla donde encaja el pestillo de retenida sobre el que actúa la palanca de
retenida (Fig. 54.4. nº7).
La escotilla se abre normalmente desde el interior aunque en caso de necesidad
podría abrirse desde el exterior.


)LJXUD(VFRWLOOD 9LVWDH[WHULRU )LJXUD(VFRWLOOD 9LVWDLQWHULRU 


11.2.a. Abrir la compuerta de la escotilla desde el interior.

Tirar hacia abajo de la palanca de retenida (Fig. 54.4. nº 7). La puerta de la escotilla
tiende a abrirse por acción de la barra de torsión y si soltamos la palanca de
retenida, quedará enclavada en la siguiente posición que es la de observación
protegida.
Habrá que volver a actuar otra vez sobre la palanca de retenida, para que al zafar su
pestillo, permita que la puerta de la escotilla siga abriéndose hasta la siguiente
posición.

11.2.b. Cierre de la compuerta de la escotilla desde el interior.

Tirar hacia abajo de la palanca de retenida (Fig. 54.4. nº 7) y la puerta de la escotilla


tenderá a cerrarse por acción de la barra de torsión (Fig. 54.3. nº 1).

PELIGRO
PUEDE GOLPEAR LA CABEZA DEL TRIPULANTE.

Como en el caso de la apertura, si soltamos la palanca de bloqueo, la puerta irá


enclavándose en las sucesivas posiciones.
Si se quiere el cierre total, sin soltar la palanca de retenida hasta el final, ayudar al
movimiento de cierre tirando de alguna de las asas de lona (Fig. 54.4. nº 8)
fuertemente en su parte final para vencer la acción de la junta de goma, hasta que la
escotilla quede enclavada en su posición de cerrada.

2-448
11.2.c. Abrir la compuerta de la escotilla desde el exterior.

En el lateral de la palanca de retenida (Fig. 54.4. nº 7), hay una llave (Fig. 54.3. nº 2)
que, en esa posición, sirve de seguro para impedir la apertura desde el exterior.
Caso de que se quiera poder efectuar esa apertura desde el exterior, se retirará
dicha llave de su alojamiento habitual y se situará en el orificio del mecanismo de
apertura exterior (Fig. 54.3. nº 5), y se girará la llave (Fig. 54.3. nº 2) en el sentido de
la flecha, con lo que se conseguirá que el mencionado mecanismo salga hacia arriba
produciendo el mismo efecto que cuando se actúa desde el interior sobre la palanca
de retenida (Fig. 54.4. nº 7) abriéndose, por tanto, la puerta de la escotilla. Una vez
realizada esta operación, retirar la llave del mecanismo de apertura y colocarla en su
posición habitual.
Cuando el Jefe de Vehículo y/o el Tirador, se llevan dicha llave y se abandona el
vehículo, deberá ponerse un candado (Fig. 54.3. nº 3) en el orificio del mecanismo
de apertura exterior, para evitar que alguien pueda introducir en el mismo alguna
herramienta con la que pudiera conseguir abrir la escotilla.

11.2.d. Bloqueo de la escotilla.

Para bloquear la escotilla desde el interior se dispone de una palanca (Fig. 54.4. nº
10) de manivela abatible (Fig. 54.4. nº 9). Esta palanca, en su posición de bloqueo
activa el contactor de cierre (Fig. 54.4. nº 11).

11.3. MANEJO DEL ASIENTO DEL JEFE DE VEHÍCULO.

Disponen de dos mandos de ajuste:


 Palanca de liberación de la base del asiento (Fig. 54.5 nº 7): Permite poner el
asiento (Fig. 54.5 nº 4) en posición vertical sobre la columna soporte (Fig.
54.5 nº 2), con lo que el operador puede ponerse de pie con comodidad sobre
el piso de la torre. Para ello sólo hay accionar la palanca y tirar del asiento
hacia arriba y el asiento se replegará hacia atrás... Para poner el asiento
horizontal, empujar el asiento hacia abajo hasta que quede enclavado.
 Pestillo de ajuste en altura (Fig. 54.5 nº 8): Permite obtener ocho alturas
diferentes del asiento. Para ello, tirar hacia afuera del pestillo y ajustar la
altura del asiento aprovechando el peso del cuerpo. Cuando se alcance la
altura deseada, soltar el pestillo para que por acción de su muelle, se
introduzca en el orificio correspondiente y quede enclavado.
Los asientos disponen de un cinturón de seguridad doble, con una parte fija (Fig.
54.5 nº 3) y dos carretes (Fig. 54.5 nº 6 y 9) situados en el lado opuesto. Asimismo
cuentan con almohadillas de lona desmontables y reposacabezas (Fig. 54.5 nº 1).
La columna soporte se apoya en su parte inferior sobre el soporte (Fig. 54.5 nº 5).

2-449
)LJXUD$VLHQWRVGHODWRUUH

12. RESUMEN.

En esta ficha se describen el puesto de Jefe de vehículo y las operaciones en modo


apagado, no se considera conveniente realizar un resumen de los mismos

13. PRÁCTICAS.

13.1. SITUACIÓN INICIAL

VCI con las escotillas de la torre cerradas (resto de escotillas, celosías y portón
trasero pueden estar abiertos), mamparos de la cámara de armas puestos.
Un tripulante se situará en el Puesto de Jefe de vehículo y otro en el de Tirador. El instructor permanecerá en la
parte superior de la torre o de la barcaza, donde disponga del control de los dos tripulantes.

13.2 REQUISITOS A ALCANZAR:

Identificar las escotillas.


Abrir y cerrar las escotillas desde el exterior y desde el interior.
Sabrá poner el seguro de las escotillas de la torre para la no apertura desde el
exterior de las mismas.
Conocerá el manejo del asiento tanto del puesto del JV como del TIR.

13.3 SITUACIÓN FINAL:

2-450
FICHA DE TAREA

1. CÓDIGO. 612-400-055.

2. DESCRIPCIÓN. SISTEMA DE MOVIMIENTO Y ESTABILIZACIÓN DE LA TORRE


Y CAÑÓN.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico-Práctica. Aula y Vehículo Teoría: 30 minutos.
Práctica: 15 min./alumno
7. AYUDAS A LA INSTRUCCIÓN.
Soporte informático, manuales, VCI/C y CD ayudas a la Instrucción.
8. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

Es necesario disponer de un vehículo por cada 4 tripulantes como máximo en la


clase práctica, y en la clase teórica auxiliarse en soporte informático o sala EAO.
El instructor debe hacer especial mención a las medidas de seguridad y no dar paso
a la clase práctica hasta que los soldados no las tengan perfectamente asimiladas.

NOTA: Es necesario en esta práctica (y en todas en las que la torre se vaya a


mover) poner el indicador luminoso rotativo de la torre, para avisar al personal que
se puede mover la misma en cualquier momento.

10. REQUISITOS A ALCANZAR.

Que el tripulante sea capaz de:


x Manejar, observando las normas de seguridad, el mando del Jefe de Vehículo
para movimiento de torre y cañón.
x Manejar la torre y el cañón mecánicamente.
x Explicar en qué consiste el sistema de estabilización.
x Identificar y explicar la función que realizan los elementos principales de la
estabilización.
x Poner en funcionamiento la estabilización observando las normas de
seguridad.

La tarea se considerará correctamente realizada si se obtiene el 80 % de aciertos en


los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. PUESTA EN SERVICIO DE LA TORRE.


2-455
11.1.a. Normas de seguridad.

Ver Ficha 612-400-013: Normas de seguridad, y Anexo A de este manual.

11.1.b. Funcionamiento eléctrico de la torre por el jefe de vehículo.

Entendemos por “puesta en servicio” poner la torre en condiciones de ser utilizada;


para ello lo primero es proporcionar alimentación eléctrica a todos los sistemas
principales.
La alimentación de la torre es proporcionada por el sistema eléctrico general del
vehículo que, a través del anillo colector, alimenta el sistema eléctrico específico de
la torre.
Para ello en la caja de disyuntores general de la cámara de conducción han de estar
activados el disyuntor general del vehículo y el disyuntor principal de la torre. Con
ello las dos baterías de servicio del vehículo proporcionan alimentación para
sistemas de bajo consumo.

11.1.b.(1). PROCEDIMIENTO GENERAL:


1) Colocar el interruptor INT. PRIN. BATERÍAS en su posición 1 si solamente se
van a realizar operaciones de bajo consumo.
2) Comprobar que los cinco disyuntores de la caja de distribución de potencia.
están activados.

PRECAUCIÓN
Poner en marcha el motor o conectar a una fuente de alimentación externa en
caso de tener que efectuar movimientos de torre/cañón con los servos u
operaciones de armado del cañón. PUEDEN AGOTARSE RÁPIDAMENTE LAS
BATERÍAS

Para un uso normal de la torre deben observarse las siguientes instrucciones:


 Poner en marcha el motor del vehículo.
 La tripulación deberá ocupar sus puestos y cerrar las puertas correderas de la
protección de la torre.
 Las trincas de bloqueo de giro de la torre y de elevación del cañón se
soltarán.
 Comprobar que el pulsador de oscurecimiento DESCON LUCES del Panel de
Control Principal, está desconectado. Si estuviera conectado, no se
encenderá ningún indicador durante la autocomprobación previa al conectar la
torre y dará la impresión de que falta tensión.

Una vez efectuado lo anterior y sobre el panel principal poner en ON el interruptor


general TORRE ON/OFF (Fig. 55.1. nº1).

2-456
)LJXUD3DQHOGH&RQWURO3ULQFLSDOGHODWRUUH

En ese momento y suponiendo un inicio correcto se producirá:


 Arranca el BITE y se inicia el autotest (ver ficha 612-400-058 de este manual).
 Se realiza un test de lámparas durante 5 segundos.
 Se ilumina la pantalla de información (ver ficha 612-400-058 de este manual)
y transcurridos 6 segundos se presenta el mensaje INICIO CORRECTO
(durante 8 seg).
 El sistema adopta la configuración inicial:
o Arma seleccionada: Ametralladora MG.
o Modo de disparo: Ráfagas de 6 disparos.
o Servos: OFF.
o Estabilización: OFF.
o DAL: Se mueve a la posición central, si el cierre está atrás (armado).

Dependiendo de la situación previa del arma, se iluminarán:


 En la Panel de Control Principal:
o ZONA INTER DIREC. Si el cañón está entre las 4 y las 8, o entre 10 y
12.
o ESCOT ABIERT. Si está abierta alguna escotilla.
 En los Paneles de Control de armas del JV y Tirador los indicadores:
o SEGUR.
o MG 7,62.
o FIN CINTA (Si el cargador de la ametralladora está vacío)
 En las pantallas de información de los Paneles de Control de armas:
o CIERRE ATRAS. Si el cierre del cañón está en esa posición.
o POS INC ALIM. Si el DAL no está centrado.
o MG RAF 6.

La torre ahora está preparada para la activación de todos los sistemas.


11.1.b.(2). FUNCIONAMIENTO DEL BITE.

Ver ficha 612-400-058 de este manual

11.2. SISTEMA DE ESTABILIZACIÓN DEL VEHÍCULO.

11.2.a. Generalidades.

2-457
Es el encargado del movimiento en acimut de la torre y de elevación del cañón, así
como de su estabilización en dos ejes para el tiro/observación.
El sistema permite el giro de la torre en 360° y la elevación del cañón y de la
ametralladora coaxial entre –10º y +50°.
Un sistema de protección eleva el cañón automáticamente, evitando golpear el
casco, cuando se mueve con un ángulo de depresión y se encuentra entre la 4 y las
8.
Por razones de seguridad el sistema de giro de torre no puede ser operado con las
escotillas abiertas, salvo que se actúe (bajo la responsabilidad del JV) sobre el
interruptor de anulación de escotillas abiertas, ANULAR SEG ESCT, situado en la
Panel de Control Principal. Las características técnicas del sistema se exponen en el
Manual Técnico correspondiente al vehículo.

11.2.a.(1).SISTEMA DE ACCIONAMIENTO DE LA TORRE Y EL CAÑÓN.

PRECAUCIÓN
Antes de activar el sistema asegurarse de que la torre no está bloqueada.
Comprobar las trincas de bloqueo (ver ficha 612-400-041 de este manual).

PELIGRO
ANTES DE ACTIVAR LOS SERVOS ASEGURARSE DE QUE LOS
PROTECTORES DE PIE DE JV Y TIRADOR ESTÁN CORRECTAMENTE
CERRADOS.

Presionar el pulsador/indicador SERVO ON/OFF, del Panel de Control


Principal. Si este indicador permanece encendido (en “verde”), la torre estará
en disposición de funcionamiento pudiendo accionarse con los mandos
respectivos del JV o del T.
Si el indicador parpadea, el sistema de servos queda inhibido y el movimiento
de la torre no será posible, lo cual puede ser debido a:
 Hay alguna escotilla abierta: Se cerrará la escotilla correspondiente o se
activará el interruptor de prioridad ANULAR SEG ESCT. Si este
interruptor se coloca en ON (bajo la responsabilidad del JV), el sistema
de movimiento de la torre y cañón se activará aún con las escotillas
abiertas, mientras el indicador ESCOT ABIER parpadeará (en “ámbar”).
 Hay avería en el sistema: Se enciende (en “rojo”), el indicador de fallos
ERROR SERVO.
Si todo funciona correctamente y no se puede mover la torre, puede ser
debido a:
 No hay suficiente tensión: Se encenderá el indicador TENS BAJA del
Panel de Control Principal.
 No han sido desbloqueadas las trincas de giro de torre y/o elevación del
cañón: Se iluminará (en “rojo”) el indicador de bloqueo TRINCAS del
Panel de Control Principal.

2-458
Si la torre se desplaza sobre las zonas de interferencia en dirección con un ángulo
del cañón inferior a 0º, se encenderá (en “rojo”) el indicador ZONA INTER DEPRE.
del panel y se elevará automáticamente. Si el sensor de autoelevación se activa
durante el tiro con cualquiera de las dos armas, se interrumpirá el fuego
automáticamente siendo necesario volver a presionar el disparador para continuar el
fuego.
Si la torre se desplaza sobre las zonas de interferencia en dirección, entre las 4 y las
8, o entre las 10 y las 12, se encenderá (en “ámbar”) el indicador ZONA INTER
DIREC, indicando que se está en una zona donde, por debajo de un determinado
ángulo de depresión del cañón, puede interferir con el casco, en cuyo caso
sucedería lo explicado en el punto anterior.

11.2.a.(2).SISTEMA DE ESTABILIZACIÓN:
1) Realizados todos los pasos descritos en los apartados anteriores.
2) Presionar el pulsador/indicador ESTAB ON/OFF del panel de mando principal,
para conectar la estabilización
3) El indicador parpadeará (en “ámbar”) durante unos segundos, pasados los
cuales se iluminará fijo indicando que la estabilización está conectada
correctamente.
Si el indicador no dejara de parpadear, indicaría que la estabilización no está lista
para operar, bien por avería o bien por un fallo en la comunicación a través del CAN-
BUS (ver apartado 11.1.b.(2)).

11.2.b. El manejo mecánico de la torre.

La torre está equipada con un sistema electromecánico estabilizado en dos ejes, de


giro de torre y elevación de cañón, dirigido a través de una Dirección de Tiro (DT).
El sistema permite el giro de la torre en los 360° y la elevación del cañón y de la
ametralladora coaxial entre -10° y +50° en manual.
Un sistema de protección eleva el cañón automáticamente, para evitar que pueda \

golpearse contra el casco, cuando aquel se mueve con un ángulo de depresión


(inferior a 0°) y se encuentra entre la 4 y las 8.
Por razones de seguridad el sistema de giro de torre no puede ser operado con las
escotillas abiertas, salvo que se actúe (bajo la responsabilidad del JV) sobre el
interruptor de anulación de escotillas abiertas, situado en el panel de mando
principal.
Independiente del sistema de accionamiento electromecánico este vehículo dispone
de un sistema mecánico con mandos manuales para giro de la torre y elevación del
cañón así como de sendos mecanismos de bloqueo (ver ficha 612-400-041 de este
manual).

11.2.c. Accionamiento mecánico de giro de la torre.

El mando manual de giro de la torre, está situado a la altura de la corona de giro de


la misma, entre los asientos del Jefe de Vehículo y del Tirador y funciona mediante
el movimiento rotacional de la manivela (Fig. 55.2 nº6) en uno o en otro sentido,
dependiendo de para donde se quiera que gire la torre. Su manivela (Fig. 55.2 nº6)
es abatible, fijándose, para su uso, en posición horizontal, mediante un pestillo de
fijación que tiene a tal efecto. También es abatible 90° el brazo completo alrededor
del eje de giro , liberándolo mediante un pestillo que tiene a su izquierda, de modo
que dicho brazo quede horizontal. Al finalizar su utilización, se volverá a poner el
brazo en vertical y tirando de la manivela hacia el exterior, se abatirá ésta también.
2-459
)LJXUD0DQGRGHJLUR

11.2.d Accionamiento mecánico de elevación del cañón.

El mando manual de elevación del cañón (Fig. 55.3 nº3) está situado delante y a la
derecha del asiento del Tirador, a la derecha y debajo del mando correspondiente a
la DT. Su empuñadura también es abatible (con el mismo sistema del mando de giro
de la torre) y una vez en posición horizontal, girando a derechas se abatirá el cañón,
y a izquierdas se elevará.

)LJXUD0DQGRGHHOHYDFLyQ

2-460
FICHA DE TAREA

1. CÓDIGO. 612-400-056.

2. DESCRIPCIÓN. ELEMENTOS DE OBSERVACIÓN Y PUNTERÍA DEL JEFE DE


VEHÍCULO.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico-Práctica. Aula y vehículo VCI Teoría: 40 minutos.
Práctica: 15 min./alumno
7. AYUDAS A LA INSTRUCCIÓN.
Soporte informático, vídeos, diapositivas y VCI/C, CD ayudas a la Instrucción.
8. BIBLIOGRAFÍA.
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

Fase teórica auxiliarse y apoyarse en soporte informático, videos y diapositivas.


Fase práctica distribuir grupos, a poder ser, de no más de 4 tripulantes por VCI.

10. REQUISITOS A ALCANZAR.

Que el tripulante sea capaz de:

x Identificar, explicar la función que realizan y manejar correctamente los


elementos principales del periscopio de puntería del Jefe de Vehículo.
x Efectuar punterías con el mismo.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. DESCRIPCIÓN Y MANEJO DEL PERISCOPIO DE PUNTERÍA DEL JEFE DE


VEHÍCULO.

El Sistema Secundario de Punterías está compuesto por el periscopio P-204-P del


Jefe de Vehículo. Este periscopio es independiente de la DT por lo que resulta
fundamental en caso de que el sistema principal o el propio Tirador queden fuera de
combate. Asimismo permite al JV participar en el proceso de adquisición y
designación de blancos y todas las operaciones previas al disparo. Su montaje se
realiza sin necesidad de herramientas ni utillaje sobre el soporte que incorpora el
VCI.

11.1.a. Periscopio P-204

2-465
El periscopio P-204-P permite la observación directa mediante una pantalla 1x (Fig.
56.1 nº 1) y la ejecución de puntería directa mediante el ocular 8x (Fig. 56.1 nº 2) y
su correspondiente retículo de punterías. La selección entre ambos modos se realiza
mediante conmutación de un espejo abatible con el mando de cambio de modos
(Fig. 56.1 nº 7).

)LJXUD3HULVFRSLRGHSXQWHUtDVGHO-9

Nº DENOMINACIÓN FUNCIÓN
1 Acoplamiento del varillaje Transmitir los movimientos del cañón al espejo
balístico. balístico para seguimiento del blanco.
2 Tuerca de palomilla. Fijar el periscopio a su soporte.
3 Leva de selección. Seleccionar la visión a través de la ventana de
observación o a través del ocular de puntería.
4 Ventana de observación. Permitir la observación con una visión de 1x.
5 Anillo de ajuste de Enfocar el canal del visor diurno para obtener la
dioptrías. mejor imagen.
6 Mando de dirección del Mover el retículo en dirección para la
retículo. homogeneización.
7 Mando de elevación del Mover el retículo en elevación para la
retículo. homogeneización.
8 Selector de filtro. Seleccionar diferentes filtros al girarlo 90º.
9 Tapón de barrido. Introducir el nitrógeno seco en el cuerpo del
periscopio para comprobar la estanquidad.
10 Pestillo de fijación. Sujetar el cuerpo con el ocular del periscopio a la
cabeza del mismo.
11 Tapón de barrido. Introducir el nitrógeno seco en la cabeza del
periscopio para comprobar la estanquidad.

11.1.b. Retículo del periscopio P-204 (Fig. 56.2)

El retículo del periscopio del JV dispone de tres escalas verticales, una para cada
tipo de munición (APFSDS, MP/TP y ametralladora coaxial) y trazas horizontales
para punterías sobre blancos en movimiento.
2-466
)LJXUD5HWtFXORGHOSHULVFRSLR3GHO-HIHGH9HKtFXOR

11.2. MODO DE EFECTUAR PUNTERÍAS.

PELIGRO
ANTES DE EFECTUAR EL FUEGO ASEGURARSE DE QUE TODOS LOS PANELES DE ACCESO
A LA CÁMARA DE ARMAS INCLUIDOS CARGADORES Y ACCESO AL CAJÓN DE RECOGIDA
DE VAINAS ESTÁN COLOCADOS Y ASEGURADOS

11.2.a. Observación y detección de blancos.

Para la observación y detección de blancos es conveniente utilizar los elementos


ópticos de campo ancho: CT en campo ancho preferentemente o bien las ventanas
1x de los periscopios del Tirador y JV. Sólo si el sector de tiro asignado es muy
limitado en azimut podría resultar conveniente utilizar para la detección de blancos la
CT en campo estrecho, el ocular de la UVL o el ocular 8x del periscopio del JV.
La cámara térmica es el elemento más indicado para la detección de blancos
aunque la identificación del mismo resulta más difícil. Esta circunstancia debe
tenerse en cuenta en situaciones confusas del combate para evitar hacer fuego
sobre objetivos propios.

11.2.b. Puntería y fuego con el sistema principal.

NOTA
El operador puede ser:
 El Tirador apuntando a través de su periscopio (UVL) o del monitor de
cámara térmica.
 El Jefe de Vehículo apuntando a través de su monitor de cámara
térmica. En este último caso, debe asegurarse de que:
o Los datos introducidos por el Tirador en el UCP son correctos.
o El láser está encendido (ON) si quiere distancia láser
o El láser está anulado (OFF) si se desea distancia manual
o Si desea ALZA DE COMBATE basta que pulse el pulsador
correspondiente en sus mandos (láser OFF).

En el caso normal, detectado, identificado y elegido el blanco, el Tirador o el JV


deben efectuar la secuencia siguiente:
2-467
1) Apuntar al blanco con el retículo de la CT u ocular de la UVL (sólo Tirador) y,
si el blanco está en movimiento, efectuar un seguimiento del mismo hasta que
sea uniforme.
2) Efectuar un disparo láser (el retículo se desplazará) y sin soltar el pulsador
láser, el Tirador vuelve a apuntar al blanco y, una vez centrado, efectúa el
disparo. Debe procurar que el tiempo transcurrido desde el disparo del láser al
disparo del arma sea el mínimo posible, debido a que el disparo del láser, es
susceptible de ser detectado por el enemigo. y, sobretodo, para minimizar el
error del ángulo de predicción.

)LJXUD3XOVDGRUHV

3) El fuego se produce al presionar el correspondiente disparador, teniendo


apretado previamente el pulsador de toma de carga, desde cualquiera de las
empuñaduras del JV o T.
4) En el modo fuego ante la pulsación de disparo proveniente bien del Tirador o
del JV todo es correcto, el sistema empieza a disparar. Constantemente se
realiza un conteo del número de disparos realizados así como la indicación de
cualquier interrupción en el proceso de fuego.
5) La empuñadura del JV tiene prioridad sobre la del Tirador.
6) El pulsador de toma de carga tiene que permanecer apretado durante todo el
ciclo de fuego: dejar de apretar dicho pulsador supone el inmediato alto el
fuego.
7) El JV puede dar por finalizado un ciclo de fuego que esté realizando el
Tirador, apretando el pulsador de toma de carga de su empuñadura.

NOTA
Si al pulsar fuego existe un fallo en el circuito, el indicador seguro permanecerá
encendido y el indicador fuego parpadeará.

Las variaciones sobre esta secuencia pueden consistir en lo siguiente:

2-468
 Necesidad de tener que variar el ECO (PRIMERO/ÚLTIMO) del láser si se
prevén falsos ecos anteriores o posteriores al blanco elegido. En éste caso,
se iluminará el indicador de eco en la pantalla de la CT o el ocular de la UVL.
 Si no se utiliza el láser para la medición de distancia (llave en OFF) introducir
manualmente la distancia o bien pulsar el botón de alza combate en el mando
de dirección.
 Si se utiliza alza de combate, sobre blancos en movimiento y se efectúa el
seguimiento del blanco debe apretarse el botón del láser y mantenerlo
apretado para introducir la predicción lateral.

11.2.c. Puntería con el sistema secundario (Periscopio del JV)

11.2.c. (1). AJUSTES PREVIOS:

 Selección del modo de visión: Para observar en modo 1x, situar el mando de
cambio de modos Fig. 56.1 nº 3) en su posición superior, de forma que la
imagen se muestre en la ventana de observación. Para observar en modo 8x,
situar el mando de cambio de modos en su posición inferior, y la imagen se
mostrará en el ocular del Periscopio.
 Ajuste de las dioptrías del ocular (modo de visión 8x): girar el anillo de ajuste
dióptrico del ocular hasta obtener una imagen enfocada del retículo.
 Selección del filtro: Actuar sobre el mando de selección (Fig. 56.1 nº 8) para
seleccionar el filtro adecuado a las condiciones de iluminación.

11.2.c. (2). EJECUCIÓN DE LA PUNTERÍA.

Para efectuar las punterías con el periscopio del Jefe de Vehículo solo es necesario
apuntar con el trazo adecuado del retículo (Fig. 56.4).

)LJXUD5HWtFXORGHOSHULVFRSLRGHO-9

El retículo presenta las siguientes marcas e indicaciones:


a) En la izquierda del retículo se muestra una columna con los números 5-10-15-
20-25-30, que corresponden a las distancias (en hectómetros, hm) a que se
han grabado las alzas (líneas horizontales y extremos inferiores de tramos en
vertical) con que se deberá apuntar para la munición APFSDS y la distancia
considerada.
b) A la derecha del retículo se muestran dos columnas de números. La más
interna de ellas (números 3-5.5-8-10.5-13-15) corresponde a las distancias
(en hectómetros, hm) a que están marcadas las alzas para la munición
MP/TP, y la más extrema (números 2-3-4.5-5.5-6.5-7.5) corresponde a la

2-469
distancia (en hm) a que están grabadas las alzas para la munición MG
(ametralladora).
c) Un círculo central, que se utiliza para la homogeneización y puesta a cero.
d) Una línea vertical central y discontinua, en la que los extremos inferiores de
cada tramo están enrasados con las líneas horizontales. La posición inferior
de cada tramo de la línea vertical corresponde a las distancias que se
representan a la izquierda y a la derecha del retículo, dependiendo del tipo de
munición. El extremo superior de cada tramo de la línea vertical corresponde
a las distancias intermedias entre las correspondientes a las dos líneas
horizontales que le son más próximas.
e) Un conjunto de líneas horizontales a derecha e izquierda de la línea central
vertical. Estas líneas representan los valores de la predicción lateral que se
deberá introducir en el arma para las diferentes velocidades del blanco que
están representadas en el retículo.
El retículo es simétrico respecto a la línea vertical central, debiéndose utilizar las
marcas de la derecha/izquierda para la introducción de las predicciones laterales
correspondientes a blancos que se desplacen hacia la izquierda/derecha.

MUNICIÓN
APFSDS MP/TP MG
A 500 300 200
B 750 425 250
C 1.000 550 300
D 1.250 675 375
E 1.500 800 450
F 1.750 925 500
G 2.000 1.050 550
H 2.250 1.175 600
I 2.500 1.300 650
J 2.750 1.400 700
K 3.000 1.500 750

11.2.c. (3).PUNTERÍA SOBRE BLANCO FIJO.

Para apuntar sobre blanco fijo se utilizará, preferentemente, la línea central vertical.
(Fig. 56.5), los extremos de cada tramo de la línea vertical corresponden al alza
asociada a la distancia en hectómetros (hm), indicada en la tabla anterior, de la “A” a
la “K”:

2-470
)LJXUD'LVWDQFLDVGHORVWUD]RVYHUWLFDOHVGHOUHWtFXOR

Ejemplo A sobre blanco fijo


Supongamos que queremos batir un objetivo situado a una distancia de 1.500 m con
munición APFSDS. Se deberá apuntar al centro del objetivo según se indica en la
figura 56.6. En el caso de que la munición a emplear fuera la MP/TP, se deberá
apuntar según se indica en la misma figura.

)LJXUD(MHPSORGHWLURVREUHEODQFRILMR P 

Ejemplo B sobre blanco fijo


Supongamos que queremos batir un objetivo situado a una distancia de 1.250 m y
disponemos de munición APFSDS. Se deberá apuntar al objetivo según se indica en
la figura 56.7. En caso de que la munición con que queremos batir el objetivo sea la
MP/TP, se deberá apuntar según se indica en la misma figura.

2-471
)LJXUD(MHPSORGHWLURVREUHEODQFRILMR P

11.2.c. (4).PUNTERÍA SOBRE BLANCO MÓVIL.

Para la realización de puntería sobre blanco móvil, se emplearán los trazos


horizontales del retículo, dependiendo de la velocidad del blanco y la munición
considerada (Fig. 56.8). Las marcas del lado derecho del retículo se usarán para
blancos que se muevan de derecha a izquierda. Las marcas del lado izquierdo del
retículo se usarán para blancos que se muevan de izquierda a derecha.
Los extremos indicados como (1) en las líneas horizontales, corresponden a la
predicción para una velocidad del blanco de 10 km/h. Los extremos indicados como
(2), (3) y (4) corresponden, respectivamente, a velocidades de 20, 40 y 60 km/h del
blanco.

)LJXUD9HORFLGDGHVGHORVWUD]RVKRUL]RQWDOHVGHOUHWtFXOR

Ejemplo A sobre blanco móvil


Supongamos que queremos batir un objetivo que se desplaza hacia la izquierda, con
una velocidad de 10 km/h y que se encuentra a una distancia de 1.500 m. Para la
munición APFSDS se deberá apuntar al objetivo como se indica en la figura 56.9.
Para la munición MP/TP, el mismo punto de 10 km/h, corresponde a una distancia
de 800 m y, por tanto, deberá buscarse el trazo correspondiente a 1500 m.

2-472
)LJXUD(MHPSORGHWLURVREUHEODQFRPyYLO P 

Ejemplo B sobre blanco móvil


Supongamos que queremos batir un objetivo que se desplaza hacia la derecha, con
una velocidad de 30 km/h y se encuentra a una distancia de 1.300 m. Para la
munición APFSDS se deberá apuntar como se indica en la figura 56.10, mientras
que para la munición MP/TP se deberá apuntar según se indica en esta misma
figura.

)LJXUD(MHPSORGHWLURVREUHEODQFRPyYLO P 

Efectuadas las punterías sobre el blanco elegido, la ejecución del fuego es la misma
que con el Sistema Principal, es decir presionando los disparadores de los mandos
eléctricos.

12. RESUMEN.

a. El telescopio de punterías E1 del Jefe de Vehículo es el elemento que le permite


efectuar punterías.

2-473
FICHA DE TAREA

1. CÓDIGO. 612-400-057.

2. DESCRIPCIÓN. DISPARAR EL CAÑÓN DESDE EL PUESTO DEL JEFE DE


VEHÍCULO.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórica-Práctica Aula-VCI/C Pizarro. Teórica: 40 min.
Práctica: No tiempo
min./alumno
7. AYUDAS A LA INSTRUCCIÓN.
Soporte informático, manuales, CD de ayuda a instrucción, VCI/C Pizarro,
herramientas de torre, banderas de tiro.
8. BIBLIOGRAFÍA.

MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación

9. CONDICIONES DE EJECUCIÓN.

Es necesario disponer de un vehículo por cada 3 tripulantes como máximo en la


clase práctica.
Por ser una práctica fundamental para la instrucción del Jefe de Vehículo es
imprescindible no tener prisa en el desarrollo de la misma, por lo que el número de
tripulantes que pasen por ella vendrá determinado por la necesaria destreza
adquirida por ellos.
A poder ser, se realizará en un campo de tiro.

10. REQUISITOS A ALCANZAR.

Que el JV sea capaz de:


x Realizar correctamente la puntería desde el puesto del Jefe de Vehículo,
sobre blancos fijos y móviles (si se dispone de ellos).
x Poner en práctica el procedimiento a seguir en el caso de que se produzca un
fallo en el disparo.

La tarea se considerará correctamente realizada si se obtiene el 80 % de aciertos en


los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. DISPARO DEL CAÑÓN DESDE EL PUESTO DEL JEFE DE VEHÍCULO.

11.1.a. Generalidades.

2-477
El cañón MAUSER MK 30-2 (30 mm x 173) es un arma de gran precisión y alta
cadencia de fuego. Su alcance efectivo y su precisión permiten batir objetivos fuera
del alcance de fusiles, ametralladoras y cañones de menor calibre, siendo
especialmente apto para batir:
 Vehículos acorazados ligeros por encima de los 2.000 m.
 Aeronaves y helicópteros de ataque por encima de los 3.000 m.

)LJXUD&RQMXQWRFDxyQ

Es un arma automática por toma de gases que accionan:


 El desbloqueo y retroceso del cierre y la extracción y expulsión de la vaina.
 El mecanismo de alimentación (Doble alimentador).

El cañón dispone de un doble alimentador que permite su alimentación por la


izquierda o por la derecha lo que permite utilizar dos tipos distintos de munición
encintada.
La secuencia de disparo se inicia con el cierre en posición retrasada retenido por el
mecanismo de disparo, los muelles recuperadores comprimidos y un cartucho en
posición de ser arrastrado por el cierre. Accionado el disparador y libre el cierre,
arrastra el cartucho introduciéndolo en la recámara, bloqueándose y produciéndose
la percusión y disparo del cartucho.

Sus características se exponen en el Manual Técnico correspondiente al vehículo.

11.1.b. Puntería, seguimiento y disparo por parte del jefe de vehículo.

Véase ficha 612-400-056 de este manual

11.2. ACTUACIÓN EN CASO DE FALLO DEL DISPARO..

11.2.a. Inhibición de disparo.

El disparo puede inhibirse por:


 Escotilla abierta. El indicador ESCOT ABIER en Panel de Control Principal de
la torre. Para evitarlo cerrar escotillas.
 Fallo en los extractores de la cámara de armas. Si por necesidades del
combate fuera necesario efectuar el fuego, activar el interruptor de anulación
de la inhibición.

11.2.b. Disparo mecánico de emergencia.

Cuando por avería u otra razón las armas no se puedan disparar eléctricamente
desde los mandos del Jefe de Vehículo o del Tirador, tanto el cañón MK 30-2 como
2-478
la AM coaxial pueden dispararse manualmente. La duración de la ráfaga dependerá
del tiempo que se actúe sobre el disparador del arma.

11.2.b.(1). DISPARO DE EMERGENCIA DEL CAÑÓN.

Para poder realizar el disparo manual de emergencia operar como sigue:

1. COLOCAR EL DAL EN SU POSICIÓN CENTRAL.


1) Insertar la llave de vaso de 14 mm (Fig. 57.2 nº 1) de la bolsa de
herramientas, el prolongador largo (Fig. 57.2 nº 2) y la llave de carraca
de cabeza hexagonal (Fig. 57.2 nº 4), en el cuadradillo del mando
manual del DAL (Fig. 57.3 nº 1) y girarlo en la dirección conveniente
hasta dejarlo aproximadamente centrado

)LJXUD%ROVDGHKHUUDPLHQWDV

)LJXUD&XDGUDGLOORSDUDPRYLPLHQWRGHO'$/

2) Comprobar el centrado con la galga (Fig. 57.2 nº 5) midiendo sobre el


puente de mando del modo que se muestra en la figura 57.4. La galga
debe entrar por su lado más estrecho (38,5 mm) en ambos lados y no
entrar por su lado más ancho (39 mm). En ése momento el DAL estará
centrado y podremos proceder al armado manual del cierre.
2-479
)LJXUD&HQWUDGRGHO'$/

2. ARMAR MANUALMENTE EL CIERRE (Fig. 57.5).


1) Girar la palanca (1) del mecanismo de bloqueo a la posición DESBLOQ
(B) para dejar libre el mecanismo de rearme
2) Introducir la manivela (Fig. 57.2 nº 6) del lote de a bordo en el
cuadradillo (2) y girar la manivela en el sentido de las agujas del reloj
para desplazar el cierre hacia atrás.
3) Una vez retenido el cierre por el mecanismo de disparo, invertir el
movimiento de giro de la manivela para llevar el sistema de rearme a su
posición más adelantada (reposo).

)LJXUD$UPDGRPDQXDOGHOFLHUUH

3. DISPARAR MANUALMENTE:

2-480
1) Situar el DAL con el mecanismo manual en posición de alimentación
(derecha o izquierda en función del cargador que vayamos a usar).
2) La palanca selectora manual (Fig. 57.5. nº 3) que se encontrará en la
posición de RAFAGA (siempre en ésa posición para poder efectuar el
disparo eléctrico) deberá situarse en la de TIRO A TIRO, si se quiere
efectuar el disparo en esta modalidad; en caso contrario mantener la
posición RAFAGA.
3) Introducir la palanca de disparo de emergencia (Fig. 57.6. nº 1) de forma
que enganche los tetones (Fig. 57.6. nº 2) del balancín de disparo (Fig.
57.6. nº 3).

)LJXUD$FFLRQDPLHQWRPDQXDOGHO
PHFDQLVPRGHGLVSDUR 
)LJXUD$FFLRQDPLHQWRPDQXDO
GHOPHFDQLVPRGHGLVSDUR 

4) Apalancar hacia adelante con la palanca de disparo para hacer bascular


el balancín de disparo y desplazar la cadena (Fig. 57.6. nº 4) del
mecanismo de disparo, para que actúe sobre dicho mecanismo,
liberando el cierre y produciendo el disparo. (Fig. 57.7).
5) Para llevar el cierre hacia adelante sin efectuar el disparo, caben dos
posibilidades:
a. Si el mecanismo de rearme está atrás, disparar manualmente tal y
como se explica en el siguiente apartado para liberar el cierre y
con la manivela llevar el cierre hacia delante (girar en sentido
contrario a las agujas del reloj).
b. Si el mecanismo de rearme está delante, llevarlo hacia atrás y
ejecutar la operación anterior.

11.2.c. Interrupciones del tiro del cañón.

11.2.c.(1). CONDUCTA A SEGUIR EN CASO DE INTERRUPCIÓN.

2-481
En el caso de producirse una interrupción en el fuego por la causa que sea, debe
asumirse que puede haber un disparo en la recámara.

PELIGRO
SI SE PRODUCE UNA INTERRUPCIÓN Y EL TUBO ESTÁ MUY CALIENTE (SE
CONSIDERA MUY CALIENTE DESPUÉS DE DISPARAR MÁS DE 100 DISPAROS
EN MEDIA HORA) PUEDE PRODUCIRSE LA AUTOIGNICIÓN DE LA CARGA SI
EXISTE UN DISPARO EN LA RECÁMARA.

PELIGRO
SI EL CIERRE SE ENCUENTRA EN UNA POSICIÓN INDETERMINADA Y EXISTE
UN DISPARO EN LA RECÁMARA O EN EL DOBLE ALIMENTADOR, PUEDE
PRODUCIRSE EL DISPARO INESPERADAMENTE.

PELIGRO
QUEDA TOTALMENTE PROHIBIDO EL DESMONTAR EL TUBO DEL CAÑÓN,
DEL CAJÓN DE MECANISMOS O EL CAÑÓN DE LA CUNA SI EXISTE UN
DISPARO EN LA RECÁMARA O EN EL DOBLE ALIMENTADOR.

NOTA
Salvo en operaciones, es aconsejable que la operación de extracción de un disparo
de la recámara se efectúe por el 2º Escalón

En este caso y hasta que se restablezcan las condiciones de seguridad:


1) Mantener el VCI en su posición.
2) Despejar el área peligrosa.
3) Mantener apuntado el cañón apuntado a su objetivo.
4) Si el cañón está muy caliente, esperar al menos 30 minutos antes de proceder
a solucionar el problema.

Las acciones correctivas a ejecutar son las siguientes:


1) Extremar las precauciones.
2) Situar el cierre MANUALMENTE en posición retrasada.
3) Retirar la munición del doble alimentador.
4) Levantar el doble alimentador.
5) Determinar el tipo de interrupción:
 Vaina atascada en la recámara
 Vaina rota (sin culote)
 Disparo en la recámara
 Cierre atascado
6) Revisar y despejar las guías del cierre eliminando cualquier elemento que
pudiese impedir el funcionamiento normal del mismo.
7) Revisar la recámara comprobando que está libre de cualquier elemento
extraño. En caso contrario:

2-482
a) Montar el kit de limpieza tal y como muestra la figura 57.8 con la
boquilla portatrapos (1) en primer lugar y a continuación los tramos de
varilla (2) y finalmente el maneral (3).

)LJXUD.LWGHOLPSLH]D

b) Situándose fuera de la línea de fuego y mirando hacia el objetivo,


introducir despacio el útil en el tubo agarrando dos hombres el
maneral por sus asas laterales hasta hacer tope. Usar guantes.
c) Si existe un proyectil en la recámara la baqueta se introducirá
hasta la marca roja 6 si el freno de boca está puesto o hasta la
marca roja 7 si no lo estuviera.
d) Si lo que existe en la recámara es una vaina, la baqueta se
introducirá hasta la marca 4 (con freno de boca) o hasta la marca
5 (sin freno de boca).
e) Si la baqueta se introduce más allá de las marcas rojas (6 ó 7) sin
llegar a las blancas (4 ó 5) nos encontramos con un disparo con
parte de un proyectil.
8) Extraer los elementos extraños (en el caso de un proyectil completo avisar al
2º Escalón que dispone de la boquilla adecuada para insertar en la baqueta)
mediante unos cuantos golpes cortos pero potentes. Si se necesitase el
extractor de vainas avisar al 2º Escalón.
9) Limpiar la recámara con los elementos de limpieza.
10)Si el cierre no quedara en posición retrasada, determinar la posición del
cierre:
 Si estuviera en posición adelantada, comprobar los pestillos de
bloqueo.
 Si los pestillos de bloqueo no estuviesen atascados comprobar el
mecanismo de rearme.
 En caso contrario buscar la causa y proceder a su corrección
 En caso de duda avisar al 2º Escalón.

11.2.c.(2). CONMUTADOR DE MODO FUEGO/SEGURO.

Condiciones por las que el sistema pasa automáticamente a modo SEGURO (se
iluminan los pulsadores SEGURO en las Unidades de Control del JV y T):

2-483
 Si se abre alguna escotilla, se iluminará el indicador ESCOT ABIER en el
Panel de Control Principal de la torre: Cerrar la escotilla o activar el interruptor
ANULAR SEG ESCT.
 Después de un error en el cañón, parpadearán los pulsadores FUEGO, lo que
puede ser debido a:
o Fallo en el electroimán de disparo.
o Tiempo de regreso del cierre > 200 ms.
o Ciclo de fuego > 2,5 s.
 Comprobar el sistema de alimentación de munición y salida de eslabones,
subsanar el error y apagar y volver a encender la torre.
 Por un error en el DAL, parpadearán los testigos POS INC ALIM de las
pantallas de los Paneles de Control de armas de JV y T: Subsanar error y
apagar y volver a encender la torre.


NOTA
Al ponerse el arma en SEGURO, el DAL se mueve a su posición central.

Condiciones para conmutar de nuevo a modo FUEGO


Para la ametralladora MG: no hay ninguna condición previa.
Para el cañón MK 30-2: Para que la lógica autorice la posición de cargador derecho
o cargador izquierdo, deberá comprobarse previamente que:
 El cierre está atrás (el cañón debe estar armado). Se enciende CIERRE
ATRÁS.
 El DAL ocupa su posición central.
 El mecanismo de rearme está desconectado y en su posición de descanso
(delante).
Se pasa a FUEGO presionando dicho pulsador, en ese momento:
 Si la MG está seleccionada: el DAL permanece en su posición central.
 Si está seleccionado el cañón: el DAL se mueve a una posición de
alimentación (dependiendo del cargador seleccionado).


)LJXUD)LQGHFLQWDHQOD8&GHO-9

11.2.c.(3). FIN DE CINTA (Fig. 57.9).

El indicador FIN CINTA indica que en el cargador del arma seleccionada quedan
solamente los últimos disparos para enlace. El interruptor del cargador es accionado
por la cinta cuando la cinta de alimentación que resta es demasiado corta. Los

2-484
indicadores FIN CINTA (1) de los Paneles de Control de JV y del Tirador, se
iluminarán en “rojo”.
Si el interruptor del cargador actúa durante una ráfaga, la acción de éste
interrumpirá la misma.
La desactivación de esta señal, y por tanto la recuperación de la posibilidad de
disparo se produce:
 Si la señal de FIN CINTA cesa al recargar el arma.
 Si se selecciona otra arma u otro cargador.
Presionando el indicador FIN CINTA, con lo que puede continuarse el fuego hasta
consumir el último disparo de la cinta, sabiendo que esta opción dificultará la
próxima recarga.

11.2.c.(4). ACUMULACIÓN DE VAINAS.

Aunque la capacidad del almacén de vainas está adecuada al volumen de munición


de empleo inmediato, existe la posibilidad, de que durante el disparo con ángulos
cercanos a la máxima elevación del cañón y en ráfagas de 10 disparos, puedan
producirse interrupciones aleatorias por rebote vertical de una vaina al alcanzar el
automatismo del cierre.
Este hecho se puede subsanar inmediatamente con el rearme normal o rearme de
servicio.
La posibilidad de interrupción no debe presentarse, ni en las condiciones más
adversas, antes de disparar, al menos, 130 cartuchos. Así pues, para que esta
interrupción no se produzca bajo ningún concepto se recomienda, caso de ser
tácticamente posible, la extracción de vainas y eslabones cuando se hayan realizado
dicho número de disparos.

PRECAUCIÓN
Al vaciar el almacén de vainas comprobar que no queden eslabones
depositados en la parte superior del accionamiento de elevación, pueden
producirse interrupciones en el disparo.

12. RESUMEN.

En esta ficha se describen los pasos a seguir por el JV para el disparo del cañón, no
se considera conveniente realizar un resumen de los mismos.

13. PRÁCTICAS.

13.1. SITUACIÓN INICIAL

VCI con las escotillas de la torre abiertas, mamparos de la cámara de armas puestos
y asegurados, cestas, portón trasero y escotillas de la barcaza cerradas y
aseguradas.
El motor arrancado y conductor en su puesto.
Torre encendida.
Elementos de la Dirección de tiro encendido.
Servos Apagados.

2-485
FICHA DE TAREA

1. CÓDIGO. 612-400-058.

2. DESCRIPCIÓN. LOS PANELES JV Y EL BITE.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico-Práctica. Aula y Vehículo. Teoría: 40 minutos.
Práctica: 15-20 min./alumno
7. AYUDAS A LA INSTRUCCIÓN.
Soporte informático, aula EAO, CD ayuda a la Instrucción y VCI/C Pizarro.
8. BIBLIOGRAFÍA
MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

Fase teórica auxiliarse de las aulas EAO y manual MT6-021.


Fase práctica distribuir grupos, a poder ser, de no más de 4 tripulantes por VCI.
Durante el desarrollo de la misma, el Instructor se introducirá en el puesto del TIR y
el tripulante en el puesto de JV.

10. REQUISITOS A ALCANZAR.

Que el tripulante sea capaz de:

x Explicar el Panel de Control Principal (PMP).


x Explicar el Panel de Control de JV (PC JV)
x Saber manejar lo que controlan.
x Manejar el BITE

La tarea se considerará correctamente realizada si se obtiene el 80% de aciertos en


los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. PANEL DE CONTROL PRINCIPAL.

El Panel de Control Principal permite accionar diversos sistemas y presenta la


información sobre el status de distintos elementos y sistemas.

2-489
)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

Nº DENOMINACIÓN FUNCIÓN
1 Indicador ZONA INTER Se ilumina cuando la torre se encuentra entre las 4 y
DIREC las 8 y entre las 10 y las 12, indicando que está en una
de las zonas donde por debajo de un determinado
ángulo de depresión del cañón puede interferir con el
casco.
2 Interruptor ANULAR Inhibir seguridad con escotillas abiertas. Al ponerlo en
SEG ESCT ON (bajo la responsabilidad del JV), el indicador
ESCOT ABIER deberá parpadear y la lógica del
sistema ignorará el hecho de que esté abierta alguna
escotilla.
3 Indicador ESCOT Indicar que está abierta alguna de las tres escotillas del
ABIER casco o las puertas correderas de la protección de la
torre. Cuando se enciende, el sistema de armas se
pone en SEGURO y se desconectarán el sistema de
servos y la estabilización. Parpadea si el interruptor
ANULAR SEG ESCT está en ON.
4 Interruptor general Conectar la alimentación de energía eléctrica a la torre
TORRE ON/OFF con dos posiciones:
ON: Tirando hacia afuera
OFF: Presionando

2-490
)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

Nº DENOMINACIÓN FUNCIÓN

5 Pulsador de Ajustar la deriva de la estabilización.


compensación de deriva
(COMP.DERI.).
6 Toma de corriente. Permitir la conexión de accesorios auxiliares a 24 V cc.

7 Pulsador/indicador Conectar (presionándolo) el sistema de rearme del


REAR SERV cierre del cañón cuando exista una interrupción o
avería en el cañón. Se ilumina en “rojo”.

8 Pulsador BIT PROX. Si la pantalla 12 está apagada: orden para presentar


el menú del BITE.
Si se está ejecutando alguno de los test: orden para
presentar el siguiente mensaje.

9 Pulsador/indicador Conectar (presionándolo) el sistema de armado de


REAR NORM cierre del cañón. Se ilumina en “verde”.
10 Pulsador DESCON Apagar (presionándolo), las luces de los paneles, y las
LUCES luces de torre y casco. Su función es semejante al que
dispone el JUT.
11 Pulsador BIT SELEC. Ejecutar el mensaje presentado en la pantalla 12.

2-491
)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

Nº DENOMINACIÓN FUNCIÓN
12 Pantalla de información. Presentar mensaje de integridad del sistema durante
la ejecución del BITE en cualquiera de sus
modalidades.
13 Pulsador/indicador Cuando se conecta (presionándolo) activa la
ESTAB ON/OFF estabilización de torre y cañón. Inicialmente envía una
señal de petición al sistema de accionamiento y
estabilización y el indicador parpadea (en “ámbar”).
Cuando se recibe la confirmación a la señal, el
indicador luce fijo. Para poder activarse la
estabilización, debe estar en ON el pulsador (15)
SERVO ON/OFF.
14 Indicador TENS BAJA Se ilumina en “rojo” cuando el voltaje baja a 21 V.
Por debajo de 18 V, el indicador parpadea.
Análogamente sucede por encima de 28 y 32 V.
15 Pulsador/indicador Activar (presionándolo) el sistema de accionamiento
SERVO ON/OFF poder mover la torre y el cañón eléctricamente.
Parpadea (en “verde”) y el sistema de servos queda
inhibido, si hay alguna escotilla abierta o error en el
sistema, en cuyo caso se enciende el indicador (18)
ERROR SERVO.

2-492
)LJXUD3DQHOGH&RQWURO3ULQFLSDO  

Nº DENOMINACIÓN FUNCIÓN
16 Indicador ZONA INTER Indicar que la posición de la torre en dirección entra
DEPRE en zona prohibida y que el ángulo de depresión del
cañón es mayor del permitido en esa zona. El
cañón se eleva automáticamente y se interrumpe el
tiro. (se ilumina en “rojo”).
17 Indicador TRINCAS Indicar que la trinca de dirección o de elevación
están puestas y se quiere mover la torre, o cuando
hay algún obstáculo exterior que bloquea el
movimiento en dirección o en elevación del cañón,
(se ilumina en “rojo”). No se enciende con las
trincas puestas
18 Indicador ERROR SERVO Indicar si hay fallos en el sistema de elevación de
cañón y giro de torre, (se ilumina en “rojo”). En este
caso parpadea el pulsador (15) SERVO ON/OFF.
19 Conector. Permitir conectar un ordenador portátil para recibir
información de los distintos sistemas.
20 Reóstato. Regular la intensidad de iluminación de los
indicadores y de la pantalla.

11.2. PANEL DE CONTROL DEL JEFE DE VEHÍCULO.

Permite activar diversas funciones y presenta información de status de diversos


elementos y sistemas.

2-493

)LJXUD3DQHOGH&RQWUROGHDUPDVGHO-HIHGH9HKtFXOR  

Nº DENOMINACIÓN FUNCIÓN
1 Pantalla de información con Avisar al JV de:
los testigos:

POS INC ALIM (rojo). El alimentador del cañón no está bien


posicionado
CIERRE ATRAS (ámbar). El cierre del cañón está en posición retrasada (de
armado).
MG RAF 6 (verde). Seleccionado tiro con AMETRALLADORA a
ráfagas de 6 disparos (aprox).
MG RAF CONT (verde) Seleccionado tiro con AMETRALLADORA en
fuego continuo.
30 MM TT (verde) Seleccionado tiro con CAÑÓN tiro a tiro.
30 MM RAF 3 (verde) Seleccionado CAÑÓN a ráfagas de 3 disparos.
30 MM RAF 5 (verde) Seleccionado CAÑÓN a ráfagas de 5 disparos.
30 MM RAF 10 (verde) Seleccionado CAÑÓN a ráfagas de 10 disparos.

)LJXUD3DQHOGH&RQWUROGHDUPDVGHO-9  

2-494
Nº DENOMINACIÓN FUNCIÓN
2 Selector de la munición de los Programar el tipo de munición de los
cargadores cargadores izquierdo y derecho, con las
ruletas interiores IZQ y DER
3 Pulsador selector de Indicar, al pulsarlo, que la ametralladora se ha
ametralladora (MG 7,62). seleccionado (se ilumina en “ámbar”).
4 Pulsador selector del cañón con Indicar, al pulsarlo, que el cañón se ha
cargador izquierdo (30 C. IZQ). seleccionado para disparar con el cargador
izquierdo (se ilumina en “ámbar”).
5 Pulsador selector del cañón con Indicar, al pulsarlo, que el cañón se ha
cargador derecho (30 C. DER). seleccionado para disparar con el cargador
derecho (se ilumina en “ámbar”).
6 Pulsador de disparo (FUEGO) Permitir, al pulsarlo, el disparo del armamento
(para las dos armas). (se ilumina en “rojo”).
7 Pulsador de seguro (SEGURO) Impedir, al pulsarlo, el disparo del armamento
(para las dos armas). (se ilumina en “verde”).
8 Indicador de final de cinta de Indicar que ha actuado el fin de cinta y es
alimentación (FIN CINTA) (para necesario proceder a la recarga de munición.
las dos armas). Si se pulsa permite tirar hasta el último
disparo, (se ilumina en “rojo” hasta que se
pulsa).

)LJXUD3DQHOGH&RQWUROGHDUPDVGHO-9  

Nº DENOMINACIÓN FUNCIÓN
9 LONG RAFG: Selector del número Variar, al pulsarlo, el número de disparos de
de disparos por ráfaga del cañón y la ráfaga del cañón o de la ametralladora,
de la ametralladora según indicación en la pantalla.
10 Reóstato de brillo. Regular la intensidad de iluminación de los
indicadores y de la pantalla.

2-495
11 Indicador de posición de la torre.
Indicar la posición del cañón con relación al
eje longitudinal del casco del vehículo.
12 AGUA ON/ OFF: Interruptor de Conectar, (mientras se mantiene presionado
bomba de agua de limpieza del en la posición ON), la bomba de agua para
periscopio del JV. limpieza de la ventana del periscopio del JV.
13 Ajuste de brillo. Regular el brillo del retículo del periscopio
del JV.
14 CALEF ON/OFF: Interruptor de Conectar, en posición ON el dispositivo de
antivaho del periscopio del JV calentamiento de la ventana del periscopio
del JV.
15 Interruptor de iluminación. Iluminar el retículo del periscopio del JV.

11.3. BITE.

El BITE (Built-In Test Equipment) está integrado en la Panel de Control Principal y


realiza dos funciones:
 Chequear y mostrar el estado del arma y del sistema de accionamiento y
estabilización
 Controlar permanentemente el funcionamiento del CAN-BUS, dispositivo que
constituye la interfase principal entre el sistema de armas, el sistema de servos
y el computador balístico.
La información se presenta al usuario a través de una pantalla de información con
dos filas de caracteres (Fig. 58.8 nº 3) y mediante dos pulsadores etiquetados con
BIT-PROX (Fig. 58.8 nº 1) y BIT-SELECT (Fig. 58.8 nº 2).

11.3.a. Funcionamiento del BITE.

Cuando se enciende la torre el BITE realiza un autotest. Se ilumina la pantalla de


información durante unos 6 segundos y a continuación se presenta durante 8
segundos el mensaje INICIO CORRECTO.

BIT 4.03 Versión del BIT que corresponda

INICIO CORRECTO

Todos los pixel deberán lucir, detectándose si hay alguno fundido.


Transcurridos los 8 segundos de “INICIO CORRECTO”, el BITE se pondrá en estado
de espera o “por defecto”, apareciendo en las pantallas:

En blanco

Vb = 27.1 (tensión de batería) o NO CONEX

La tensión de baterías la recibe dos veces por segundo, vía CAN BUS desde el
control electrónico de la torre.
Cuando no recibe la señal de tensión, presenta en la línea inferior el mensaje NO
CONEX que avisa de un fallo en el CAN-BUS.
Este es el estado al que retorna el BITE, en todos los casos excepto cuando se
dispara el cañón o cuando se produce una interrupción en el mismo.
2-496
Cuando se apaga la torre, ningún componente del BITE tiene memoria permanente,
y por tanto cualquier mensaje de error que se haya almacenado se perderá.
11.3.a.(1). TIPOS DE TEST

Hay tres tipos de test que pueden realizarse con el BITE


 Test del sistema “TEST-SYS”.
 Test automático “TEST-AUT”.
 Test interactivo “TEST-INT”.

Partiendo del estado de espera del BITE “por defecto” y pulsando el botón de “BIT-
PROX”:
 Pulsando una vez aparece en la pantalla “TEST-SYS”
 Pulsando dos veces aparece en la pantalla “TEST-AUT”
 Pulsando tres veces aparece en la pantalla “TEST-INT”
Partiendo de cualquiera de las tres posiciones pulsadas anteriormente (con el botón
“BIT. PROX”) y pulsando a continuación el botón “BIT. SELEC”, antes de que
transcurran 8 segundos desde que apareció en la pantalla el tipo de test, quedará
seleccionada la comprobación deseada. Caso contrario volverá a BITE en espera o
BITE “por defecto”.
Tanto si partimos de BITE “por defecto” como de “parada de emergencia” y
presionamos cualquiera de los dos botones citados, según opciones, aparecerá:

NOTA
Hay una parada de emergencia cuando se produce una detención del ciclo de
disparo para el armamento seleccionado ocasionada por cualquier tipo de
interrupción.

TEST SYS
TEST-AUT Tipo de TEST seleccionado
TEST-INT

No existe comunicación
NO CONEX
Sólo existe comunicación con el control de armas
— ESTx
Car—
Hay comunicación con control de armas y servos
Car— EST—
(hay que conectar previamente los servos)

11.3.a.(2). TEST DEL SISTEMA

El test del sistema informa del estado en que se encuentra


 El “Sistema de Control del Arma “ y
 El “Sistema de Servos”.
El test del sistema no fuerza a que los sistemas de control estén conectados. La
finalidad del test es informar del estado de los sistemas que estén funcionando en
ese momento y de si se ha producido algún error.
Cuando se selecciona para su ejecución el test del sistema, éste pide información a
los sistemas conectados vía CAN-BUS y escribe un resumen en la pantalla:

NO CONEX
ArmS: OK Control del sistema de armas.
ArmS: 01
2-497
SERVS: Off
SERVS: OK Control del sistema de estabilizado.
SERVS: 02

Sobre el sistema de control de armas la información que puede presentar es:


 Si no hay conexión con el CAN BUS: “NO CONEX”
 Si está conectado y no hay errores: “ArmS: OK
 Si está conectado y se ha producido algún error, el número total de los
mismos: “ArmS: 01” (si sólo se ha producido un error).
Sobre el sistema de control de servos la información que puede presentar es :
 Si no se han conectado los servos: “SERVS: Off”
 Si están conectados y no hay errores: “SERVS: OK”
 Si están conectados y se ha producido algún error, el número total de los
mismos “SERVS:02” (si se han producido dos errores).
Ejemplo: Si aparece el mensaje que se muestra abajo, indica que:

ArmS:01 En el sistema de control de armas se ha producido un error

SERVS: Off El sistema de servos no está encendido

Si (como en el ejemplo anterior) se ha detectado un error, este puede ser


presentado en la pantalla presionando el pulsador de BIT PROX”
Si hubiera habido más errores, cada vez que se pulsa el “BIT PROX” aparecerá el
mensaje de error de una manera cíclica; de forma que cuando termine con los
errores del sistema de control del arma continuará con los errores del sistema de
control de servos.
Si durante 30 segundos no se pulsa nada el BITE, vuelve a su estado por defecto.
Ejemplo de errores:
01. WF05

DAL CNT

En la primera línea aparece el número ordinal del error, seguido del


código del error con la sigla WF para el arma principal, o con la LF
para los servos.
En la línea inferior aparece la abreviatura del error y, pulsando “BIT
SELEC”, va apareciendo un breve mensaje con la descripción del
error. En este caso aparecería: “Doble Alimentador: Fallo en Sensor
Contador”.

NOTA
Ver en el Anexo C de este manual la lista de los códigos y mensajes de errores.

11.3.a.(3). TEST AUTOMÁTICO.

El test automático sirve para comprobar el correcto funcionamiento de los sistemas


de control del arma principal y del sistema de control de servos, por lo tanto deben
estar conectados al CAN-BUS.
2-498
El test automático se realiza siempre sobre el sistema del control del arma y
simultáneamente sobre el sistema de servos, si están encendidos y se tiene
presionado el pulsador de toma de carga de cualquiera de las empuñaduras,
terminando inmediatamente si detecta un error en armas. Para llevarse a cabo, debe
estar en ON el pulsador SERVO (Fig. 58.3).

)LJXUD%,7(

7(67$8720È7,&2'(/&21752/'(/$50$35,1&,3$/

El test automático sólo se puede iniciar cuando el sistema de control del arma está
en su estado por defecto que es el que, por seguridad, se selecciona cuando se
conecta la torre.
Si alguna de esas condiciones no se cumple, el test automático no comienza,
presentando:

FALLO

Mensaje Mensaje que orienta sobre la causa del fallo.

Estos mensajes pueden ser:


 Debe estar en modo SEGURO
 MG debe estar seleccionada
 Sistema de rearme debe estar en posición de reposo
 El cierre no puede estar atrás
 Disparo REMOTO debe estar desconectado
 Error DAL
 Error en Sistema de Rearme
 ESCOTILLAS cerradas o OVERRIDE ON

7(67$8720È7,&2'(/&21752/'(/6,67(0$'(029,0,(1726(592$6,67,'2

Si se quiere realizar este test de control automático del sistema de servos,


cumpliéndose todas las condiciones anteriores, se presionará el pulsador de toma
de carga y a continuación el pulsador de BIT SELEC. Este se interrumpe soltando el
pulsador de toma de carga del mando-empuñadura (continuando sólo con el del
arma).

2-499
PELIGRO
ESTE TEST PUEDE SER PELIGROSO, ESPECIALMENTE CUANDO SE REALIZA
EL TEST DE SERVOS, YA QUE EN SU REALIZACIÓN SE MUEVE LA TORRE Y
EL CAÑÓN. POR ESTA RAZÓN EL TEST PUEDE SER ABORTADO EN
CUALQUIER MOMENTO, PRESIONANDO SIMULTÁNEAMENTE “BIT PROX” Y
“BIT SELEC” O SOLTANDO EL PULSADOR DE TOMA DE CARGA. POR
RAZONES DE SEGURIDAD, CUANDO SE ABORTA EL TEST POR ALGUNA
CAUSA, ES CONVENIENTE APAGAR Y VOLVER A ENCENDER LA TORRE
PARA QUE EL SISTEMA VUELVA A SU ESTADO DE SEGURIDAD.

La torre debe estar situada a las 12 y el cañón a 0º para evitar que el sistema de
servos detecte un error en el giróscopo, que lo único que indicaría sería que los
ángulos a los que se ha movido no eran los predeterminados.
Cuando comienza el test aparece el siguiente mensaje:

CUIDADO!

MOVIENDO

Este mensaje aparece durante dos segundos, durante los cuales si presionamos
simultáneamente los indicadores BIT PROX y BIT SELEC, se aborta
instantáneamente la ejecución del test y aparece el siguiente mensaje:

TEST-AUT

ABORTADO

y el BITE vuelve a su estado por defecto


Durante la ejecución del test, la línea superior de la pantalla informa sobre el estado
del sistema de control del arma, y la inferior sobre el estado del sistema de control
de servos.
11.3.a.(4). TEST INTERACTIVO.

El test interactivo puede usarse tanto para comprobar los mandos del Tirador como
los del JV, así como para comprobar todas las entradas digitales (sensores y
actuadores).
Cuando el test interactivo comienza, aparece el siguiente mensaje:

TEST-INT

LISTO

Este mensaje indica que el test ya ha comenzado, por lo que a partir de este
momento cualquier señal (procedente de los sensores y actuadores) se presentará
2-500
en la pantalla, pero si durante los primeros 30 segundos no recibe información, el
test terminará volviendo el BITE a su estado “por defecto”.
Un ejemplo de mensaje puede ser:

TIR PAL n

SUCESO 1

Este mensaje indicaría que se ha pulsado el pulsador de toma de carga del Tirador.
Por tanto el siguiente mensaje (cuando se suelte la empuñadura) sería:

TIR PAL p

SUCESO 2

Donde la flecha hacia arriba indica que se ha activado la entrada (el


sensor) y hacia abajo indica su desactivación.
La fila inferior indica el número del suceso almacenado, que cuando
llega a 25 parpadea para indicar que el buffer está lleno. Presionando
el BIT SELEC se borra el buffer, se reinicializa el test y aparece el
mensaje TEST-INT / LISTO.
Presionando el botón de BIT PROX, irán apareciendo secuencialmente todos los
datos almacenados en el buffer, con mensajes como el siguiente:

TIR PAL

1 DE 2

Que nos indica que es el primer mensaje de los 2 almacenados en el


buffer y que se refiere al sensor del pulsador de toma de carga del
Tirador.
A las empuñaduras del JV y del Tirador se les ha dado un tratamiento especial.
Si el pulsador de toma de carga se mantiene presionado durante 3 segundos y el
sistema de estabilización está conectado, entonces el Test Interactivo indicará la
dirección del movimiento de la empuñadura.
Ejemplos:

EMPUÑAD EMPUÑAD

COMAN o TIRAD m

Donde la flecha indica la dirección en que se ha movido la


empuñadura (una de las ocho posibles).

2-501
El BITE, vuelve a presentar los sucesos referentes a sensores y actuadores, tan
pronto como se dejen de presionar las empuñaduras. Los movimientos de las
empuñaduras no se almacenan en el buffer.
En el ANEXO C: MENSAJES DEL BITE, aparecen los errores, mensajes y entradas
del test interactivo, agrupados en tres Cuadros con el siguiente contenido:
 Cuadro 1: Resumen de errores en Test Automático y Test del Sistema.
 Cuadro 2: Mensajes durante el Test Automático.
 Cuadro 3: Entradas en el Test Interactivo.
11.3.a.(5). MENSAJES EN PANTALLA TRAS DISPARAR EL CAÑÓN

Después de hacer uso del arma principal (cañón MK 30-2) bien satisfactoriamente,
bien con interrupción, en la pantalla se presentan los siguientes mensajes:
 Disparando en ráfaga el control electrónico de la torre envía al BITE:
o El número de disparos efectuado sobre lo programado.
o La cadencia de la ráfaga (disparos/minuto)
Por ejemplo:

10/10 DIS

693 CAD

 Disparando tiro a tiro, el BITE no recibe cadencia:

Un DIS

-----------

En caso de producirse una parada de emergencia se interrumpe la ráfaga


programada y el BITE informa sobre ello a la vez que presenta el mensaje:

EMERG-30

!!!!!!

En caso de interrupción de una ráfaga programada, el BITE informa del número de


disparos realizados en comparación con lo programado, y de su cadencia:
Por ejemplo:

7/10 DIS

693 CAD

2-502
En caso de interrupción cuando se dispara tiro a tiro, el BITE presenta:

No DISP

-----------

12. RESUMEN.

a. El Panel de Control Principal controla la entrada general de corriente a la torre, el


movimiento en eléctrico y en estabilización, el test de la torre, y el rearme del cañón.

b. Para la realización de lo anterior lleva:


x Indicador de zona de interferencia.
x Interruptor de anulación de escotillas.
x Indicador de escotillas abiertas.
x Interruptor general.
x Pulsador de compensación de deriva.
x Toma de corriente.
x Pulsador de armado de emergencia.
x Pulsador de armado normal.
x Pulsador BIT-PROX.
x Pulsador de oscurecimiento.
x Pulsador BIT-SELEC.
x Pantalla de información.
x Pulsador de estabilización.
x Indicador de baja tensión.
x Pulsador de movimiento.
x Indicador de zona de autoelevación.
x Indicador de bloqueo.
x Indicador de fallo en servos.
x Conector.
x Reóstato.

c. El Panel de Control del Jefe de Vehículo, controla principalmente la elección del


armamento, la ráfaga, selección de munición en cargadores e incluso dispone de
información de torre con respecto a barcaza.

d. Para la realización de lo anterior lleva:


x Pantalla de información con los testigos.
x Selector de la munición de los cargadores.
x Pulsador selector de la ametralladora.
x Pulsador selector cargador izquierdo.
x Pulsador selector cargador derecho.
x Pulsador de disparo.
x Pulsador de seguro.
2-503
FICHA DE TAREA

1. CÓDIGO. 612-400-059.

2. DESCRIPCIÓN. SISTEMAS DE ALUMBRADO, DE VENTILACIÓN Y CONTADOR


DE DISPAROS.

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Práctica. VCI/C Pizarro. Práctica: 15-20 min./alumno
7. AYUDAS A LA INSTRUCCIÓN.
VCI/C Pizarro.

8. BIBLIOGRAFÍA.

MT6-021. Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

La ficha se desarrollará en una sola sesión práctica. Los tripulantes se dividirán en


grupos de no más de cinco y la sesión comenzara con una exposición breve por
parte del instructor.

10. REQUISITOS A ALCANZAR.

Que el JV sea capaz de manejar correctamente:

x El alumbrado de la torre.
x Conozca el funcionamiento de ventilación de la misma.
x Localice y sepa la función del Contador de cierre atrás.

La tarea se considerará correctamente realizada si se obtiene el 80% de aciertos en


los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. ELEMENTOS DEL ALUMBRADO.

La torre dispone de los siguientes elementos de iluminación:


 Tres lámparas de iluminación en la cámara de armas (Fig. 59.1. nº 1) con sus
correspondientes interruptores (Fig. 59.3. nº 1).
 Tres plafones de iluminación en la cámara de combate (Fig. 59.1. nº 2)
(iguales a los del casco).
 Una lámpara de iluminación del cargador derecho (Fig. 59.2. nº 2).
 Luz rotativa acoplable al mástil (Fig. 59.2. nº 1), ya descrita ficha 612-400-031
de este manual.

2-509
 Caja de interruptores (Fig. 59.1. nº 3) para la luz giratoria, general para la
cámara de armas y la lámpara del cargador derecho del cañón (Ver detalle
Fig. 59.4).

)LJXUD(OHPHQWRVGHLOXPLQDFLyQGHODWRUUH  

)LJXUD(OHPHQWRVGHLOXPLQDFLyQGHODWRUUH  

)LJXUD/iPSDUDFiPDUDGHDUPDV
2-510
)LJXUD&DMDGHLQWHUUXSWRUHVOXFHVWRUUH

11.2. SISTEMA DE VENTILACIÓN DE LA TORRE.

El sistema de ventilación de la torre es independiente del SCCA y su función es


ventilar la cámara de armas de los gases producidos por los disparos del cañón o la
ametralladora.

11.2.a. Ventiladores de extracción de aire.

)LJXUD6LVWHPDGHYHQWLODFLyQGHODFiPDUDGHDUPDV

2-511
Está compuesto por dos extractores de aire (Fig. 59.5. nº 1) que succionan los gases
procedentes del disparo evacuándolos por las dos salidas (Fig. 59.5. nº 2).
Al presionar el pulsador FUEGO, se conectan
automáticamente. Al presionar el pulsador
SEGURO después del último disparo, los
extractores continuarán funcionando durante 2
minutos, para garantizar la evacuación total de
gases. Si no se ha realizado tiro con las armas, al
presionar SEGURO, los extractores se detendrán
inmediatamente.
En caso de fallo del sistema se inhibe el disparo,
por lo que se dispone de un interruptor de
ANULACIÓN INHIBICIÓN TIRO (override) (Fig.
59.6. nº 1) situado en un lateral de la Unidad de
Control Electrónico de la torre (ver ficha 612-400-
040 de este manual) que anula la inhibición en
caso de necesidad. Se trata de un interruptor de )LJXUD,QWHUUXSWRU
dos posiciones protegido por una caperuza roja $18/$&,Ï1,1+,%,&,Ï17,52
de seguridad y un precinto de plomo. En caso de RYHUULGH 
uso, el precinto deberá ser sustituido.

11.2.b. Válvula automática de sobrepresión.

Descrita en la ficha 612-400-038 de este manual.

11.3. POSICIÓN DE CIERRE ATRÁS (Fig. 59.7. nº 3).

Dentro de los sensores pertenecientes a los sistemas periféricos del cañón, existe
un sensor de Posición de cierre atrás, su función es indicarnos la situación del
cierre y contabiliza el número de veces que el cierre va hacia atrás, debe quedar
claro que NO es un contador de disparos. Su función real es contabilizar las veces
que el cierre va hasta atrás. Por lo que se efectué un disparo o no, contabilizara
cada vez que el cierre llegue a la altura de dicho sensor (ver ficha 612-400-054 de
este manual).

Figura 59.7. Sensor de cierre atrás.

12. RESUMEN.
2-512
FICHA DE TAREA.

1. CÓDIGO: 612-400-060.

2. DESCRIPCIÓN: INTERFONÍA (I).

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico – Práctica. Aula y zona de instrucción. Teoría: 30 minutos.
Práctica: 60 minutos por
operador.
7. AYUDAS A LA INSTRUCCIÓN.
Presentaciones.
8. BIBLIOGRAFÍA.
Manual didáctico del sistema de interfonía ROVIS de la ACINF.

9. CONDICIONES DE EJECUCIÓN.

En aulas y zona de instrucción donde podamos colocar los vehículos y


tripulaciones.

10. REQUISITOS A ALCANZAR.

x Conocer y saber utilizar la MCS y la caja de alimentación MX-4099.


x Saber programar cualquier estación de tripulante desde la MCS.
x Conocer las diferentes conexiones entre cajas y radio.
El apto se establecerá en el 80 % de aciertos en los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. SISTEMA INTERFÓNICO ROVIS.

11.1.a. Generalidades.

El sistema ROVIS está compuesto por:

x Caja de control maestro MCS.


x Estación de tripulante FFCS.
x Estación de tripulante con línea FFCS/T.
x Estación de tripulante con datos FFCS/D.
x Estación solo monitor MOS.
x Caja telefónica exterior ITS.
x Terminal interfaz de radio RIT.
x Terminal de radio con interfaz de datos RIT/D.
x Altavoz LS.
x Altavoz CA815.
x Amplificador de megafonía CMA2113.
2-517
x Supresor y distribuidor de energía CDSUP.
x Caja de alimentación MX-4099.

11.1.b. Caja de control maestro (MCS). (Fig. 60.1)

11.1.b.(1) MCS: CONTROLES E INDICADORES. CONECTORES Y TERMINALES MCS.

CONECTOR TERMINAL FUNCIÓN


ESTACIÓN S J6 Conector interconexión BUS (highway): Interfaz
entre la MCS y otras unidades ROVIS en el
sistema.
ESTACIÓN E J7 Conector interconexión BUS (highway): Interfaz
entre la MCS y otras unidades ROVIS en el
sistema.
ALIMENTACIÓN J5 Entrada de alimentación
ALTAVOZ J4 Conector del cable que envía señales audio y
alimentación al altavoz LS.
ALARMAS J3 Conector del cable que proporciona un Interfaz
para las señales de alarma del vehículo.
LÍNEAS TML1 Postecillo del par telefónico para conectar la MCS
o a un Teléfono de campo TA-3122.
LÍNEAS TML2 Postecillo del par telefónico para conectar la MCS
o a un Teléfono de campo TA-3122.
RADIO A J2 Conector del cable a la Radio A.
RADIO B J1 Conector del cable a la Radio B.

)LJ&DMDGHFRQWUROPDHVWUR

11.1.b.(2). CONMUTADOR “SISTEMA” MCS. (Fig.60.2)


2-518
POSICIÓN FUNCIÓN PANTALLA
OFF La alimentación está desconectada de todas las Apagada
unidades ROVIS. Las radios con características de
desconexión también están apagadas.
PROG 1 El sistema está programado con el acceso radio P1
almacenado en este programa (Prog 1).
PROG 2 El sistema está programado con el acceso radio P2
almacenado en este programa (Prog 2).
PROG 3 El sistema está programado con el acceso radio P3
almacenado en este programa (Prog 3).
SILENCIO El sistema esté programado para impedir a los LS
RADIO tripulantes que transmitan a través de las radios.
P.ej.: se impone silencio radio (solo escucha).
TODOS Los tripulantes tienen acceso total (Rx/Tx) a todas ALL
las radios de a bordo.

)LJ&RQPXWDGRUVLVWHPD

11.1.b.(3) CONMUTADOR “PROGRAMA” MCS. (Fig. 60.3)

POSICIÓN FUNCIÓN PANTALLA


Posición de funcionamiento normal. El sistema ROVIS
funcionará de acuerdo con los niveles de acceso radio
SISTEMA P1, P2, P3
almacenados del programa seleccionado (PROG 1,
PROG 2 o PROG 3)

2-519
El usuario de la MCS puede examinar el nivel de
acceso radio permitido a cada tripulante en el
MOSTRAR programa seleccionado cuando la pantalla “se pasea” Varias
a través de cada posición almacenada.
En esta posición, presionando el pulsador CAMBIAR,
ESTACIÓN desplaza la pantalla a través de los números de 1,2,3,4,5,6
identificación de la estación de tripulante.

En esta posición, presionando el pulsador CAMBIAR,


RADIO desplaza la pantalla a través de los números de A,B,C,D,E,F
identificación de la estación de radio (A a F).
En esta posición, presionando el pulsador CAMBIAR,
desplaza la pantalla a través de los tres niveles de
acceso radio:
FUNCIÓN
a. No acceso --
b. Sólo Recibir r.
c. Recibir y Transmitir rt
Almacena el programa mostrado en la pantalla en la
GUARDAR varias
memoria de la MCS.

)LJ&RQPXWDGRUSURJUDPD

11.1.b.(4). CONMUTADOR “CAMBIAR” MCS. (Fig. 60.3)

En funcionamiento normal, con el conmutador PROGRAMA en la posición


SISTEMA, el pulsador CAMBIAR se utiliza para cancelar o aceptar los mensaje
visualizados del BIT (Built-in- test). Cuando el conmutador PROGRAMA esté en las
posiciones ESTACIÓN, RADIO o FUNCIÓN, se utiliza para desplazarse a través de
las cajas de tripulante, radios o funciones respectivamente. El pulsador CAMBIAR
2-520
puede ser utilizado también para alterar el nivel de brillo de la pantalla cuando el
conmutador PROGRAMA está en la posición SISTEMA y no hay mensajes de BIT
en la pantalla. Hay disponibles tres niveles de brillo: (i) Brillo fuerte para el uso
durante el día, (ii) Poco brillo para el uso dentro de vehículos oscuros y gafas de
visión nocturna, y (iii) Pantalla apagada. Si se produce un error del sistema o si el
comandante comienza a programar el sistema, la pantalla (LED) vuelve
automáticamente a la posición de Poco brillo.

11.1.b.(5). CONMUTADOR “ALTAVOZ” MCS. (Fig.60.4)

Este conmutador determina la salida de audio al conector del altavoz del MCS. En la
posición OFF, no se produce ninguna señal en un altavoz conectado. En la posición
INT, todas las señales del intercomunicador o de prioridad del intercomunicador
(O/R) son enviadas al altavoz. En la posición RADIO, el altavoz reproduce las
señales recibidas de todas las radios conectadas además de las señales prioritarias
del Intercomunicador (O/R).

)LJ&RQPXWDGRUDOWDYR]

11.1.b.(6). INTERRUPTOR “LÍNEA” MCS. (Fig. 60.5)

En la posición OFF del interruptor se anula la capacidad de transmisión por el par


telefónico, aunque las señales que se reciben pueden ser oídas. En la posición ON
del interruptor LÍNEA se permite la transmisión y recepción por el par telefónico.

2-521
)LJ,QWHUUXSWRU/tQHD

11.1.b.(7). INTERRUPTOR “INTENS” MCS. (Fig. 60.5)

Con el interruptor INTENS (acentuación) en la posición ON, se intensifica el canal de


intercomunicador con respecto a las señales de alarma del vehículo o recepción
radio, cuando haya una señal prioritaria del intercomunicador (O/R). Esto se
consigue, cuando existe una señal prioritaria del intercomunicador, reduciendo el
volumen de las señales de alarma del vehículo en 6 dB (mitad) y de las señales de
recepción radio en 20 dB (en diez veces). Con el interruptor INTENS en la posición
OFF, la presencia de una señal prioritaria del intercomunicador no tiene efecto en los
volúmenes del intercomunicador, radio y señales de alarma del vehículo. (Fig. 60.6)

)LJ3RVLFLRQHVLQWHUUXSWRU³,QWHQV´

11.1.b.(8). PANTALLAS E INDICADORES DE LA MCS. (Fig. 60.7.).

El circuito asociado a los dos indicadores LED de Fallo de Alimentación, situados a


los largo del borde superior de la pantalla de la MCS, comprueba la corriente
entregada a los circuitos de alimentación de la MCS.

El LED SYS se ilumina cuando hay un consumo excesivo en el circuito de


alimentación del sistema. El circuito de alimentación del sistema proporciona la
alimentación a la electrónica de la MCS y a través del cable de interconexión BUS a
todos los componentes restantes del ROVIS (FFCS, RIT, etc. ).

2-522
El LED ANR se ilumina cuando hay un consumo excesivo de corriente en el circuito
de alimentación del sistema de reducción activa de ruido. Éste proporciona la
alimentación estabilizada al circuito ANR que equipan los auriculares y la unidad
ITS.

La pantalla alfanumérica de la MCS tiene dos tareas principales. Muestra el modo de


funcionamiento seleccionado y el estado del sistema, determinado en el BIT, y
también guía al operador cuando se hacen cambios en los programas de acceso
radio: P1,P2 y P3. Toda la información se suministra en formato abreviado, de fácil
entendimiento, indicando las cajas de tripulante con el número de identificación
(1,2,3,4,5 y 6) y la letra de identificación de las radios (A,B,C,D,E y F).

)LJ3DQWDOODHLQGLFDGRUHVGHOD0&6

11.1.c. Caja de alimentación MX-4099. (Fig. 60.8)

x Destinada a ser utilizada en instalaciones vehiculares.


x Conectada a la Batería, distribuye la alimentación al resto del sistema.
x Tiene sistemas de protección contra sobretensiones de tipo electrónico,
circuito impreso, y eléctricos, con fusibles semi-lentos.
x Dispone de un sistema de Prueba de circuitos.

2-523
)LJ&DMDGHDOLPHQWDFLyQ0;

12. RESUMEN.

En esta ficha se describen los pasos a seguir para la puesta en funcionamiento de


la MX-4099 y de la MCS y programación de las estaciones de tripulante desde la
misma, por lo tanto no se considera necesario realizar un resumen de los mismos.

13. PRÁCTICAS.

13.1. SITUACIÓN INICIAL.

Caja de alimentación MX-4099 apagada.


MCS apagada (Sistema:Off, Programa: Sistema, Altavoz: Off, Línea: Off, Intens:
Off)

13.2. ACCIONES A REALIZAR.

Identificar las distintas conexiones de la MX-4099


Encender la caja de alimentación MX-4099
Poner interruptor en “on prueba”
Poner interruptor en test.
Identificar todas las conexiones y terminales de la MCS.
Identificar controles e indicadores de la MCS.
Encender la MCS.
Hacer funcionar los diferentes conmutadores de la MCS.
Realizar una programación completa de una estación de tripulante.
2-524
FICHA DE TAREA.

1. CÓDIGO: 612-400-061.

2. DESCRIPCIÓN: INTERFONÍA (II).

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico – Práctica. Aula y zona de instrucción. Teoría: 30 minutos.
Práctica: 60 minutos por
operador del sistema.
7. AYUDAS A LA INSTRUCCIÓN.
Presentaciones.
8. BIBLIOGRAFÍA.
Manual didáctico del sistema de interfonía ROVIS de la ACINF.

9. CONDICIONES DE EJECUCIÓN.

Aula y zona de instrucción donde podamos colocar los vehículos con sistema ROVIS
y tripulaciones.

10. REQUISITOS A ALCANZAR.

Conocer y saber utilizar las distintas cajas de tripulante FFCS.


El apto se establecerá en el 80 % de aciertos en los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. SISTEMA INTERFÓNICO ROVIS.

11.1.a. FFCS: Indicadores y controles (Cajetín de tirador). (Fig. 61.1)

Función y conectores de la FFCS.

CONECTOR TERMINAL FUNCIÓN


ESTACIÓN E J1 Conector del cable interconexión BUS (“highway”):
Interfaz a otras unidades ROVIS en el sistema.
ESTACIÓN I J4 Conector del cable interconexión BUS (“highway”):
Interfaz a otras unidades ROVIS en el sistema.
AURICULARES J2 Interfaz audio desde la FFCS a unos auriculares,
microteléfono o amplificador de altavoz.
PTT VEHÍCULO J3 Permite la conexión de los interruptores Push-to-
talk (PTT)del vehículo.
CUBIERTA La cubierta del interruptor protege el conmutador
de número de identificación de la estación de
tripulante (establecida durante la instalación).

2-529
)LJ))&6FDMHWtQGHOWLUDGRU


11.1.b. Ajuste del Número de Identificación de la FFCS. (Fig. 61.1)

Normalmente, el número de identificación de la FFCS se establecerá durante la


instalación. La cubierta se debe retirar girándola en sentido contrario a las agujas del
reloj. Entonces, usando un destornillador pequeño, se girará el conmutador
totalmente en sentido contrario a las agujas del reloj. Esta es la posición para la
FFCS número 1. Cada vuelta de “clic” del interruptor en el sentido de las agujas del
reloj aumenta el número de identificación de la FFCS por uno. Por ejemplo, después
de girar totalmente en sentido contrario a las agujas del reloj a la posición de inicio,
dirigiéndolo en sentido de las agujas del reloj con dos “clics” resultaría que hemos
establecido como número de identificación de la FFCS el número 3 , teniendo en
cuenta que no pueden conectarse al mismo anillo dos o más cajas FFCS con el
mínimo número de identificación. Después de haber establecido el número de
identificación, la cubierta deberá ser colocada de nuevo y apretarse a mano.

11.1.c. Control de volumen de la FFCS. (Fig. 61.1)

El control de volumen ajusta el volumen del audio oído a través del auricular o de
cualquier otro accesorio de audio conectado a la FFCS. Para reducir el volumen, el
2-530
tripulante debe girar en el sentido contrario al de las agujas del reloj y para aumentar
el volumen, en sentido opuesto. Existen tres zonas de color codificadas, separadas,
utilizadas para indicar los niveles de escucha de seguro a peligroso. Condiciones de
funcionamiento normal requerirían que el tripulante estuviera colocado al final de la
zona VERDE; un volumen mayor se daría en las zonas AMARILLA y ROJA. Un uso
continuo en la zona ROJA debería evitarse cuando se utilicen los auriculares ya que
en algunos casos la intensidad sonora puede superar los límites del oído humano.

11.1.d Conmutador SELECTOR FFCS. (Fig. 61.1)

Este conmutador se utiliza para seleccionar el canal de trabajo para voz (el utilizado
para transmitir y recibir señales de audio). La posición INT selecciona el
intercomunicador como canal en función. Se puede seleccionar una radio individual
(identificada con la letra de la A la F) como el canal de voz en función en las
posiciones A, B, C, D, E y F respectivamente. La posición INT permite siempre el
acceso del tripulante al canal de intercomunicación, mientras que el nivel de acceso
a cada radio es definido por el modo de funcionamiento y programación de la Caja
de Control Maestro (MCS).
Para transmitir en el canal de en función, el usuario debe pulsar se conmutador PTT
radio. Éste puede estar localizado en el casco izquierdo de sus auriculares, como
una caja incorporada en el cable “Bailout” de los auriculares, a un lado del equipo, o
en un interruptor de pie o de mano situado en el vehículo.

11.1.e. Conmutador MONITOR FFCS. (Fig. 61.1)

Este conmutador se utiliza para seleccionar la radio de escucha. Esto permite al


tripulante recibir otra radio además de la radio seleccionada por el conmutador
SELECTOR.
Si el conmutador MONITOR está situado en la posición SEL, no se escucha ninguna
radio extra, la recepción está limitada al canal en función. En las posiciones A, B, C,
D, E y F, el tripulante puede escuchar por una radio (conmutador MONITOR)
mientras que está funcionando (transmitir y recibir) por otra radio (conmutador
SELECTOR). Con el conmutador MONITOR en la posición TODO, el tripulante
puede escuchar todas las radios mientras que está trabajando con una radio
particular (seleccionada con el conmutador SELECTOR).
La recepción de MONITOR está sujeta al modo de operación de la MCS y, si existe
en Prog 1, Prog 2 o Prog 3, y al programa de acceso radio.
En un sistema con más de 2 ó 3 radios, si se utiliza la posición TODO se puede
llegar a sobrecargar el tráfico de voz. Sin embargo si lo usamos en conjunto con la
MCS el acceso a las radios viene programado y cada estación de tripulante tendrá
unos accesos limitados.

11.1.f. Conmutador INTERCOM FFCS. (Fig. 61.1)

Cuando el conmutador está situado en la posición PTT (push-to-talk), el tripulante


debe situar el conmutador SELECTOR en la posición INT para recibir a través del
intercomunicador, y accionar el interruptor PTT situado en el casco, el del cable de
los auriculares o el interruptor PTT del vehículo para transmitir por el
Intercomunicador. Si no se pulsa ningún interruptor PTT, se reciben tanto en
Intercomunicador como cualquier radio que esté seleccionada. La recepción de las
radios está condicionada a la programación y al modo de operación de la MCS.

2-531
El tener seleccionada esta posición en el conmutador permite al operador de la
FFCS no escuchar el Intercomunicador, no tener en cuenta el Intercomunicador.
Cuando el conmutador INTERCOM se coloca en la posición PTT, con el conmutador
SELECTOR en una de las posiciones radio (A-F), el tripulante ya no escucha el
Intercomunicador, pero sí puede escuchar las radios seleccionadas mediante los
conmutadores SELECTOR y MONITOR. Esta posibilidad es útil para radio
operadores que necesiten escuchar atentamente una serie de radios y no quieran
ser distraídos por las comunicaciones rutinarias entre los tripulantes.

En la posición ACTIV el tripulante puede hablar directamente por el micrófono,


puesto que transmitirá permanentemente sin necesidad de pulsar ningún PTT.

En la posición VOX se activa el micrófono de los tripulantes automáticamente cada


vez que se habla delante de él. Se reduce el ruido de ambiente.

En la posición O/R se permite la comunicación prioritaria de una situación de


emergencia. Debe mantenerse sujeta mientras se habla.

12. RESUMEN.

En esta ficha se describen los pasos a seguir para la puesta en funcionamiento y


manejo de las cajas de tripulante FFCS, por lo tanto no se considera necesario
realizar un resumen de los mismos.

13. PRÁCTICAS.

13.1. SITUACIÓN INICIAL.

Caja de alimentación MX-4099 encendida.


MCS encendida.
MCS con estaciones FFCS programadas.
Radio PR-4G instalada.

13.2. ACCIONES A REALIZAR.

Localizar las cajas de tripulante en el VCI y saber diferenciarlas.


Ajustar los números de identificación de las FFCS.
Hacer funcionar los diferentes conmutadores de las FFCS.

13.3. SITUACIÓN FINAL.



Igual que situación inicial.

13.4. ACCIONES PARA RESTITUIR LA SITUACIÓN INICIAL.

No es necesario realizar ninguna acción.


2-532
FICHA DE TAREA.

1. CÓDIGO: 612-400-062.

2. DESCRIPCIÓN: INTERFONÍA (III).

3. IDENTIFICACIÓN.
NIVEL II. Individual. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórico – Práctica. Aula y zona de instrucción. Teoría: 30 minutos.
Práctica: 60 minutos por
operador.
7. AYUDAS A LA INSTRUCCIÓN.
Power Point.
8. BIBLIOGRAFÍA.
Manual didáctico del sistema de interfonía ROVIS de la ACINF

9. CONDICIONES DE EJECUCIÓN.

Aula y zona de instrucción donde podamos colocar los vehículos y tripulaciones.

10. REQUISITOS A ALCANZAR.

Conocer y saber utilizar las distintas cajas de tripulante del sistema ROVIS.
El apto se establecerá en el 80 % de aciertos en los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. SISTEMA INTERFÓNICO ROVIS.

11.1.a. Controles e indicadores FFCS/T con línea telefónica. (Fig. 62.1)

Conectores y funciones de la FFCS/T.

CONECTOR TERMINAL FUNCIÓN


ESTACIÓN S J1 Conector del cable interconexión BUS (“highway”):
Interfaz a otras unidades ROVIS en el sistema.
ESTACIÓN E J4 Conector del cable interconexión BUS (“highway”):
Interfaz a otras unidades ROVIS en el sistema.
AURICULARES J2 Interfaz audio desde la FFCS a unos auriculares,
microteléfono o altavoz.
PTT VEHÍCULO J3 Permite la conexión de los conmutadores Push-to-
talk (PTT) del vehículo.
TELÉFONO J5 Interfaz del Audio y control desde la FFCS/T a la
Caja Telefónica Exterior o CMA2113.
CUBIERTA La cubierta del interruptor protege el conmutador de
número de identificación de la estación de tripulante
(establecida durante la instalación).
2-535
)LJ&RQWUROHVHLQGLFDGRUHV))&67

11.1.a.(1) AJUSTE DEL NÚMERO DE IDENTIFICACIÓN DE LA FFCS/T.

Normalmente, el número de identificación de la FFCS/T se establecerá durante la


instalación. La cubierta se debe retirar girándola en sentido contrario a las agujas del
reloj. Entonces, usando un destornillador pequeño, se girará el conmutador
totalmente en sentido contrario a las agujas del reloj. Esta es la posición para la
FFCS/T número 1 Cada vuelta de “clic” del interruptor en el sentido de las agujas del
reloj aumenta el número de identificación de la FFCS/T por uno. Por ejemplo,
después de girar totalmente en sentido contrario a las agujas del reloj a la posición
de inicio, dirigiéndolo en sentido de las agujas del reloj con dos “clics” resultaría que
hemos establecido como número de identificación de la FFCS/T el número 3,
teniendo en cuenta que no pueden conectarse al mismo anillo dos o más cajas
FFCS/T con el mínimo número de identificación. Después de haber establecido el
número de identificación, la cubierta deberá ser colocada de nuevo y apretarse a
mano.

11.1.a.(2) CONTROL DE VOLUMEN DE LA FFCS/T. (Fig. 62.1)

Accesorio de audio conectado a la FFCS. Para reducir el volumen, el tripulante debe


girar en el sentido contrario al de las agujas del reloj y para aumentar el volumen, en
sentido opuesto. Existen tres zonas de color codificadas, separadas, utilizadas para
indicar los niveles de escucha de seguro a peligroso.

Condiciones de funcionamiento normal requerirían que el tripulante estuviera


colocado al final dela zona VERDE; un volumen mayor se darían en las zonas
AMARILLA y ROJA. Un uso continuo en la zona ROJA debería evitarse cuando se
utilicen los auriculares ya que en algunos casos la intensidad sonora puede superar
los límites de seguridad del oído humano.

2-536
La manipulación del Control de Volumen de la FFCS/T no tiene ningún efecto en el
volumen del sonido oído en la caja ITS conectada a esta unidad.

11.1.a.(3) CONMUTADOR SELECTOR FFCS/T. (Fig. 62.1)

Este conmutador se utiliza para seleccionar el canal de trabajo (el utilizado para
transmitir y recibir). Si se conecta una ITS a la FFCS/T y se activa mediante el
conmutador de Teléfono de Carro, el canal seleccionado en la FFCS/T es también el
canal de trabajo de la ITS. La posición INT selecciona el intercomunicador como
canal en función. Se puede seleccionar una radio individual (identificada con la letra
de la A a la F) como el canal en función en las posiciones A, B, C, D, E y F
respectivamente. La posición INT permite siempre el acceso del tripulante al canal
de intercomunicación, mientras que el nivel de acceso a cada radio es definido por el
modo de funcionamiento y programación de la Caja de Control Maestro (MCS).

Para transmitir en el canal en función, el usuario debe pulsar su conmutador PTT


radio. Éste puede estar localizado en el casco izquierdo de sus auriculares, como
una caja “Bailout” de los auriculares, a un lado del equipo, o en un interruptor de pie
o de mano en el vehículo.

Análogamente, para transmitir por el canal seleccionado, el usuario de la ITS


conectada debe situar el conmutador PTT en la posición AUTO/RADIO y luego
pulsar el interruptor PTT del casco o del cable de los auriculares.

11.1.a.(4) CONMUTADOR MONITOR FFCS/T. (Fig. 62.1)

Este conmutador se utiliza para seleccionar la radio de escucha. Esto permite al


tripulante recibir otra radio además de la radio seleccionada por el conmutador
SELECTOR.

Si conectamos una caja ITS a la FFCS/T, y la activamos con el conmutador de


Teléfono de Carro, entonces lo que seleccionamos en el conmutador MONITOR de
la FFCS/T, también es lo que queda seleccionado en la ITS.

Si el conmutador MONITOR está situado en la posición SEL no se escucha ninguna


radio extra, la recepción está limitada al canal en función. En las posiciones A, B, C,
D, E y F, el tripulante puede escuchar por una radio (conmutador MONITOR)
mientras que está funcionado (transmitir y recibir) por otra radio (conmutador
SELECTOR). Con el conmutador MONITOR en la posición TODO, el tripulante
puede escuchar todas las radios mientras que está trabajando con una radio en
particular (seleccionada con el conmutador SELECTOR).

La recepción del MONITOR está situada al modo de operación de la MCS y, si


existe en Prog 1, Prog 2 o Prog 3, y al programa de acceso radio.

11.1.a.(5) CONMUTADOR INTERCOM FFCS/T. (Fig. 62.1)

La caja FFCS/T presenta una serie de diferencias respecto al funcionamiento de la


FFCS, que vamos a detallar ahora. Para todo lo demás el funcionamiento de ambas
estaciones es análogo.

2-537
A diferencia de lo que ocurría con la FFCS, el operador de la FFCS/T , no dispone
de la posibilidad de cancelar la escucha del Intercomunicador. Con el conmutador
INTERCOM en la posición de PTT, pero con el conmutador SELECTOR no situado
en la posición INT, el tripulante oye el Intercomunicador del vehículo. De hecho, ya
que la FFCS/T se usa en algunas configuraciones para proporcionar la señal de
audio a las cajas MOS, el Intercomunicador se oye todo el tiempo a no ser que se
pulse algún interruptor PTT con el conmutador SELECTOR situado en una de las
posiciones radio (A-F).

En la posición ACTIV, el usuario de una ITS conectada, transmite a través del


Intercomunicador, siempre que lleve un casco de tripulante.

11.1.a.(6) CONMUTADOR TELEFÓNICO FFCS/T. (Fig.62.2)

Este conmutador se encuentra en el lateral derecho de la caja FFCS/T.

Cuando, el conmutador Telefónico de la caja FFCS/T, está situado en la posición


OFF se evita el acceso del exterior al sistema ROVIS desde la caja Telefónica
Exterior (ITS) o en el caso de estar conectada la caja Amplificadora de Megafonía
(AME) coloca a esta en la posición de apagado evitando que se escuche algo por el
altavoz. Ninguna señal de la FFCS/T tiene salida desde esta unidad. Sin embargo, el
usuario de la ITS puede "llamar" para solicitar acceso pulsando el PTT
intercomunicador. Esto tiene como efecto la iluminación del LED "llamada" en azul y
de la lámpara externa "CALL". Además, si el conmutador INTERCOM de la FFCS/T
está en la posición ACTIV, VOX u O/R, el usuario de la ITS puede hablar en el
intercomunicador mientras que esta "llamando", aunque él no oirá el efecto local.

Cuando, el conmutador Teléfono de Tanque de la caja FFCS/T, este situado en la


posición EXT habilitara el acceso externo al sistema ROVIS desde la ITS o en caso
del Amplificador de Megafonía lo pondrá en la posición ON. Todas las señales oídas
en la FFCS/T también son oídas en la ITS o por los altavoces conectados a la caja
Amplificadora de Megafonía (AME). El LED "CALL" (llamada) azul en la FFCS/T se
ilumina para indicar que el acceso externo está habilitado, pero la lámpara externa
"CALL" permanece apagada. Además de recibir todas las señales recibidas por la
FFCS/T, el usuario de la ITS tiene el acceso de transmisión al intercomunicador y al
canal en función seleccionado en la FFCS/T. Sin embargo las radios seleccionadas
por los conmutadores SELECTOR Y MONITOR permanecen sujetas al modo y la
programación de funcionamiento de la MCS.

)LJ&RQPXWDGRUWHOHIyQLFR))&67

2-538
El operador de la FFCS/T pude "llamar" al operador de la ITS externa girando el
conmutador "Teléfono del Tanque" de la FFCS/T a la posición "CALL" (llamada).
Esto ilumina la lámpara exterior del vehículo y el LED azul "CALL". En la posición
"CALL", el LED azul sólo se ilumina si la lámpara externa se ilumina, facilitando al
operador de la FFCS/T una transmisión positiva y un chequeo de la bombilla de la
lámpara externa.

11.1.b. Teléfono exterior ITS. (Fig. 62.3)

El PIZARRO dispone de un teléfono exterior, situado en la parte posterior de la


barcaza, como sucede en la mayoría de los Carros de Combate, que ofrece la
posibilidad de que personal que no pertenezca a la tripulación del vehículo pueda
comunicarse con la misma a través de la interfonía, o utilizar la radio del vehículo
para comunicarse con el exterior a través del cajetín del conductor.

Otra utilidad fundamental es la de ser el medio de comunicación de la tripulación con


el resto de la Unidad cuando la primera se encuentra fuera del vehículo.

Así pues, los dos elementos fundamentales son: el propio teléfono exterior y un
conmutador situado en el lateral derecho del cajetín del conductor

)LJ7HOpIRQRH[WHULRU,76

11.1.c. Controles e indicadores FFCS/D. (Fig. 62.4)

Conectores y funciones de la FFCS/D.

CONECTOR TERMINAL FUNCIÓN


Conector del cable interconexión BUS (“highway”):
ESTACIÓN S J1
Interfaz a otras unidades ROVIS en el sistema.
Conector del cable interconexión BUS (“highway”):
ESTACIÓN E J4
Interfaz a otras unidades ROVIS en el sistema.

2-539
Interfaz audio desde la FFCS a unos auriculares,
AURICULARES J2
microteléfono o altavoz.
Permite la conexión de los conmutadores Push-to-
PTT VEHÍCULO J3
talk (PTT) del vehículo.
EQUIPO
Interfaz compatible accesorios PR4G Voz y Datos.
TERMINAL J5
(Microteléfono)
DATOS (DTE)
La cubierta del interruptor protege el conmutador
CUBIERTA de número de identificación de la estación de
tripulante (establecida durante la instalación).

)LJ&RQWUROHVHLQGLFDGRUHV))&6'

     )LJ

11.1.d. Casco DH-809. (Figs. 62.6 y 62.7)

Interruptor auricular derecho:


Off – Apagado
ANR (Reducción activa de ruido) No se escucha el ruido ambiente.
TTC (Circuito de sonido directo) Permite escuchar el ruido ambiente.

2-540
)LJ&DVFR'+

)LJ&DVFR'+

12. RESUMEN.

En esta ficha se describen los pasos a seguir para la puesta en funcionamiento y


manejo de las cajas de tripulante FFCS, por lo tanto no se considera necesario
realizar un resumen de los mismos.

2-541
FICHA DE TAREA

1. CÓDIGO: 612-400-068

2. DESCRIPCIÓN: INSTALACIÓN DE LA PR4G V3 EN CONFIGURACIÓN


VEHICULAR

3. IDENTIFICACIÓN
NIVEL II. Individual. Específico.

4. TIPO 5. LUGAR 6. DURACIÓN


Práctica Zona de instrucción 1 HORA

7. AYUDAS A LA INSTRUCCIÓN
Radioteléfono RT-9210.
VCI con bastidor de PR4G V3
Amplificador de potencia ALA-126AP

8. BIBLIOGRAFÍA
Manual técnico Oper. y Manto. 1º y 2º Esc. configuración con RT-9210
MI-500 Manual de Instrucción Radioteléfono PR4G V3

9. CONDICIONES DE EJECUCIÓN.

Los operadores deben en todo momento saber reconocer la configuración vehicular


de la radio, saber instalarla en y tener soltura en el montaje/desmontaje y operación
del equipo. Para ello se dispondrá de estaciones Mercurio 2000 con la actual
configuración en VHF del Ejército de Tierra o en su defecto de vehículos con
configuración vehicular de la RT-9210, esto es, la configuración TRC-9310-4. Es
deseable tener no más de tres alumnos por cada transceptor.

10. REQUISITOS A ALCANZAR.

Montaje y desmontaje de la PR4G v3 en configuración vehicular.

La tarea se considerará correctamente realizada si se obtiene el 100%


de aciertos en los aspectos a evaluar.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. MONTAJE DE LA CONFIGURACIÓN VEHICULAR CON PR4-G V3


Para ello, primero montará la antena vehicular, a continuación instalará el
amplificador ALA126 en el vehículo y por ultimo acoplará el RT-9210 al mismo
según los siguientes pasos:

Instalará la antena de la configuración vehicular sobre la base de la misma en el


exterior del vehículo, asegurándose de que dicha base es funcional, para ello:

2-587
Comprobará que del soporte o base de antena, sale el cable coaxial (o de antena)
que transporta la señal desde la antena hasta el bastidor, en el interior del vehículo.

Si el vehículo dispone de más de una base de antena, localizará la situación


de cada cable de antena en el interior.

Asegurará el amplificador ALA-126AP encima del bastidor específico del vehículo.

)LJXUD$PSOLILFDGRUVREUHHOEDVWLGRUYHKLFXODU

Retirará los tapones de protección del equipo; tanto del RT-9210 como del
amplificador ALA-126AP.

Efectuará el conexionado del amplificador al vehículo por el siguiente orden:

x Conectará la toma de tierra del vehículo al amplificador.


x Conectará el cable de antena del vehículo a la toma de antena inferior del
amplificador.
x Conectará el cable de alimentación del vehículo a la toma de alimentación
del amplificador.

Situará el RT-9210 sobre el ALA126AP, para ello será necesario efectuar las
siguientes operaciones:

x Soltará el obturador de protección de los contactos de alimentación y el del


interfaz de infrarrojos, y los encastrará en los huecos destinados que a tal fin
existen en la carcasa. (a)
x Se asegurará de la presencia de fusibles de recambio.
x Desenroscará los dos tornillos de fijación y soltará las mordazas de
fijación. (b)
x Colocará el emisor receptor sobre el adaptador respetando las guías de
posicionamiento.
2-588
x Empujará el emisor receptor sobre la guía hasta que encuentre el tope
del adaptador.
x Situará las mordazas de fijación sobre el borde del emisor receptor y
revisará los dos tornillos de fijación.
x Apretará alternativamente cada tornillo de fijación hasta que el emisor
receptor quede perfectamente sujeto al adaptador. (c)

)LJXUD&RQH[LyQGHODPSOLILFDGRU

Conectará el cableado entre RT-9210 y ALA126 por el siguiente orden:

x Conectará la Toma de tierra del amplificador al RT.


x Conectará el Cable de antena desde la toma de antena superior de
amplificador hasta la toma de antena del RT.
x Conectará el Cable de alimentación del amplificador al RT.

Conectará el cable de señal GPS a la toma correspondiente del RT-9210.


Conectará el microteléfono.
Pondrá los tapones en aquellos conectores que quedan libres.
Encenderá el equipo pulsando el botón ON/OFF y comprobará que funciona
correctamente.

2-589
)LJXUD&RQILJXUDFLyQYHKLFXODU

11.2. DESMONTAJE DE LA CONFIGURACIÓN VEHICULAR

Apagará el equipo pulsando el botón ON/OFF.


Soltará los cables que unen físicamente la radio y el amplificador.
Retirará la radio del amplificador.
Desenroscará la antena de su base en el exterior del vehículo.
Pondrá los tapones de protección del equipo; tanto de la radio como del
amplificador.
11.3 UBICACIÓN DE LOS COMPONENTES

2-590
FICHA DE TAREA

1. CÓDIGO: 612-400-073.

2. DESCRIPCIÓN: HOMOGENEIZACIÓN.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórica-Práctica Aula y Vehículo. Teoría: 60 minutos.
Práctica: 60 minutos.
7. AYUDAS A LA INSTRUCCIÓN.
VCI/C, Centrador de boca, blanco de homogeneización.
8. BIBLIOGRAFÍA.
MI-017. Manual de Instrucción. Instructor Avanzado de Tiro del VCI/C “Pizarro”

9. CONDICIONES DE EJECUCIÓN.

La parte teórica se llevará a cabo con la tripulación reunida en el aula. La parte


práctica de la homogeneización se llevará a cabo con la tripulación en sus puestos
correspondientes y en un campo de maniobras adecuado para efectuar tiro con el
armamento principal del vehículo.

10. REQUISITOS A ALCANZAR.

Que la tripulación sea capaz de realizar la homogeneización del armamento principal


y de la ametralladora coaxial.
Se considerara que la tripulación ha superado la prueba si obtiene el 100% de
aciertos.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1 CONSIDERACIONES PREVIAS

La homogeneización es el conjunto de operaciones que se realizan para hacer


coincidir en un punto los ejes de las ánimas del cañón y ametralladora coaxial, y los
ejes ópticos de los aparatos de puntería, con objeto de garantizar la precisión del
disparo.
Para el VCI/C PIZARRO la finalidad principal de la homogeneización es conseguir
que los ejes ópticos de la Unidad Visual Láser (UVL) y de la Cámara Térmica (CT),
en el periscopio del tirador, y el P-204P (periscopio del jefe del VCI/C) corten a la
prolongación del eje del cañón a una determinada distancia.
Una precisión de 0,5ºº o menos, en el cañón del VCI/C, ha probado su efectividad.
Esa precisión, en la que la homogeneización juega un papel fundamental, produce
un 60 % de impactos al primer disparo con munición TP-T, a 1200 m., sobre un

3-5
blanco de aproximadamente las dimensiones de un BMP frontal. Esto, que se podría
considerar un nivel moderado de impactos al primer disparo, es un buen porcentaje
para un sistema de armas a menudo considerado para batir zonas.
La homogeneización de la ametralladora coaxial es a menudo considerada como
poco importante, debido a su modo de empleo como arma para batir zonas. No
obstante, en referencia a un arma para batir zonas, es importante distinguir entre la
precisión del visor del arma y la capacidad de esta de realizar un gran volumen de
fuego sobre un área extensa.
Al ser la ametralladora coaxial un arma principalmente ofensiva, es usada para
supresión de posiciones enemigas, reconocimientos por el fuego, pero también para
destruir elementos puntales no blindados, por lo que en estas situaciones necesitan
un alto nivel de precisión en el visor de puntería. Lo que requiere una
homogeneización precisa.
En este capítulo se describe el proceso de homogeneización y otros aspectos
relacionados con la precisión en el tiro.

11.2. GENERALIDADES.

En el VCI/C Pizarro la homogeneización se puede realizar de dos formas, sobre


pancarta a 10 metros del eje de muñones o sobre un blanco a una distancia
determinada.
El primer procedimiento tiene la ventaja de poderse realizar en un espacio reducido,
por lo que se favorece el estacionar el vehículo en un sitio sin inclinación, que la
pancarta se pueda colocar perfectamente horizontal, perpendicular a los elementos
de puntería y a la misma altura que ellos, y que las operaciones se realicen con
mayor rapidez y comodidad. Además favorece el hacerlo por la noche o en
condiciones de visibilidad limitada. Por el contrario, se pueden producir más errores
debidos a la paralaje ojo/pupila a cortas distancias, que con el siguiente método.
La homogeneización sobre un blanco a una distancia determinada puede realizarse
entre los 100 y 3000 metros, aunque se recomienda hacerlo a 1200 por ser el ángulo
de paralaje a esta distancia menor a 0,1ºº. Esta es la comúnmente utilizada en
ejercicios y operaciones.
La revisión y homogeneización de los elementos de puntería se realizará:
– Antes de cada ejercicio de tiro.
– Para realizar o comprobar una puesta a cero.
– Por instalación o sustitución de:
x Conjunto del cañón.
x Tubo del cañón.
x Periscopio del tirador y/o cámara térmica.
x Periscopio del jefe del VCI/C.
x Calculador balístico.
– Después de un ajuste o revisión, en cualquier escalón de mantenimiento, de
los elementos anteriores.
Las condiciones ideales para realizar la homogeneización son las que a continuación
se detallan. Aunque será difícil que se den todas a la vez, resulta evidente que la
homogeneización será más precisa cuantas más de ellas concurran a la hora de
realizarla:
– Vehículo situado en terreno completamente horizontal.
– Blanco de homogeneización a la misma altura que el vehículo y perpendicular
a él.
3-6
– Sol de espaldas, preferentemente a primeras horas de la mañana o al final de
la tarde para evitar el efecto de reverberación sobre la óptica.
– Viento en calma.
– Vehículo parado por su propia inercia, sin aplicar el freno.
– Motor parado. Siempre que sea posible se realizará con el VCI/C conectado
al Grupo Electrógeno (EBITRON).
– Cañón frío (que no se haya disparado con él, en las anteriores ocho horas).
– No apoyarse sobre el cañón.
– Toda la tripulación deberá haber ocupado sus puestos antes de iniciar las
tareas. No realizándose movimientos sobre el VCI/C una vez se comience la
homogeneización.
– La diferencia de temperatura entre la Pancarta de homogeneización y
sus alrededores debe ser tan alta como sea posible.
Si no se dispone de un blanco de homogeneización, se puede usar un blanco
diferente. Este debe presentar una esquina bien marcada, con una línea vertical y
otra horizontal, y claramente visible a través de la cámara térmica.

11.2.a. Señales a utilizar durante el proceso de la homogeneización

El Instructor Avanzado de Tiro indicará al tirador mediante un código de señales


cómo debe mover la torre con los mandos manuales. De tal modo que siempre
habrá un enlace entre ellos a pesar de las perturbaciones que pueda crear el
ambiente alrededor del VCI/C. El tirador verá las señales a través de la ventana 1x
de su periscopio. Las señales a emplear serán (Fig. 73.1):
– Dedo pulgar hacia la derecha: torre a la derecha
– Dedo pulgar hacia la izquierda: torre a la izquierda
– Dedo pulgar hacia arriba: elevar el cañón
– Dedo pulgar hacia abajo: bajar el cañón
– Puño cerrado: detener el movimiento

)LJXUD6HxDOHVDHPSOHDUGXUDQWHODKRPRJHQHL]DFLyQ


11.3. EQUIPO DE HOMOGENEIZACIÓN PARA EL VCI/C PIZARRO

Se incluye en una caja conteniendo todos los elementos necesarios para llevar a
cabo la homogenización.

11.3.a. Descripción del equipo de homogeneización

3-7
La homogeneización se lleva a cabo con el centrador de boca, que es un
instrumento que proyecta ópticamente con precisión, el eje de la boca de fuego
sobre el objetivo.
El dispositivo en su estuche está formado por:
– Un visor acodado de puntería con ocular fijo, retículo con índice central,
colimado según norma MIL-STD 810C.
– Un kit para mantenimiento, que comprende un estuche con una llave Allen, un
librillo de papel para lentes y un pincel.
– Tres lentes frontales de distancia focal 10m, 25m y 40m.
– Una barra calibre para 30 mm
– Una barra calibre para 7,62 mm.
– Un destornillador Phillips.
– Un manual de instrucciones














)LJXUD(VWXFKHFRQHTXLSRGHKRPRJHQHL]DFLyQ

Para operaciones a corta distancia se dispone opcionalmente de lentes frontales


suplementarias para alineaciones a 10, 25 o 40 metros, que se montan frente a la
lente del objetivo.
La barra calibre de 30 mm y la de 7.62 se introducen cada una en su arma hasta el
tope.
Para la limpieza de los elementos ópticos se utilizan el pincel y el papel especial
para lentes del lote de a bordo. El destornillador Phillips se emplea para regular los
tornillos de ajuste que sirven para desplazar el retículo en altura y dirección, éstos se
encuentran protegidos por un anillo que evita el depósito de polvo y que impide
modificaciones involuntarias de la regulación. Si no se cuenta con el equipo
apropiado no tocar estos tornillos, corremos el riesgo de inutilizar el centrador.

11.3.b. Colocación del centrador de boca

La colocación del centrador de boca se realizará siguiendo los siguientes pasos y en


este orden:
– Limpiar el tubo hasta la longitud alcanzada por la barra calibre y engrasar
ligeramente la superficie de apoyo de la barra calibre.
– Introducir el dispositivo de puntería en el tubo hasta que contacte con la boca.
El ocular estará hacia el lado del periscopio del tirador.

3-8

)LJXUD%DUUDFDOLEUHGHPP³FHQWUDGRUGHERFD´










)LJXUD9LVRUDFRGDGRGHO³FHQWUDGRUGHERFD´


– Realizar el test de 180° sólo en caso de que no se tenga constancia de la


colimación del centrador. Al ser este test responsabilidad del Instructor
Avanzado de Tiro, no es objeto de este manual. El procedimiento se detalla
en el Capítulo 3 del MI-017 Manual de Instrucción. Instructor Avanzado de
Tiro del VCI/C “PIZARRO”
El centrador es un elemento de precisión, por lo que cuando se quite, es muy
importante almacenarlo en su caja para evitar golpes.

11.4. PREPARATIVOS PARA LA HOMOGENEIZACIÓN.

Material a utilizar:
x Un centrador de boca.
x Una pancarta de homogeneización de 10 m con su correspondiente soporte, o
un blanco de homogeneización. (Fig. 73.5 y 73.6).
x Una escalera o taburete.

3-9
)LJXUD3DQFDUWDGHKRPRJHQHL]DFLyQDP



)LJXUD%ODQFRGHKRPRJHQHL]DFLyQ

11.4.a. Colocación del blanco de homogeneización

– Colocar la pancarta de homogeneización (Fig. 73.5) a 7,40 metros de la boca


del cañón, en posición vertical y perpendicular a la dirección de tiro. Regular
la altura de la pancarta para que el centro de la cruz correspondiente al eje
del cañón esté a 2,09 metros, y permitir mantener el cañón a cero grados en
elevación cuando esté alineado.
– Para homogeneizar sobre un blanco a una distancia determinada usar
preferentemente el modelo de blanco de la figura 73.6.

11.4.b. Preparativos en la línea de tiro

– Prevenir grandes diferencias de temperaturas entre el cañón y la óptica.


– Evitar, en lo posible, que una parte del VCI/C esté sometida al calor o al frío
mientras que la otra zona permanezca en condiciones distintas.
– Evitar realizar este trabajo mientras se observe reverberación producida por el
aire caliente.
– Durante la homogeneización tener el motor y la calefacción apagados.
– No realizar ningún movimiento sobre el VCI/C durante el proceso de
homogeneización.
– Toda la tripulación ocupará sus puestos tácticos antes de realizar las tareas.
– Girar la torre a las 10 para permitir acceder al centrador de boca sin subirse al
VCI/C.

11.4.c. Preparativos en el vehículo. Misiones de la tripulación

Nº JV T CD Tarea o comprobación
1 X X X Realizar las tareas de mantenimiento previas al tiro.
Limpieza del ánima del cañón y comprobar que no está
2 X X X
dañada.
Situar el VCI/C sobre una superficie horizontal. En oblicuo
3 X X
respecto a la pancarta (Cañón a las 10)
Limpieza de la optica de observación y puntería y ajuste de
4 X X
dioptrías.
3-10
5 X Mantener el VCI/C con el motor parado, sin aplicar frenos.
6 X Quitar trincas de torre y cañón.
7 X Activar el interruptor principal de torre.
8 X Situar la torre a las 10 con movimiento manual.
9 X Encender la DT, UVL y CT.
10 X Hacer la prueba del sistema.
Medir la distancia láser (o introducirla manualmente), apagar
11 X
UVL y retirar llave.

11.5. PROCEDIMIENTO DE HOMOGENEIZACIÓN.

11.5.a. Periscopio del tirador.

– Realizadas las tareas anteriores, el Tirador comprueba que la distancia


introducida en el Calculador Balístico corresponde con la anteriormente
medida. Comprueba que está seleccionado el cañón y activa el pulsador
HOMO (2) en la UCP / CBC que debe iluminarse.
– Coloca el mando “SISTEMA” del PCM / SCT en “HOMO”. En la pantalla
aparecerá el retículo del “CAMPO ESTRECHO”.
– Con el mando de homogeneización de la UCP (Fig. 73.7 nº 1), o los
pulsadores de dirección en el CBC (Fig. 73.8 nº 1), llevar el retículo de la UVL
al centro de la pancarta de homogeneización. Anotar los ángulos de azimut y
elevación que aparecen en pantalla con su signo correspondiente.



)LJXUD8&3\3&0 )DVH,











)LJXUD&%&\6&7 )DVH,,
3-11
– Con el mando homogeneización del PCM/SCT (Fig. 73.7 y 73.8 nº 2) llevar el
retículo de la cámara térmica al centro de la pancarta de homogeneización.
Anotar los ángulos de azimut y elevación que aparecen en pantalla.
– Pasar el mando “SISTEMA” del PCM/SCT a “NORMAL”. Los ángulos de
homogeneización de la CT quedan almacenados en memoria.
– Pulsar ENTER (Fig. 73.7 y 73.8 nº 3) en la UCP / CBC, quedan guardados los
ángulos de homogeneización.
– Para salir del modo homogeneización actuar sobre el pulsador “HOMO” debe
apagarse.

11.5.b. Periscopio del jefe del vehículo P-204P (Fig. 73.9).

– Esta operación puede realizarse simultáneamente a las que realiza el Tirador con
su periscopio.

)LJXUD3HULVFRSLRGHO-9 33  )LJXUD5HWtFXORGHO33

 Con el eje del ánima del cañón apuntando al centro del blanco (o al punto de
homogeneización elegido), actuar sobre los mandos de homogeneización del
retículo, en azimut (2) y elevación (1) hasta que coincida el circulo de
homogeneización con el punto elegido. NOTA: Para desbloquear y poder girar
los mandos, tirar de ellos hacia fuera. (Fig. 73.11).

3-12
)LJXUD0DQGRVGH+RPRJHQHL]DFLyQ

 Una vez que el retículo esté en el punto deseado, soltar el mando, que volverá a
su posición y quedará enclavado, con el fin de que no se pueda girar sin volver a
tirar de él. Los mandos tienen una escala numerada del 1 al 7, que se mueve
independientemente del mecanismo anteriormente descrito.
 Una vez homogeneizado el Periscopio, en elevación y acimut, actuar con los
dedos sobre dicha escala a derecha o izquierda y hacer coincidir la marca (4)
con el índice grabado en el mando (Fig. 73.11).

11.5.c. Homogeneización de la ametralladora coaxial.

 Al igual que los elementos de puntería, la ametralladora coaxial se puede


homogeneizar sobre pancarta a 10 metros o sobre un blanco a una distancia
determinada. En este último caso se recomienda hacerlo a una distancia de 600
metros. Introducir la distancia de tiro en la UCP / CBC.
 La Dirección de Tiro debe estar en modo Homogeneización, para lo cual el
Tirador selecciona la ametralladora y actúa sobre el pulsador HOMO de la UCP /
CBC. Apuntar el retículo de UVL al blanco elegido con los mandos manuales.
 Montar el centrador de boca (Fig. 73.12) en el cañón de la ametralladora con el
visor acodado hacia arriba.
 Realizar las alineaciones en azimut y elevación que se describen a continuación.

3-13
)LJXUD&HQWUDGRUGHERFDFRQYLVRUDFRGDGR

 Alineación en azimut (Fig. 73.13):

ƒ Aflojar el tornillo (1) con una llave allen (2) del nº 6.


ƒ Girar el anillo de azimut (3) en el sentido necesario para alinear la línea vertical del
retículo del periscopio de homogeneización con el punto elegido en el blanco.
ƒ Volver a apretar el tornillo (1) cuando se haya conseguido la alineación.

)LJXUD$OLQHDFLyQHQD]LPXW

 Alineación en elevación (Fig. 73.14):


ƒ Aflojar el tornillo de bloqueo (1) del control de elevación con la llave allen (2) del nº 6.
ƒ Con la misma llave, girar el tornillo de ajuste (3), para alinear la línea horizontal del
retículo de puntería del periscopio de homogeneización con el punto elegido del
blanco. Girando el tornillo en sentido horario (apretar), desciende la boca de fuego
de la ametralladora; girándolo en sentido contrario (aflojar) la boca de fuego sube.

)LJXUD$OLQHDFLyQHQHOHYDFLyQ


ƒ Volver a apretar a tope el tornillo de bloqueo (1), una vez obtenida la alineación.

3-14
 Finalizada la homogeneización de la ametralladora coaxial volver la dirección de
tiro a su modo NORMAL. Pulsar ENTER y a continuación HOMO. Esta debe
apagarse.






)LJXUD3URFHVRGHDOLQHDFLyQGHODDPHWUDOODGRUD

11.5 d. Homogeneización sobre pancarta a 10 metros.


)LJXUD3URFHVRGHDOLQHDFLyQGHODDPHWUDOODGRUD

 Ejecutar las mismas acciones que para la homogeneización sobre blanco, con las
siguientes salvedades:
x Colocar la pancarta frente a los elementos de puntería y perpendicular a ellos.
x Distancia a la boca del cañón 7,40 metros.
x Altura de la cruz eje del cañón 2,09 metros
x Introducir manualmente la distancia de 1200 metros en la UCP / CBC.
x Apuntar cada uno de los elementos a la cruz correspondiente en la pancarta.

11.6. COMPROBACIÓN DE LA HOMOGENEIZACIÓN DEL TELEMETRO LÁSER

La tripulación puede realizar una comprobación de la homogeneización y,


accesoriamente, comprobar la precisión del telémetro láser. Es necesario disponer
de dos blancos. Uno de ellos a una distancia de 500m y el otro a una distancia,
comprobada de antemano, entre 500 y 1.500m. Ambos blancos deberán estar
verticales y perpendiculares a la línea de tiro.

11.6.a. Comprobación de la homogeneización del telemetro láser

3-15
Para comprobar la homogeneización del láser, llevar a cabo las siguientes
operaciones:
 Situar el VCI/C en una posición horizontal.
 Encender la torre y la UVL.
 Posicionar el conmutador de filtro de seguridad láser en PRINCIPAL.
 Situar un blanco a 500 metros.
 Seleccionar PRIMER ECO. Apuntar el periscopio del tirador al centro del
blanco y medir dos veces la distancia. A continuación, pasar a ÚLTIMO ECO
y volver a realizar dos disparos al centro del blanco. La distancia no debe
diferir más de ± 10 metros.
 Apuntando sucesivamente sobre las cuatros esquinas del blanco (el centro
del retículo no debe sobresalir fuera de los bordes durante esta operación),
medir la distancia láser dos veces sobre cada uno de estos puntos (el tiempo
de espera entre disparos debe ser de 10 segundos) Los indicadores de ecos
múltiples no deben aparecer, y la distancia, respecto a la primera medición al
centro del blanco, no debe diferenciarse más de ± 10 metros.

)LJXUD&RPSUREDFLyQGHODKRPRJHQHL]DFLyQGHOOiVHU

 Seleccionar PRIMER ECO. Apuntar a la parte superior del blanco de manera
que la mitad del centro del retículo sobresalga por encima del blanco. Medir
dos veces la distancia. Deben aparecer los puntos de ecos múltiples en el
display del ocular del periscopio (el blanco no se debe recortar contra el cielo)
y se debería reflejar la distancia de 500 metros ( ± 10 metros)
 Seleccionar ÚLTIMO ECO y repetir las mediciones del punto anterior. Deben
aparecer los puntos de ecos múltiples en el display del ocular del periscopio y
la distancia medida debería ser superior a la del punto anterior.
Si alguna condición de las mencionadas anteriormente no se cumple, debe
comunicarse al 2º escalón.

11.6.b. Comprobación de la precisión del láser

Apuntando la UVL al centro del blanco situado a una distancia comprendida entre los
500 y los 1.500 metros, medir al menos cinco veces la distancia y comprobar en el
display del ocular que la desviación de las medidas realizadas no se diferencia en
más de ±10 metros de la distancia real. De no ser así, realizar otros 5 disparos más
y si los errores persisten, comunicarlo al 2º escalón de mantenimiento.
La tripulación debe anotar en la documentación del VCI/C la fecha en la que se ha
hecho la comprobación del láser.

3-16



)LJXUD&RPSUREDFLyQGHODSUHFLVLyQGHOOiVHU

11.7. COMPROBACIÓN DE HOLGURAS EN EL VARILLAJE BALÍSTICO.

La holgura (Backlash) en el varillaje balístico, y entre este y la cuna o el espejo de la


cabeza del periscopio, se produce por un defectuoso enlace entre los diferentes
elementos de conexión.
La consecuencia final de esta holgura es la imprecisión del sistema de armas.

11.7.a. Procedimiento de comprobación (Fig. 73.19).

1 2 3 4

5 6 7 8

)LJXUD&RPSUREDFLyQGHKROJXUDV

1. Llevar la línea de tiro (eje del ánima del cañón) al centro de la pancarta, o al
punto designado. Usar el centrador de boca.
3-17
2. Poner en modo homogeneización la DT. La línea de mira (retículo de la UVL)
debe coincidir en el centro del blanco, si no es así, usar el mando de
homogeneización para llevarlo.
3. Con el mando manual de movimiento, deprimir el cañón hasta -10º.
4. Subir el cañón, con mando manual, hasta que la línea de mira vuelva a estar
centrado en la pancarta.
5. Comprobar con el visor del centrador de boca que la línea de tiro coincide con
el centro del blanco. Si no fuese así valorar la diferencia.
6. Con el mando manual de elevación, llevar el cañón hasta + 50º.
7. Bajar el cañón hasta que la línea de mira quede de nuevo centrado en la
pancarta.
8. Comprobar con el visor del centrador de boca que la línea de tiro coincide con
el centro del blanco. Si no fuese así valorar la diferencia.
Esta misma comprobación deberá realizarse con el periscopio P-204P para
comprobar si existe holgura en su varillaje balístico y determinar el error
correspondiente.
Si se detecta una holgura superior a las 2ºº el sistema debe ser revisado y ajustado
por la unidad de mantenimiento.

11.7.b. Efectos de la holgura

Normalmente la holgura produce un error de posición angular entre la línea de mira y


la línea de tiro cuando el movimiento se finaliza hacia abajo. De ahí que se haya
determinado que en la homogeneización el movimiento se finalice de abajo hacia
arriba.
La dirección del movimiento final al homogeneizar y la usada para apuntar sobre un
objetivo puede afectar a la precisión del disparo si no coinciden. La siguiente tabla
compara ambos movimientos y la dirección del error, del 1er disparo, que se puede
producir si el sistema tiene holgura:

Movimiento final del Movimiento final del Dirección del


cañón en la cañón al ERROR
HOMOGENEIZACIÓN APUNTAR A UN BLANCO del 1er disparo
ARRIBA ARRIBA NINGUNO
ARRIBA ABAJO BAJO / CORTO
ABAJO ARRIBA ALTO / LARGO
ABAJO ABAJO NINGUNO

La consiguiente corrección del fuego para los sucesivos disparos, también se verán
afectados. La siguiente tabla muestra el error que se produce al corregir el tiro,
dependiendo del movimiento final del cañón:

Movimiento final del Movimiento final del cañón Dirección del


cañón en el en el ERROR
1ER DISPARO DISPARO DE
CORRECCIÓN
ARRIBA ARRIBA NINGUNO
ARRIBA ABAJO BAJO / CORTO
ABAJO ARRIBA ALTO / LARGO
ABAJO ABAJO NINGUNO

3-18



)LJXUD(IHFWRGHODKROJXUDHQODFRUUHFFLyQGHOWLUR

En la figura 73.21 se muestra un ejemplo del efecto producido por la holgura si no se


sigue un mismo patrón de movimiento.
Para un sistema de arma que se ha homogeneizado finalizando el movimiento en
elevación, si al enfrentar un objetivo el patrón de movimiento es en depresión, el
sistema se verá afectado por la holgura por lo que el impacto será BAJO / CORTO.
Al corregir el error realizamos el movimiento en dirección contraria, elevación, por lo
que el sistema no se verá afectado por la holgura y el disparo quedará LARGO /
ALTO.
De lo anteriormente expuesto se puede deducir que lo mejor es que el movimiento
final del cañón en la homogeneización, al disparar contra un blanco y en la
corrección del tiro, se realice en la misma dirección.
Como se considera más factible observar y calificar un disparo BAJO / CORTO que
el que se produce ALTO / LARGO, es por lo que preferentemente se recomienda
usar el patrón de movimiento final de abajo hacia arriba.

Este patrón debe ser puesto en práctica en todas las circunstancias, de manera que
los tripulantes no tengan que recordar o calcular en qué condiciones se debe
aplicar.

11.8. ESQUEMA DE RESPONSABILIDADES EN LAS TAREAS DE


HOMOGENEIZACIÓN.

3-19
FICHA DE TAREA

1. CÓDIGO: 612-400-074.

2. DESCRIPCIÓN: PUESTA A CERO.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Específica.

4. TIPO. 5. LUGAR. 6. DURACIÓN.


Teórica-Práctica Aula y Vehículo. Teoría: 60 minutos.
Práctica: 90 minutos.
7. AYUDAS A LA INSTRUCCIÓN.
VCI/C, Centrador de boca, blanco de homogeneización.
8. BIBLIOGRAFÍA.
MI-017. Manual de Instrucción. Instructor Avanzado de Tiro para VCI/C Pizarro

9. CONDICIONES DE EJECUCIÓN.

La parte teórica se llevará a cabo con la tripulación reunida en el aula. La parte


práctica de la puesta a cero se llevará a cabo con la tripulación en sus puestos
correspondientes y en un campo de maniobras adecuado para efectuar tiro con el
armamento principal del vehículo.

10. REQUISITOS A ALCANZAR.

Que la tripulación sean capaces de realizar la puesta acero con distintas municiones,
para el armamento principal y la ametralladora coaxial.
Se considerara que la tripulación ha superado la prueba si obtiene el 100% de
aciertos.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. TERMINOLOGÍA.

En relación con la puesta a cero existen una serie de términos, cuyos acrónimos son
utilizados como lenguaje común por los IAT especialistas en diferentes materiales y
en los diversos países que cuentan con personal “PDVWHUJXQQHU´. Los términos más
empleados son los siguientes:
– ISF: Error sistemático individual (ESI)
– B-ISF: Determinación del nuevo error sistemático individual de cada VCI/C (D-
ESI)
– C-ISF: Comprobación del antiguo error sistemático individual de cada VCI/C
(C-ESI)
– ESF: Unidad de error sistemático para todos los VCI/C. Media aritmética de
los ISF (M.ESI)
– GTP: Centro de impactos (CI)
– ETW: Probabilidad de impacto al primer disparo (PIPD)

3-25
11.2. GENERALIDADES

La finalidad de la puesta a cero es calcular el error sistemático del arma para cada
tipo de munición. Es decir, la desviación medida en milésimas entre el centro de
impactos (GTP) y el punto de impacto previsto según las tablas de tiro.
El error sistemático depende de los propios componentes individuales del arma, que
se desgastan con el tiempo, y del tipo de munición empleada que presenta
peculiaridades propias en función de cada lote, por lo que los valores de este error
no permanecen constantes. Al no ser constante la dependencia entre la munición y
los componentes del arma, la probabilidad de impacto al primer disparo (ETW)
disminuye con el paso del tiempo.
Como consecuencia de todo lo anterior, es necesario establecer una desviación
particular del arma que se calcula mediante la “GHWHUPLQDFLyQ GHO HUURU VLVWHPiWLFR
LQGLYLGXDO”, denominada “B-ISF”. Normalmente acudiremos a unos datos estándar
“ESF”, obtenidos de la media aritmética de las puestas a cero de un número
significativo de VCI/C con un ISF parecido, llevándose a cabo una determinación
específica para un VCI/C, únicamente cuando se comprueba que esos valores
estándar no son válidos para ese vehículo.
En todo caso siempre prevalecerá una puesta a cero particular de un VCI/C sobre la
unidad de error sistemático, cuando no se cumplan los requisitos para aplicar esta
última.
El error sistemático puede, si es conocido de antemano, ser introducido en la
dirección de tiro y, por lo tanto, disminuir o incluso eliminar el error sistemático entre
los elementos de puntería y el punto de impacto.
La desviación particular del arma se establece a través de la “determinación del
error sistemático individual” (B-ISF). Introduciendo los valores hallados para el ISF,
en el calculador balístico de la dirección de tiro, se compensa el error sistemático.
Para los VCI/C Pizarro hay hasta cuatro errores sistemáticos ISF aplicables que
dependen de la munición:
x ISF MP / TP.
x ISF APDS.
x ISF APFSDS.
x ISF 7,62
Para estas mismas municiones se podrán aplicar los correspondientes ESF.
La “GHWHUPLQDFLyQGHOHUURUVLVWHPiWLFRindividual” debe realizarse siempre que:
x Se introduzca un nuevo tipo de munición para los VCI/C.
x Se cambie cualquier elemento de la dirección de tiro o componente del cañón.
x Se observen desvíos en el tiro durante los ejercicios, teniendo introducidos el
ESF.

11.3. OPERACIONES PREPARATORIAS PARA LA PUESTA A CERO DEL CAÑON

Para la puesta a cero se necesita contar con el siguiente material:


x Centrador de boca.
x Documentación del vehículo.
x Escalera doméstica o taburete.
x Aparatos de medida (Termómetro, anemómetro y barómetro o altímetro)
x Cinta Métrica.
3-26
x Hojas de registro de puesta a cero

11.3.a. Acondicionamiento de la zona de blancos

Colocar dos blancos de puesta a cero (ver ficha 612-400-074) para cada VCI/C y a
una distancia de:
x 1000 m, si vamos a realizar una B-ISF o una C-ISF para munición APFSDS o
APDS.
x 500 m, si la munición es MP, TP o 7,62.

)LJXUD=RQDGH%ODQFRV

Situarlo en una zona lo más llana posible, en posición vertical y perpendicular a la
dirección de tiro.

)LJXUD%ODQFRGHSXHVWDDFHURSDUDPHWURV

3-27
)LJXUD%ODQFRGHSXHVWDDFHURSDUDPHWURV

Para evitar deterioros en los blancos, separarlos convenientemente de los


montículos o espaldones del campo de tiro que pudieran producir rebotes.
Comprobar la distancia al blanco con el telémetro láser (± 10 metros).
11.3.b. Preparación del VCI/C

Previo a la realización de una “puesta a cero” se debe realizar:


x Prueba del sistema de la Dirección de tiro.
x Test automático del BITE.
x Homogeneización de los elementos de puntería.

Realizar las tareas de mantenimiento previo al tiro conforme al Capítulo 4 de este


Manual.

11.4. CÁLCULO DE LA PUESTA A CERO PARA EL CAÑÓN

11.4.a. Procedimiento

Para efectuar correctamente una puesta a cero debemos disponer, como mínimo, de
quince (15) disparos del mismo lote por vehículo. El procedimiento a seguir será el
siguiente:

– Situar el vehículo en una zona de terreno lo más llana posible.


– Colocar a una distancia de 500 / 1000 metros del vehículo (según tipo de
munición) un blanco capaz de recoger los impactos. De dimensiones 3x3
metros, (Fig 74.2 y 74.3) y que se encuentre aproximadamente en el mismo
plano horizontal que el vehículo.

3-28
– Comprobar la velocidad del viento y que ésta no supera los valores
adecuados (5m/seg. para munición MP / TP o 7,62 y 8m/seg. para APFSDS /
APDS).
– En caso de que exista viento racheado, es conveniente situar en las
cercanías del objetivo una señal (manga de viento, bandera o similar) que
ayude al tirador a elegir el momento más adecuado para disparar.
– Poner en funcionamiento la torre y el sistema de dirección de tiro siguiendo
las instrucciones recogidas en el Capítulo 3 de este Manual.
– Introducir en la UCP/CBC los parámetros locales de:
x ALTITUD equivalente a la medida de la presión atmosférica en
milibares (entre –200 y 4000 m)
x TEMPERATURA (entre –45º C y 55º C)
x VIENTO perpendicular u oblicuo (entre +30 m/s (si viene de la
dcha.) y –30 m/s (si viene de la izquierda)
– En el Panel del JV seleccionar en las ruletas la munición a ajustar.
– Cargar la munición seleccionada.
– Seleccionar el cargador en el que está la munición sobre la que vamos a
realizar la B-ISF, comprobar que coincide con la que aparece en pantalla.
Verificar el valor de puesta a cero almacenado en la DT. Accionar, en la UCP
/ CBC, el pulsador CERO (se ilumina) y comprobar que en la pantalla aparece
el valor 0.0.0.0. Pulsar ENTER, se debe apagar CERO.
– Medir distancia al blanco por medio del telémetro láser o introducirla
manualmente si es conocida.
– Efectuar dos (2) disparos de acondicionamiento del tubo, apuntando fuera del
blanco.
– Apuntar con el retículo de la UVL al centro del blanco, hacer cinco (5)
disparos, tiro a tiro, volviendo a apuntar después de cada disparo con los
mandos de movimiento manual. Dejar una pausa de al menos 30 segundos
entre cada disparo.
– Medir el desvío de cada uno de los impactos y calcular las coordenadas del
centro de impactos (CI) y el valor del error en milésimas, según el
procedimiento descrito en el párrafo 11.4 b.
– Materializar en el blanco el centro de impactos.
– Mantener el retículo de la UVL apuntando al centro del blanco. Presionar
“CERO” en la UCP / CBC e introducir manualmente el error calculado en
milésimas. Al presionar “ENTER” el dato queda almacenado en
memoria y debemos apreciar que el retículo se ha desplazado
colocándose sobre el CI materializado en el blanco.
– Otra posibilidad es llevar, por medio del conmutador articulado de la UCP, el
retículo de la UVL al centro de impactos y a continuación pulsar ENTER.
– Apuntar los datos obtenidos en el formulario correspondiente del libro de
filiación del vehículo.

11.4.b. Cálculo del centro de impactos y del error sistemático.

– Al finalizar la secuencia de 5 disparos, colocar un círculo de 1 metro de


diámetro (distancia de tiro 500 metros, munición MP/TP) o de 1,6 metros
(distancia de tiro de 1000 metros, munición APFSDS/APDS) abarcando el
mayor número de impactos y descartando aquellos que se queden fuera del
círculo. Sí el número de impactos válidos no es superior a tres se realizarán

3-29
tres disparos adicionales, volviéndose a comprobar con el círculo los impactos
válidos.
– Medir las coordenadas de los impactos válidos (en metros), calcular la media
aritmética y localizar el centro de impactos (CI) de acuerdo a las fórmulas
siguiente:

݀1 + ݀2 + ݀3 + ݀݊
ܸ݈ܽ‫݅ܿܿ݁ݎ݅݀ ݊݁ ݎ݋‬ó݊ ݈݀݁ ‫= ܦ ܫܥ‬
݊
݁1 + ݁2 + ݁3 + ݁݊
ܸ݈ܽ‫݅ܿܽݒ݈݁݁ ݊݁ ݎ݋‬ó݊ ݈݀݁ ‫= ܧ ܫܥ‬
݊

d= desvío en dirección del impacto en metros.


e = desvío en elevación del impacto en metros.
n = número de impactos válidos
– El sentido del desvío queda reflejado según el signo que se le asigne en
función del cuadrante del blanco en el que se encuentre (Fig. 74.4).

)LJXUD'LVWULEXFLyQGHOEODQFRSRUFXDGUDQWHV

– Para calcular el Error Sistemático Individual (ISF) usar:

Error en dirección (ǹ]  Error en elevación (El)


‫݉(ܦ‬, ‫)ݏ‬ ‫݉(ܧ‬, ‫)ݏ‬
Ȝz°° = ‫݈ܧ‬°° =
‫݉݇( ܶܦ‬, ‫)ݏ‬ ‫݉݇( ܶܦ‬, ‫)ݏ‬
' 9DORUHQGLUHFFLyQGHO&,
( 9DORUHQHOHYDFLyQGHO&,
'7 'LVWDQFLDGH7LUR

– Introducir los datos en la UCP / CBC con el signo correspondiente.
– Anotar los datos en la documentación del VCI/C.
– Para comprobar la validez de la puesta a cero, realizar una nueva serie de
cinco (5) disparos con las mismas condiciones que la puesta a cero.
– Hallar el CI de este nuevo agrupamiento y calcular su desviación radial según
la siguiente formula.

- Para la X se introducen los valores de


dirección del CI en milésimas.
3-30 - Para la Y se introducen los valores de
elevación del CI en milésimas.
ߜ = ඥ‫ ݔ‬ଶ + ‫ ݕ‬ଶ

– 6LODGHVYLDFLyQUDGLDOHV”žž FPDP SDUDPXQLFLyQ0373R”


0,4ºº (40 cm a 1000 m) para las municiones APFSDS o APDS; la corrección
se da por válida.
– En caso de que el desvío radial sea mayor a los valores mencionados,
calcular el nuevo ESI añadiendo la corrección de este agrupamiento al
anteriormente introducido en la UCP/CBC.

EJEMPLO DE CÁLCULO DEL B-ISF


– Munición TP. Distancia de tiro 500 metros.
– Realizar una serie de cinco disparos.
– Posición de los Impactos:
x Deben estar agrupados dentro de un círculo de un (1) metro de diámetro.
x Si el agrupamiento es < 4 impactos, realizar tres disparos adicionales.
x Recoger todos los impactos agrupados en un círculo de 1 metro.

)LJXUD9DOLGH]GHODJUXSDPLHQWR


Disparo Nº Coordenadas del Impacto
Dirección (m) Elevación (m)
1 + 0,62 +0,25
2 + 1,03 +0,25
3 + 1,32 +0,35
4 + 1,18 +0,65
5 + 0,84 +0,88
6 + 0,68 +1,05
Centro de impactos + 5,67/6 = +0,95 m +3,43/6= +0,57 m



)LJXUD&HQWURGHLPSDFWRV

3-31
Valores “B-ISF” :

0,95(݉, ‫)ݏ‬ 0,57(݉, ‫)ݏ‬


Ȝz°° = ‫݈ܧ‬°° =
0,5 (݇݉, ‫)ݏ‬ 0,5 (݇݉, ‫)ݏ‬

Dirección = + 1,90ºº Elevación = + 1,14ºº

– Introducir los valores B-ISF en la UCP / CBC.


– Volver a apuntar al centro del blanco y realizar 5 disparos de comprobación.


)LJXUD&RPSUREDFLyQ(6,


Disparo Nº Coordenadas del Impacto
Dirección (m) Elevación (m)
1 -0,32 +0,15
2 -0,49 -0,35
3 -0,06 -0,35
4 +0,18 -0,45
5 +0,24 -0,68
Centro de impactos -0,45/5 = -0,09 m -1,68/5= -0,34 m

Valores “C-ISF” :
െ0,09(݉, ‫)ݏ‬ െ0,34(݉, ‫)ݏ‬
Ȝz°° = ‫݈ܧ‬°° =
0,5 (݇݉, ‫)ݏ‬ 0,5 (݇݉, ‫)ݏ‬
Dirección = - 0,18ºº Elevación = - 0,68ºº

Desviación radial del CI.


ඥ 0,09ଶ + 0,34ଶ ؆ 0,35ºº

– Como la desviación radial del CI es menor de 0,5ºº, el B-ISF se considera


válido.
– Sí la desviación radial del CI fuese mayor de 0,5ºº, recalcular el valor del ESI
añadiendo la corrección del último agrupamiento:

Dirección = 1,90ºº - 0,18ºº = +1,72ºº


Elevación = 1,14ºº - 0,68ºº = +0,46ºº

11.5. PUESTA A CERO DE LA AMETRALLADORA COAXIAL

3-32
11.5.a. Generalidades

Previa a la puesta a cero de la ametralladora coaxial debe realizarse la


homogeneización de la misma. Ambas operaciones deben ser efectuadas por la
tripulación, bajo la supervisión del Instructor Avanzado de Tiro.

La homogeneización de la ametralladora coaxial se realizará cuando:

x Se sustituya la ametralladora.
x La homogeneización de la óptica principal haya sido corregida.
x Se vayan a realizar ejercicios de tiro.
x Antes de una operación real.

11.5.b. Procedimiento para la puesta a cero de la ametralladora coaxial

– Se deben disponer de 50 disparos por VCI/C para realizar la puesta a cero.


– Se realizará sobre un blanco de puesta a cero de 3 x 3 metros y a una
distancia de 500 metros.
– La velocidad del viento, en la línea de blancos, no debe ser superior a 5 m/s.
– Con la ametralladora municionada y cargada, apuntar con el retículo de la
UVL al centro del blanco con los mandos de movimiento manual.
– Seleccionar la ametralladora en el panel del Tirador y ráfaga de 6 disparos.
– Disparar una ráfaga y observar los impactos, corregir por traslado de la línea
de mira si es necesario.
– Realizar otra ráfaga, observar los impactos y volver a corregir si fuese
necesario.
– Asegurarse que los disparos están impactando en el blanco.
– Si el traslado de la línea de mira la lleva a posicionarse fuera del blanco
realizar una puesta a cero de emergencia. Pulsar “CERO” en la UCP / CBC y
con el mando de homogeneización llevar el retículo de la UVL al centro del
blanco. Pulsar ENTER.
– Realizar 3 ráfagas manteniendo el retículo sobre el centro del blanco.
– Calcular el centro de impactos del agrupamiento obtenido. Materializarlo
sobre el blanco.
– Pulsar “CERO” en la UCP / CBC y con el mando de homogeneización llevar el
retículo de la UVL al centro de impactos calculado. Pulsar ENTER.
– Comprobar la corrección efectuando 3 ráfagas sobre el centro del blanco.
– Finalizada la puesta a cero, descargar la ametralladora y establecer las
medidas de seguridad.

11.6. PUESTA A CERO DEL PERISCOPIO DEL JV (P-204P)

Los datos obtenidos para la corrección del error sistemático individual en la


Dirección de Tiro, se pueden trasladar al periscopio P-204P para una de las
municiones reflejadas en su estadía. Para ello:
– Una vez finalizada la puesta a cero de la dirección de tiro, restaurar los
valores nominales en la UCP / CBC:
x ALTITUD = 0 metros.
x VIENTO = 0 m/seg.

3-33
x TEMPERATURA = 15º C.
– Determinar el tipo de munición para el que se va a corregir el periscopio P-
204P. Normalmente será la APFSDS / APDS, por ser esta la que necesita
mayor precisión en razón a los objetivos contra los que se usa.
– El periscopio P-204P debe estar homogeneizado con el eje del cañón.
– Seleccionar la munición elegida en el panel del JV o del Tirador.
– Llevar el retículo de la UVL sobre el centro del blanco de puesta a cero a una
distancia de 1000 metros. Medir la distancia con el telémetro láser.
– Si fuese necesario, corregir el retículo del P-204P para hacer coincidir la
intersección de la línea vertical y la correspondiente a 1000 metros, para
munición APFSDS / APDS, con el centro del blanco. La corrección se realiza
con los mandos de homogeneización.
– Comprobar la validez de la corrección para otras distancias.

)LJXUD3XHVWDD&HURGHO33

3-34
FICHA DE TAREA

4. CÓDIGO. 612-400- 106

5. DESCRIPCIÓN. EVACUACIÓN DE UN TRIPULANTE HERIDO.

3. IDENTIFICACIÓN

NIVEL II. Colectiva. Especifica.


4. TIPO 5. LUGAR 6. DURACIÓN
Práctica. Vehículo Pizarro. 60 Minutos.
7. AYUDAS A LA INSTRUCCIÓN
Vehículo Pizarro, MANIQUÍ.
8. BIBLIOGRAFÍA
MT6-021 Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

9. CONDICIONES DE EJECUCIÓN.

Es necesario disponer de un vehículo Pizarro, el lugar para la realización de la


práctica puede ser el mismo aparcamiento de los vehículos. El número de tripulantes
será el adecuado para que todos puedan realizar la práctica, sacando a un herido
de la torre.

Para realizarla lo mejor posible es necesario un maniquí, cuyas formas y peso sean
similares a las de un hombre (no sirve un tripulante, pues nunca es peso muerto).

12. REQUISITOS A ALCANZAR.

El tripulante evacúe del vehículo a un tripulante herido.


El tripulante recoja a un herido situado en el exterior.

11. DESARROLLO TEÓRICO DEL CONTENIDO.

11.1. EVACUACIÓN DE TRIPULANTES HERIDOS A BORDO DEL VEHÍCULO.

11.1.a. Normas comunes a toda evacuación de este tipo.

x El equipo de evacuación está compuesto por dos tripulantes.


x Un tercer tripulante, saca el botiquín de urgencia de su alojamiento en la
cámara de la unidad transportada.
x Se evacúa al herido y se le traslada al nido de heridos, en todo caso a un
lugar protegido.
x Se le realiza una primera cura de urgencia.
x Se señala el lugar donde se encuentra el herido (si no es el nido de heridos),
para evitar que sea atropellado.
3-173
11.1.b. Evacuación del conductor.

11.1.b.(1). POR LA ESCOTILLA.

El equipo de evacuación está formado por el Jefe de Vehículo y el Tirador. La torre


debe colocarse en la posición más cómoda para sacar por la escotilla al Conductor,
en todo caso el cañón no debe impedir la apertura de la escotilla.

JEFE DE VEHÍCULO TIRADOR

Se coloca sobre el vehículo, junto a la


Se sitúa junto al Tirador.
escotilla.
Coge al herido por las manos (o brazos), lo
Sujeta al herido. endereza y le cruza las manos sobre el
pecho.
Ayuda al Tirador. Lo levanta y gira.
Ayuda al Tirador y salta a tierra, delante Lo sienta sobre el borde de la escotilla.
del vehículo.
Recibe al herido, sosteniéndolo por el Desciende el cuerpo del herido hasta el
pecho. Jefe de Vehículo.
Sigue descendiéndole por la plancha Saca las piernas del herido por la escotilla.
inclinada y lo sostiene.
Ayudado por el Tirador, coloca al herido en Salta a tierra y ayuda al Jefe de Vehículo
el suelo. a colocarlo en el suelo.
Entre los dos transportan el herido a Entre los dos transportan el herido a
cubierto. cubierto.

11.1.b.(2). POR LA UNIDAD TRANSPORTADA.

El equipo de evacuación está formado por dos hombres de la unidad transportada.


El segundo permanece en el interior de la cámara, a la espera de que el primero
saque al Conductor hasta la misma, para desde allí sacar al herido al exterior.
El primero, lleva el asiento hasta la posición más baja y quita el respaldo del asiento,
cogiendo al herido por las axilas, lo arrastra hasta el interior de la cámara de la
unidad transportada.

11.1.c. Evacuación de un herido de la torre.

11.1.c.(1). POR LA ESCOTILLA.

El equipo de evacuación estará formado por:


x Si el herido es el Jefe de Vehículo, por el Conductor (número 1) y el Tirador
(número 2).
x Si el herido es el Tirador, por el Conductor (número 1) y el Jefe de Vehículo
(número 2).

Actividades a desarrollar:

3-174
NUMERO 1 NUMERO 2
Sobre la torre, junto a la escotilla del Desde el interior sujeta al herido, y lo
herido. sostiene por el pecho.
Sujeta al herido por las axilas, lo eleva y Ayuda al número 1, elevando al herido
coloca sobre el borde de la escotilla. desde el interior.
Sostiene al herido mientras sale el Sale, se sitúa sobre el casco, sujeta al
número 2. herido y lo baja al casco.
Salta a tierra y sostiene al herido
Salta a tierra.
mientras baja el núm. 2.
Entre los dos levantan el cuerpo del herido y lo transportan a cubierto.

11.1.c.(2). POR LA UNIDAD TRANSPORTADA.

El equipo de evacuación está formado por dos hombres de la unidad transportada.


El segundo permanece en el interior de la cámara, a la espera de que el primero
saque al herido hasta la misma, para desde allí sacarlo al exterior.
Si el herido es el Tirador, la torre se coloca a las 6. El primero introduce los brazos
en la cámara de combate y sujetando al Tirador por las piernas y por el pecho, tira
del cuerpo hasta sacar las piernas de la torre y entonces el segundo hombre ayuda
al primero tirando de las piernas hacia el centro de la cámara.
Si el herido es el Jefe de Vehículo, la torre se coloca a las 12. El primero introduce
los brazos en la cámara de combate y sujetando al Jefe de Vehículo por las piernas
y por el pecho, tira del cuerpo hasta sacar las piernas de la torre y entonces el
segundo hombre ayuda al primero tirando de las piernas hacia el centro de la
cámara.

11.2. RECOGIDA DE HERIDOS EN EL EXTERIOR DEL VEHÍCULO.

El vehículo se acerca al herido hasta colocarse en forma tal, que el portón de la


cámara de personal quede lo más próximo al mismo y el frente del vehículo en
dirección al enemigo (sí es necesario, acercarse al herido marcha atrás con la puerta
abierta y un hombre de la unidad transportada dirigiendo desde dentro al
Conductor). El Conductor detiene el vehículo y, dos hombres de la unidad
transportada, introducen al herido dentro del vehículo.

12. RESUMEN.

Por ser una ficha eminentemente práctica no se considera resumen.

13. PRÁCTICAS.

En una sesión práctica, los alumnos deben practicar las distintas formas de evacuar
un herido del vehículo. La evacuación se simula con un maniquí

3-175
FICHA DE TEORÍA

1. CÓDIGO. 612-400-107.

2. DESCRIPCIÓN. ABANDONO Y DESTRUCCIÓN DEL VEHÍCULO.

3. IDENTIFICACIÓN.
NIVEL II. Colectiva. Específica.

4. LUGAR. 5. DURACIÓN.
Vehículo Pizarro. Teoría: 60 minutos.
6. AYUDAS A LA INSTRUCCIÓN.
Vehículo Pizarro, explosivos simulados, líquidos incendiarios simulados, CD ayudas
a la Instrucción.
7. BIBLIOGRAFÍA.
MT6-021 Manual Técnico. Vehículo VCI/C Pizarro. Manual de la Tripulación.

8. DESARROLLO TEÓRICO DEL CONTENIDO.

8.1. ABANDONO Y DESTRUCCIÓN DEL VEHÍCULO.

La decisión de destruir el vehículo la toma el Jefe de la Unidad cuando considera la


acción como imprescindible por la situación táctica. No obstante, si la situación lo
permite, se recupera, el material de transmisiones, munición y armamento
secundario.

La destrucción de los vehículos se debe realizar de forma, que no pueda ser puesto
en funcionamiento uno de ellos por reparación o reposición de piezas quitadas a
otros vehículos. En la destrucción deben ser dañadas las mismas piezas en todos
los vehículos abandonados.

Destruir, las partes esenciales del vehículo, equipo y armamento, dando prioridad a
este último en caso de no disponer de tiempo.

El Jefe de Vehículo ordena el abandono del mismo cuando éste quede totalmente
inutilizado y no puede continuar la acción ni por el fuego ni por el movimiento

8.2. PROCEDIMIENTOS DE DESTRUCCIÓN.

Se clasifican en:

x Mecánico. Se requieren, hachas, barras etc. Es el menos indicado por los


pocos daños que produce.
x Demolición. Mediante explosivos o munición adecuada.
x Fuego de las armas. Puede realizarse por cualquiera que produzca los
efectos deseados.

3-179
8.3. DESTRUCCIÓN DEL VEHÍCULO.

8.3.a. Por demolición.

Los procedimientos a seguir para la destrucción del vehículo, están en función del
tiempo y de los medios disponibles.

Como norma se procede de la siguiente forma:

x Colocar cargas para destruir el armamento.


x Colocar cargas en la unión de la torre con la barcaza.
x Explosivo en la cámara del grupo motopropulsor.
x Romper los depósitos de combustible.
x Explosionar todas las cargas a la vez.

8.3.b. Por incendio.

Romper los depósitos de combustible e incendiar el combustible.

8.3.c. Fuego de otras armas.

Consiste en disparar al vehículo desde otro, eligiendo como objetivo preferente la


torre y los depósitos de combustible.

8.3.d. Destrucción del armamento.

La destrucción del armamento es simultánea a la del vehículo pero si no es posible


se da prioridad al armamento.
Se empieza por destruir o inutilizar el cañón, y a continuación se destruyen la
ametralladora si es que ésta no pueden llevarse consigo.

'HVWUXFFLyQGHOFDxyQ.

Por medio de una granada. Se quita el tubo y por el hueco se introduce una
granada.
Por medio de explosivos: Colocar medio kilogramo de trilita o explosivo similar,
dentro del cajón de los mecanismos y atracarlo a unos veinte centímetros del tubo
(cierre en su posición más atrasada) producir la explosión a cubierto mediante un
explosor eléctrico o mediante una mecha lenta.

,QXWLOL]DFLyQGHOFDxyQ

La mejor forma es llevarse el cierre, y si no es posible, enterrar aleatoriamente estos


después de haber quitado el percutor.

'HVWUXFFLyQRLQXWLOL]DFLyQGHODDPHWUDOODGRUD

La tripulación para su propia protección, si puede se lleva consigo la ametralladora


coaxial, su bolsa de accesorios y las cajas de munición.

3-180
Para destruir o inutilizar el arma se emplea un hacha, mazo o martillo, golpeando
fuertemente el cierre, cerrojo, empuñadura, tapa del cajón de los mecanismos, etc.
Otro procedimiento es quitar las piezas esenciales y destruirlas, procediendo a
inutilizar el afuste mediante golpes con el martillo.

8.4. DESTRUCCIÓN DE LAS TRANSMISIONES.

Si no es posible llevarse los equipos de transmisiones, se procede a su destrucción


o inutilización. Normalmente se inutilizan las transmisiones por procedimientos
mecánicos o incendiarios, efectuando la destrucción al mismo tiempo que la del
resto del vehículo.

8.5. ABANDONO DEL VEHÍCULO.

El Jefe de Vehículo ordena abandonar el vehículo, marcando una zona de reunión a


la tripulación.
El conductor apaga el motor.
El Jefe de Vehículo desmonta la radio
El Jefe de Vehículo desmonta de su afuste la ametralladora coaxial y la coloca sobre
la torre junto con un cañón de respeto.
El más caracterizado de la unidad transportada ordena sacar las cajas de munición
de la ametralladora y el cañón de respeto de la cámara.
Los tripulantes destrozan simultáneamente los instrumentos ópticos, los depósitos
de combustible, cajas interfónicas etc.
El tirador inutiliza la dirección de tiro.
Recogen sus máscaras, equipo individual y los documentos que porten en el
vehículo (extracto de IBCIS, Órdenes de Operaciones, etc.)
El Jefe de Vehículo sale de la torre y permanece en la parte posterior de la cámara
de la unidad transportada.
El tirador y conductor desmontan el tubo del cañón.
Si se dispone de petacas de carburante, se vacían en la cámara de combate y se
abre el grifo de vaciado de combustible de los depósitos.
El conductor quita el panel de acceso a la cámara del grupo motopropulsor desde su
asiento.
El Jefe de Vehículo se coloca en el exterior al lado del escudo del cañón, el
conductor en el exterior de la escotilla de su asiento, el tirador en el exterior de su
escotilla, el Jefe de la unidad transportada en el exterior de la misma. A la orden del
Jefe de Vehículo introducirán una granada en los siguientes sitios:

x Jefe de Vehículo: En el hueco dejado por el tubo.


x Tirador: En la cámara de combate.
x Conductor: En la cámara del grupo motopropulsor por el hueco dejado
por el panel.
x Jefe de la unidad transportada en el interior de la misma.

9. RESUMEN.

3-181
a. La decisión de destruir el vehículo la tomará el jefe de la unidad cuando considere
la acción como imprescindible por la situación táctica. No obstante, si la situación lo
permite, se recupera, el material de transmisiones, munición y armamento
secundario.
b. Los procedimientos de destrucción se clasifican en:
x Mecánico.
x Demolición.
x Fuego de las armas.
c. Para la destrucción del vehículo se tendrá en cuenta:
x Inutilizar las partes esenciales del vehículo, equipo y armamento, con
prioridad a este último en el caso de no disponer de tiempo.
x Realizar la destrucción en tres fases: Armamento, transmisiones y resto del
vehículo.
x Utilizar alguno de los siguientes procedimientos: Mecánicos (hachas, picos,
mazas, etc.), incendiarios (combustibles líquidos, aceites, granadas
incendiarias, etc.), explosivos (granadas rompedoras o de carga hueca y
explosivos, si se dispone de ellos) y tiro con otras armas (otros vehículos,
lanzagranadas, etc.).

3-182
),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï15(9,6,Ï1',$5,$'(/9(+Ë&8/2

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFRSUDFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
 3UDFWLFDPLQWULSXODFLyQ
$<8'$6$/$,16758&&,Ï1
8QYHKtFXOR9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

'LVSRQHUGHXQYHKtFXORHQXQOXJDUYHQWLODGR\HQXQWHUUHQROODQR


5(48,6,726$$/&$1=$5

3RGHUOOHYDUDFDERODUHYLVLyQGLDULDGHO9&,&
/D HYDOXDFLyQ VH FRQVLGHUD VXSHUDGD VL VH VXSHUD HO  GH DFLHUWRV HQ ORV
DVSHFWRVDHYDOXDU


'(6$552//27(Ï5,&2'(/&217(1,'2

127$ /DV WDUHDV TXH QR KDFHQ UHIHUHQFLD D ILFKDV GH HVWH PDQXDO VH
GHVFULEHQHQHO07FRUUHVSRQGLHQWH

5(9,6,21(6&21(/027253$5$'2

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 $027253$5$'2
 (TXLSR\ORWHGHD $VHJXUDUVHGHTXHQDGDHVWpIXHUDGH ; ; ;
ERUGR OXJDU
 'RFXPHQWDFLyQ &RPSUREDU  ; ;






1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 &RQMXQWRFDVFR ,QVSHFFLyQRFXODU ;  ;
 0DQFKDVGHDFHLWHJDVyOHRR
UHIULJHUDQWHHQHOVXHORGHEDMRGHO
YHKtFXOR,QYHVWLJDUHORULJHQGHOD
IXJD\HYDOXDU$QWHODGXGD
FRPSUREDUORVQLYHOHVGH
· $FHLWHGHOPRWRU7DUHD&
· 5HIULJHUDQWH7DUHD&
· 9HQWLODGRUHV7DUHD&
· $FHLWHWUDQVPLVLyQ7DUHD&
· 3DVRVILQDOHV7DUHD&
1RLQLFLDUHOVHUYLFLRVLQ
GLDJQRVWLFDU\HYDOXDUHOIDOOR(Q
FDVRGHGXGDLQIRUPDUDOž
(VFDOyQ
 &RPSUREDUTXHODVUHMLOODVGH
HQWUDGDGHDLUHGHDOLPHQWDFLyQDO
PRWRU\GHUHIULJHUDFLyQHVWiQ
OLPSLDV\GHVSHMDGDV
 3HULVFRSLRVGH /LPSLDUHQVXFDVR7DUHD& YHU  ; ;
REVHUYDFLyQ ILFKDGHHVWHPDQXDO 
 7UHQGHURGDMH\ ,QVSHFFLyQSUHVHUYLFLR7DUHD& ;  ;
VXVSHQVLyQ 6LHOYHKtFXOROOHYDWLHPSRSDUDGR\VH
 GHVFRQRFHVXHVWDGRDQWHULRUHMHFXWDUOD
 7DUHD&
(QFDVRGHGHWHFWDUDQRPDOtDVHO-9
GHEHHYDOXDUODVSRVLELOLGDGHVGHLQLFLDU
HOVHUYLFLR1XQFDLQLFLDUORFRQEDUUDVGH
WRUVLyQURWDVRWXHUFDVIORMDV
 $OXPEUDGR,QWHULRU 3UXHED  ; ;
 9iOYXODVGH &HUUDU GHEHQHVWDUDELHUWDV   ; ;
GUHQDMH
 ([WLQWRUHV  3UHVLyQ  ; ;
SRUWiWLOHV  6XMHFLRQHVOODYH\SUHFLQWRV
 /LPSLH]DGHERTXLOODV
 3DQHOGH 3UXHEDGHOiPSDUDVHLQGLFDGRUHV   ;
LQVWUXPHQWRV 1RLQLFLDUHOVHUYLFLR HQFLUFXQVWDQFLDV
QRUPDOHV VLQFRQWDUFRQHO
IXQFLRQDPLHQWRGHODV/XFHV*HQHUDOHV
GH$YLVRRODVSDQWDOODVGHWHVWLJRVGH
HVWDGR&DPELDUOiPSDUDVHQpVWHFDVR
7DUHD&
 %DWHUtDV (VWDGRGHFDUJDGHDPERVJUXSRVGH   ;
EDWHUtDV9HUYROWtPHWUR
 6LVWHPDV&,GHOD 3UXHEDGHO6LVWHPD&DPELDUOiPSDUDV ;  ;
FiPDUD*03\$( HQFDVRGHTXHDOJXQDHVWXYLHVHIXQGLGD
GHODFiPDUDGH 7DUHD&
SHUVRQDO
 %RPEDHOpFWULFDGH (VFXFKDUVLIXQFLRQDDODFFLRQDUHO   ;
FDUEXUDQWH LQWHUUXSWRU³&217$&72´


1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 %RPEDVDFKLTXH 3UXHEDGHIXQFLRQDPLHQWRVLHVWXYLHUD   ;
SUHYLVWRYDGHDU(VFXFKDUVLIXQFLRQDQ
 &21(/02725(10$5&+$
 7HVWLJRVGHOSDQHO    ;
GHLQVWUXPHQWRV
 &DUJDGHO 9HUYROWtPHWUR 9    ;
DOWHUQDGRU


35(&$8&,Ï1
6LODVEDWHUtDVHVWXYLHUDQEDMDVQRPRYHUODWRUUHHOpFWULFDPHQWHKDVWDTXH
HVWpQVXILFLHQWHPHQWHUHFDUJDGDVSXHGHQSURGXFLUVHDYHUtDVJUDYHVGHO
UHJXODGRU

 0RWRU +XPRVGHHVFDSH7DUHD&'  ;  
 &RQPXWDGRUGH &RPSUREDU7DUHD& YHUILFKD ; ; ;
OXFHVHLQWHUUXSWRU GHHVWHPDQXDO 
GHVHxDOHV
 6LVWHPDGH &RPSUREDUHOIXQFLRQDPLHQWRGHORV ; ; ;
VHJXULGDGGH FRQWDFWRUHVGHFLHUUHGHHVFRWLOODV\
HVFRWLOODVDELHUWDV SRUWyQWUDVHUR
 (TXLSRGHODYDGR )XQFLRQDPLHQWR   ;
GHOSHULVFRSLR
FHQWUDO
 (TXLSRGHODYDGR )XQFLRQDPLHQWR6LVHLQVWDOD   ;
GHOSDUDEULVDV
H[WHULRU
 (TXLSRVGH )XQFLRQDPLHQWR ; ; ;
FRPXQLFDFLRQHV
 6LVWHPD1%4 (MHFXWDUSUXHEDGHIXQFLRQDPLHQWRVLVH ;  ;
SUHYpQRSHUDFLRQHVEDMRDPHQD]D1%4
7DUHD& YHUILFKDGH
HVWHPDQXDO 


5(9,6,21(6&21(/02725(10$5&+$

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 &RQMXQWRYHKtFXOR  )XQFLRQDPLHQWRJHQHUDO ;  ;
 &RPSUREDU IUHFXHQWHPHQWH HO
SDQHOGHLQVWUXPHQWRV
 'LUHFFLyQ (OYHKtFXORQRWLHQHWHQGHQFLDDLU   ;
DGHUHFKDRL]TXLHUGD
 $FHOHUDGRU (OSHGDODFW~DVXDYH\VLQ   ;
DJDUURWDPLHQWRV/DDFHOHUDFLyQ
GHOPRWRUHVSURJUHVLYD
 )UHQRV $ODSOLFDUHOSHGDOGHOIUHQRHO   ;
YHKtFXORVHUHWLHQH\QRVHGHVYtD
DXQODGRXRWUR



1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 0RWRU 7HPSHUDWXUDUHIULJHUDQWH    ;
ƒ& 
 9HQWLODFLyQ\HQVX )XQFLRQDPLHQWR   ;
FDVRFDOHIDFFLyQR
$$
 3RUWRQHV\HVFRWLOODV )XQFLRQDPLHQWR   ;
 (TXLSRVGH $QRPDOtDV ; ; ;
&RPXQLFDFLRQHV


 35(&$8&,Ï1
6LVHHQFLHQGHODOX]GHDYLVRJHQHUDO\VXHQDHO]XPEDGRUGHWHQHUHO
YHKtFXOR\FRPSUREDUORVWHVWLJRVTXHVHKDQHQFHQGLGR7HQHUHQ
FXHQWDORVQLYHOHVGHDOHUWD\REUDUVHJ~QORHVSHFLILFDGR



5(9,6,21(6'85$17(/$0$5&+$2$/7267e&1,&26

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 )UHQRGHDSDUFDPLHQWR (OIUHQRGHDSDUFDPLHQWR   ;
LQPRYLOL]DHOYHKtFXOR\VH
HQFLHQGHDODSOLFDUORHOWHVWLJR
)5(12$3$5&$0
 9HQWLODGRUHV )XQFLRQDPLHQWR   ;
 5HMLOODVGHDLUHGH &RPSUREDUTXHHVWiQ   ;
DGPLVLyQ\UHIULJHUDFLyQ GHVSHMDGDV
 7UHQGHURGDMH\ ,QVSHFFLyQ7DUHD& ;  ;
VXVSHQVLyQ
 &RQMXQWRYHKtFXOR 2EVHUYDUIXJDVRSpUGLGDVGH ;  ;
DFHLWHUHIULJHUDQWHR
FRPEXVWLEOH$EULUYiOYXODVGH
GUHQDMHGHOPRWRU FHUUDU
GHVSXpV 


 5(9,6,21(6 '(638e6 '( /$ 0$5&+$ 2 3$86$6 352/21*$'$6 (1
23(5$&,21(62(-(5&,&,26 

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
&21(/02725(10$5&+$
 )UHQRGHDSDUFDPLHQWR &RQpODSOLFDGRFRORFDUODSDODQFD   ;
GHVHQWLGRGHPDUFKDHQODSRVLFLyQ
³'´\DFHOHUDUOLJHUDPHQWH(O
YHKtFXORQRGHEHPRYHUVH(QHO
SDQHOGHOFRQGXFWRUVHHQFLHQGHHO
WHVWLJRGH)5(12$3$5&$0

3(/,*52
(/9(+Ë&8/238('(029(56(


1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 9HQWLODGRUHV &RPSUREDUIXQFLRQDPLHQWR ;  ;
 0RWRU  &RPSUREDU HO QLYHO GH DFHLWH   ;
7DUHD& 
 3UHVLyQGHDFHLWHPRWRU
 7HPSHUDWXUDGHDFHLWH
WUDQVPLVLyQ
 7HPSHUDWXUDOtTXLGRUHIULJHUDQWH

 35(&$8&,Ï1
6LODWHPSHUDWXUDHVDOWDFRORFDUODSDODQFDGHVHQWLGRGH
PDUFKDHQ1DFHOHUDU\PDQWHQHUODVUPLQGXUDQWH
PLQXWRV\VLHPSUHFRQHOSRUWyQGHO*03FHUUDGR 
$027253$5$'2
 &RQMXQWRYHKtFXOR $EULUYiOYXODVGHGUHQDMH  ; ;



127$
&RORFDUUHFLSLHQWHVEDMRODVYiOYXODVSDUDHYLWDUXQDSRVLEOHFRQWDPLQDFLyQ
PHGLRDPELHQWDO

 &RQMXQWRYHKtFXOR 2EVHUYDUSRVLEOHVIXJDVGHDFHLWH ;  ;
UHIULJHUDQWH\FDUEXUDQWH0LUDU
QLYHOHVHQVXFDVR\UHOOHQDU
7DUHDV&&&& 
 3DVRVILQDOHV  6L VH REVHUYDUDQ SpUGLGDV   ;
FRPSUREDU HO QLYHO GH DFHLWH
7DUHD& 
 &RPSUREDFLyQ \ OLPSLH]D
H[WHULRU VLIXHVHQHFHVDULRGHO
ILOWUR GH YHQWLODFLyQ GHO SDVR
ILQDO
 6L VH KD HIHFWXDGR XQ YDGHR
H[DPLQDU YLVXDOPHQWH HO HVWDGR
GHODFHLWHSXHGHKDEHUHQWUDGR
DJXD
 7UHQGHURGDMH ,QVSHFFLyQGHOHVWDGRJHQHUDOGHO ;  ;
 WUHQGHURGDMH\VXVSHQVLyQ7DUHD
&
 $VLHQWRV\FLQWXURQHVGH  5HYLVDU ; ; ;
VHJXULGDG  /LPSLDUSDUWHVPyYLOHV
  (VFRWLOODV  5HYLVDU ;  ;
 &DMDVGH  /LPSLDUSHVWLOORVHVFRWLOODV
DOPDFHQDMH
 &DMDGHEDWHUtDV
 3ODIRQHV\OXFHV 5HYLVDU&DPELDUOiPSDUDVHQVX  ; ;
H[WHULRUHV FDVR7DUHD&



1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ2EVHUYDFLRQHV -9 $X[ &RQG
 (TXLSRVGH  ,QVSHFFLyQ FDVFRV LQWHUIyQLFRV   
&RPXQLFDFLRQHV 7DUHD&
 /LPSLH]D SROYR  GH ORV FDVFRV
LQWHUIyQLFRV
 /LPSLH]D GH ORV FRQHFWRUHV GH
ORVFDVFRVLQWHUIyQLFRV
 3HULVFRSLRVGH  &RPSUREDUGDxRV   ;
REVHUYDFLyQ  /LPSLDU 7DUHD & YHU ILFKD
GHHVWHPDQXDO 
 3HULVFRSLR3&13 /LPSLDUVLVHKXELHUDXVDGR7DUHD   ;
& YHUILFKDGH
HVWHPDQXDO 
 &RQMXQWRYHKtFXOR 1LYHOGHFDUEXUDQWH5HSRVWDUHQ ; ; ;
VXFDVRWUDVODUHYLVLyQ
 &RQMXQWRYHKtFXOR  /LPSLH]DH[WHULRU7DUHD&$  ; ;
YHU ILFKD  GH HVWH
PDQXDO 
 /LPSLH]D LQWHULRU 7DUHD &%
YHU ILFKD  GH HVWH
PDQXDO 
 5HOOHQDU IRUPXODULRV 
UHFRJLHQGR WRGDV ODV
DQRPDOtDVDYHUtDVGHWHFWDGDV
 %DWHUtDV &RQHFWDUHOPDQWHQHGRUGH   ;
EDWHUtDV


5(680(1

D5HYLVLRQHVFRQHOPRWRUSDUDGR
x 5HYLVDU HO DVSHFWR H[WHULRU WUDWDQGR GH GHVFXEULU GDxRV IDOWDV PDOD FRORFDFLyQ
GHOHTXLSRRGDxRVHQODVFDMDVGHDOPDFHQDMH
x &RPSUREDUODSHUIHFWDDSHUWXUDFLHUUH\EORTXHRGHHVFRWLOODV\SXHUWDV
x &RPSUREDUWRGRVORVSHULVFRSLRVGHREVHUYDFLyQOLPSLDUORV
x &RPSUREDUHVWDGRGHJDQFKRVVLUJDVGHUHPROTXH\DUJROODVGHL]DGR
x &RPSUREDU \ FHUUDU WRGDV ODV YiOYXODV GH GUHQDMH GHO *03 SHUVRQDO \ GH
FRQGXFFLyQ
x &RPSUREDUHOQLYHOGHFRPEXVWLEOHGHORVGHSyVLWRV
x ,QVSHFFLRQDU GHWHULRURV \ SRVLEOHV IXJDV GH ORV HOHPHQWRV GHO WUHQ GH URGDMH \
VXVSHQVLyQ
x &RPSUREDUHOHVWDGRGHOVLVWHPDHOpFWULFRFDMDGHEDWHUtDVFRQH[LRQHV\FDEOHV
x 6LWXDU HQ  ,1735,1%$7(5,$6 \ FRPSUREDU ODV OiPSDUDV GHO SDQHO GH
LQVWUXPHQWRVGHOFRQGXFWRU
x &RPSUREDUHOHVWDGRGHFDUJDGHODVEDWHUtDV
x &RPSUREDUHOIXQFLRQDPLHQWRGHSODIRQHV\OXFHVLQWHULRUHV
x 5HDOL]DUODVFRPSUREDFLRQHVGHOVLVWHPD&,GHODFiPDUDGHO*03
x 5HDOL]DUODVFRPSUREDFLRQHVGHOVLVWHPD&,\$(GHODFiPDUDGHSHUVRQDO



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1$-867(7(16,Ï1&$'(1$

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQWULSXODQWH
$<8'$6$/$,16758&&,Ï1
9HKtFXOR9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

6LWXDUXQYHKtFXORHQXQOXJDUOODQR\FRQEXHQDYLVLELOLGDG8QDYH]TXHHOYHKtFXOR
HVWHGHWHQLGRVHSXHGHSDUDUHOPRWRUGHOPLVPR
6LWXDUDODWULSXODFLyQHQXQRGHORVODWHUDOHVGHOYHKtFXORHQJUXSRVSHTXHxRVFRQ
HOPDWHULDOQHFHVDULRSDUDUHDOL]DUODSUiFWLFD
(O LQVWUXFWRUH[SOLFDUi ODVSDUWHV GHTXHFRQVWDHOVLVWHPDGH WHQVLyQ GH ODFDGHQD
KDFLHQGRKLQFDSLpHQODVYiOYXODVGHFDUJD\GHVFDUJDGHOPLVPR


5(48,6,726$$/&$1=$5

7RGRV ORV WULSXODQWHV GHEHUiQ VDEHU PHGLU OD WHQVLyQ GH OD FDGHQD GHO YHKtFXOR DO
ILQDOL]DUODSUiFWLFD
6HSUHVWDUiHVSHFLDODWHQFLyQDODOLPSLH]DGHODVYiOYXODVGHOVLVWHPDGHWHQVLyQGH
ODFDGHQD
(O LQVWUXFWRU UHDOL]DUi VREUH  SUHJXQWDV UHIHUHQWHV D OD SUiFWLFD D UHDOL]DU 6H
FRQVLGHUDUi TXH HO WULSXODQWH KD VXSHUDGR OD SUiFWLFD VL FRQWHVWD FRUUHFWDPHQWH DO
PHQRVHOGHODVPLVPDV


'(6$552//27(Ï5,&2'(/&217(1,'2

$-867(7(16,Ï1'(/$&$'(1$ 7$5($& 


7$5($&
7DUHD$MXVWHGHODWHQVLyQGHODFDGHQD
3HUVRQDOQHFHVDULR7ULSXODFLyQFRPSOHWD
+HUUDPLHQWD
 'REOHSORPDGD



 *DOJD
 /ODYHILMDPP
 %RPEDPDQXDOGHHQJUDVH
0HGLRVDX[LOLDUHV7UDSRV\UHFLSLHQWHSDUDJUDVDVREUDQWH
&RQVXPLEOHV*UDVDGHXVRJHQHUDO
7LHPSRHVWLPDGRPLQ +[K 

(-(&8&,Ï1

  &RPSUREDUTXHQRHVWiDFWLYDGRHOPHFDQLVPRGHVREUHWHQVLyQGHODFDGHQD
  0RYHU HO YHKtFXOR VREUH XQ WHUUHQR OODQR GXUR \ OLPSLR \ GHMDUOR TXH VH
GHWHQJD VROR VLQ DSOLFDU IUHQRV QL GLUHFFLyQ 8QD YH] GHWHQLGR QR DSOLFDU HO
IUHQRGHDSDUFDPLHQWR
&RORFDUHOKLORGHODSORPDGD  FRQVXFRQWUDSHVRV  VREUHODFDEH]DGHORV
WRUQLOORVGHORVFRQHFWRUHVGHOWUDPRGHFDGHQDFRPSUHQGLGRHQWUHORVURGLOORVž
\ž \ DEDUFDQGRFRQHFWRUHV


)LJXUD0HGLGDGHODWHQVLyQ  

  /LPSLDUHOHQJUDVDGRU  GHOFLOLQGURWHQVRUGHFDGHQD  
  (Q HO FRQHFWRU FHQWUDO HO ž GH ORV QXHYH TXH DEDUFD HO KLOR  LQWURGXFLU OD
JDOJD HQWUH OD FDEH]D GHO WRUQLOOR \ HO KLOR PHGLGRU  /D GLVWDQFLD HQWUH OD
FDEH]DGHOWRUQLOOR\HOKLORPHGLGRUVHUiGH“PP
· 6L OD PHGLGD HV LQIHULRU HV QHFHVDULR GHVWHQVDU OD FDGHQD 3DUD HOOR VH
GHEHDEULUHOWDSyQ  GHGHVFDUJDGHOFLOLQGURWHQVRU\GHMDUVDOLUODJUDVD
KDVWDTXHODPHGLGDVHDODFRUUHFWD
· 6LODPHGLGDHVPD\RUVHUiSUHFLVRWHQVDUODFDGHQD3DUDHOORDFRSODUOD
ERPED PDQXDO GH HQJUDVH FRQ JUDVD GH XVR JHQHUDO DO HQJUDVDGRU GHO
FLOLQGURWHQVRUHLQ\HFWDUKDVWDTXHODPHGLGDVHDODFRUUHFWD






)LJXUD0HGLGDGHODWHQVLyQ  )LJXUD7HQVRUGHODFDGHQD


  0RYHU HO YHKtFXOR \ GHMiQGROR TXH VH GHWHQJD VROR \ FRPSUREDU TXH OD
WHQVLyQHVFRUUHFWD
  8QDYH]DMXVWDGDODWHQVLyQFRPSUREDUVLHQHOFLOLQGURWHQVRUVHPXHVWUDOD
PDUFD FLUFXODU TXH PDUFD HO OtPLWH GH Pi[LPD H[WHQVLyQ 6L HV DVt VHUi
QHFHVDULRTXLWDUXQHVODEyQ\YROYHUDDMXVWDUODWHQVLyQ6LHVWDRSHUDFLyQ\D
VHKXELHUDHIHFWXDGRHVQHFHVDULRFDPELDUODFDGHQD


5(680(1

x 6LWXDU HO YHKtFXOR VREUH WHUUHQR OODQR \ GHMDUOR TXH VH GHWHQJD VLQ DSOLFDU
QLQJ~Q WLSR GH IUHQR QL JLUR GH OD GLUHFFLyQ QR DSOLFDU HO IUHQR GH
DSDUFDPLHQWR 
x /LPSLDUODYiOYXODGHOOHQDGRGHOFLOLQGURWHQVRU
x &RORFDU OD FXHUGD FRQ SHVRV VREUH XQ WUDPR GH  FRQHFWRUHV FRPSUHQGLGRV
HQWUHHOž\žURGLOORGHDSR\R
x 0HGLU FRQ OD JDOJD OD GLVWDQFLD HQWUH HO FRQHFWRU FHQWUDO ž  \ OD FXHUGD /D
GLVWDQFLDGHEHVHUGHPP
x &XDQGR OD PHGLGD VHD LQIHULRU OD FDGHQD HVWi WHQVD \ KD\ TXH GHVWHQVDUOD
$EULUHPRV OD YiOYXOD GH GHVFDUJD \ GHMDUHPRV TXH VDOJD OD JUDVD KDVWD
DOFDQ]DUODPHGLGDFRUUHFWD
x 6L OD PHGLGD HV PD\RU OD FDGHQD HVWi PX\ GHVWHQVDGD \ HV SUHFLVR GDUOH
WHQVLyQ$FRSODUHPRVODERPEDGHHQJUDVHPDQXDODODYiOYXODGHOOHQDGRGHO
FLOLQGURWHQVRUHLQWURGXFLUHPRVJUDVDKDVWDDOFDQ]DUODPHGLGDFRUUHFWD
x 0RYHUHPRV HO YHKtFXOR \ GHMDUHPRV TXH VH GHWHQJD VROR QXHYDPHQWH VLQ
DSOLFDU IUHQRV QL JLURV GH OD GLUHFFLyQ &RPSUREDUHPRV QXHYDPHQWH TXH OD
WHQVLyQHVODFRUUHFWD
x 6L VREUH HO FLOLQGUR WHQVRU VH SXHGH YHU XQD PXHVFD FLUFXODU VHUi QHFHVDULR
TXLWDUXQHVODEyQ\YROYHUDDMXVWDUODWHQVLyQGHODFDGHQD

35È&7,&$6




),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1&257(<81,Ï1'(81$&$'(1$

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQ7ULSXODFLyQ
$<8'$6$/$,16758&&,Ï1
8QYHKtFXOR9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

6LWXDUXQYHKtFXORHQXQOXJDUOODQR\FRQEXHQDYLVLELOLGDG
&RORFDU OD KHUUDPLHQWD QHFHVDULD SDUD OD FRQH[LyQ \ GHVFRQH[LyQ GH OD FDGHQD HQ
XQOXJDUDFFHVLEOH
6H DJUXSDUiQ HQ HTXLSRV GH QR PiV GH  WULSXODQWHV SDUD UHDOL]DU ODV WDUHDV
DVLJQDGDV


5(48,6,726$$/&$1=$5

/D WULSXODFLyQ GHEHUi FRQRFHU WRGD OD KHUUDPLHQWD UHODFLRQDGD FRQ OD FRQH[LyQ \
GHVFRQH[LyQGHODFDGHQD
/DWULSXODFLyQGHEHUiVDEHUFRQHFWDU\GHVFRQHFWDUFRUUHFWDPHQWHODFDGHQD
6H FRQVLGHUDUi TXH OD WULSXODFLyQ KD DOFDQ]DGR ORV FRQRFLPLHQWRV PtQLPRV
UHTXHULGRVFXDQGRUHDOLFHFRUUHFWDPHQWHHOGHODVWDUHDVHQFRPHQGDGDV


'(6$552//27(Ï5,&2'(/&217(1,'2

&257('(81$&$'(1$ 7$5($& 


7$5($&
7DUHD'HVFRQH[LyQGHODFDGHQD
3HUVRQDOQHFHVDULR&RQGXFWRU\7LUDGRU
+HUUDPLHQWD
 /ODYHILMDGHPP
 /ODYHGHFDUUDFDô´
 /ODYHGHYDVRGHPP
 %DUUDH[WUDFWRUDGHFRQHFWRUHV
 0DUWLOORGH.J
0HGLRVDX[LOLDUHV


 *XDQWHVGHWUDEDMR
 5HFLSLHQWHGHUHFRJLGDGHJUDVD
 7UDSRV
&RQVXPLEOHV
7LHPSRHVWLPDGRPLQ +[K 

(-(&8&,Ï1

3(/,*52
$/62/7$5/26&21(&725(6/$63$57(6683(5,25(,1)(5,25'(/$
&$'(1$68%(1<%$-$1&219,2/(1&,$(9,7$548(+$<$3(5621$/
(1/$',5(&&,Ï1'(/029,0,(172'(/$&$'(1$$/6(3$5$5/$2(1
/$75$<(&725,$'(6$/,'$'(/&21(&725

  /LEHUDUHOIUHQRGHDSDUFDPLHQWR
  'HVWHQVDU FRPSOHWDPHQWH OD FDGHQD DEULHQGR FRQ OD OODYH ILMD GH  PP HO
WDSyQGHGHVFDUJD )LJQž GHOFLOLQGURWHQVRU\GHMDQGRVDOLUODJUDVD



)LJXUD7DSyQGHGHVFDUJD


  /D FDGHQD VH GHEH GHVFRQHFWDU HQ XQ HVODEyQ SUy[LPR D OD UXHGD WHQVRUD
FRPSUHQGLGRHQWUHHOOD\OD~OWLPDUXHGDGHURGDMH
  ([WUDHUORVWRUQLOORVGHORVFRQHFWRUHVH[WHULRUHV
  ([WUDHUORVFRQHFWRUHVHQHOVLJXLHQWHRUGHQ )LJV\ 
D &RQ OD EDUUD H[WUDFWRUD GH FRQHFWRUHV PRYHU KDFLD IXHUD HO FRQHFWRU
LQWHULRUPPDSUR[LPDGDPHQWH
E ([WUDHUHOFRQHFWRUH[WHULRU
F ([WUDHUHOFRQHFWRULQWHULRU
G ([WUDHUHOWRUQLOORGHOFRQHFWRUFHQWUDO\UHWLUDUpVWH





)LJXUD([WUDFFLyQGHFRQHFWRUHV  



)LJXUD([WUDFFLyQGHFRQHFWRUHV  

&21(;,Ï1'(/$&$'(1$ 7$5($& 

7$5($&
7DUHD&RQH[LyQGHODFDGHQD
3HUVRQDOQHFHVDULR&RQGXFWRU\7LUDGRU
+HUUDPLHQWD
 *UDSDVGHVXMHFLyQ
 *DWRV
 0DUWLOORGH.J
 /ODYHGHFDUUDFDô´
 /ODYHGHYDVRGHPP
 /ODYHGLQDPRPpWULFD
0HGLRVDX[LOLDUHV
&RQVXPLEOHV*UDVD\DFHLWHGHPRWRU
7LHPSRHVWLPDGRPLQ +[K 



(-(&8&,Ï1 )LJV\ 

  &RORFDU ORV JDWRV   HQ ORV H[WUHPRV H[WHULRUHV GH ORV SDVDGRUHV GH ORV
HVODERQHVSDUDGHMDUVLWLRDODVJUDSDVGHVXMHFLyQGHORVHVODERQHV
  $FFLRQDUVLPXOWiQHDPHQWHORVGRVJDWRVKDVWDTXHORVHVODERQHVVHWRTXHQ
  6LQJROSHDUODVPRQWDUHQFDGDODGRXQDJUDSDGHVXMHFLyQ  HQWUHHOJDWR
\HOODWHUDOGHOHVODEyQ
  $IORMDU\TXLWDUORVJDWRV
  0RYHUHOYHKtFXORKDFLDDGHODQWHKDVWDTXHHOHVODEyQVXSHULRUGHOSXQWRGH
FRUWH GH OD FDGHQD DSR\H VREUH OD UXHGD WHQVRUD \ HO LQIHULRU QR OOHJXH D
WRFDUODUXHGD
  $OLQHDU ORV GRV SDVDGRUHV GHO HVODEyQ FRQ D\XGD GH XQD SDODQFD VL HV
QHFHVDULR H LQWURGXFLU ORV FRQHFWRUHV H[WHULRUHV   JROSHDQGR FRQ XQ
PDUWLOORKDVWDTXHHVWpQDXQRVPPGHODVJUDSDVGHVXMHFLyQ  
  'HVPRQWDUODVJUDSDVGHVXMHFLyQ  GHORVGRVODGRVGHORVHVODERQHV
  $FDEDUGHLQWURGXFLUORVFRQHFWRUHVKDVWDTXHKDJDQWRSHFRQHOHVODEyQGH
PRGR TXH OD FDUD H[WHULRU GH ORV RULILFLRV   HVWp D OD PLVPD DOWXUD TXH OD
VXSHUILFLHGHORVH[WUHPRVGHORVSDVDGRUHVGHORVHVODERQHV  
  0RQWDU ORV WRUQLOORV GH ORV FRQHFWRUHV SULPHUR HO LQWHULRU \ GHVSXpV HO
H[WHULRUXQWDQGRSUHYLDPHQWHODURVFD\ODVXSHUILFLHGHFRQWDFWRFRQJUDVD
0ROLNRWH%5RFRQDFHLWHPRWRU\GiQGROHVXQSDUGHDSULHWHFRQODOODYH
GLQDPRPpWULFDGH1P
  0RYHU HO YHKtFXOR KDFLD DWUiV KDVWD TXH HO SXQWR GH FRUWH GH OD FDGHQD VH
HQFXHQWUHHQWUHODUXHGDWHQVRUD\OD~OWLPDUXHGDGHURGDMH
  0RQWDUHOFRQHFWRUFHQWUDO  FRQVXWRUQLOORXQWDQGRSUHYLDPHQWHODURVFD\
OD VXSHUILFLH GH FRQWDFWR FRQ JUDVD 0ROLNRWH R FRQ DFHLWH PRWRU SDU GH
DSULHWH1P 
  0DUFDUFRQWL]DHOSXQWRGHXQLyQGHODFDGHQDSDUDVXSRVWHULRUUHDSULHWH
  $MXVWDUODWHQVLyQGHFDGHQD7DUHD&
  'HVSXpV GH KDEHU UHFRUULGR XQD GLVWDQFLD GH  D  NP GHEHQ UHDSUHWDUVH
ORVWRUQLOORVGHORVFRQHFWRUHVDVXSDUGH1P




 
)LJXUD&RQH[LyQGHODFDGHQD )LJXUD&RQH[LyQGHODFDGHQD
   


5(680(1

(QHVWDILFKDVHGHVFULEHQORVSDVRVDVHJXLUSRUODWULSXODFLyQSDUDHOFRUWH\XQLyQ
GHXQDFDGHQDGHOYHKtFXORQRVHFRQVLGHUDQHFHVDULRUHDOL]DUUHVXPHQ


35È&7,&$6

/D WULSXODFLyQ HQ JUXSRV SHTXHxRV QR PiV GH   UHDOL]DUi WDQWDV YHFHV FRPR VHD
QHFHVDULRKDVWDTXHHOLQVWUXFWRUFRQVLGHUHTXHODWULSXODFLyQGRPLQDODPDWHULDOD
FRQH[LyQ \ GHVFRQH[LyQ GH OD FDGHQD SXGLHQGR VLPXOWDQHDUVH DPERV ODGRV GHO
YHKtFXORVLVHGLVSRQHGHKHUUDPLHQWDVVXILFLHQWHV

 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1&$0%,2'(81(6/$%Ï1<'(81$=$3$7$

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFR3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVWULSXODFLyQ
$<8'$6$/$,16758&&,Ï1
8QYHKtFXOR9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

6LWXDUXQYHKtFXORHQXQOXJDUOODQR\FRQEXHQDYLVLELOLGDG
6HGLVSRQGUiDOODGRGHOYHKtFXORGHOXWLOODMH\KHUUDPLHQWDVQHFHVDULDVSDUDFRUWDU\
WHQVDUFDGHQD


5(48,6,726$$/&$1=$5

(O LQVWUXFWRU GHEH UHDOL]DUOH QR PHQRV GH  SUHJXQWDV UHIHUHQWHV DO HVWDGR \
FDPELRVGHORVHVODERQHV\GHODV]DSDWDV
6HFRQVLGHUDUiVXSHUDGDODSUXHEDFXiQGRHOVROGDGRFRQWHVWHPiVGHOGHODV
SUHJXQWDVFRUUHFWDPHQWH

'(6$552//27(Ï5,&2'(/&217(1,'2

 &20352%$&,Ï1 '( (67$'2 < &$0%,2 '( 81 (6/$%Ï1 '( /$
&$'(1$ 7$5($& 

7$5($&
7DUHD&RPSUREDFLyQGHOGHVJDVWHGHFRPSRQHQWHVGHOWUHQGHURGDMH
3HUVRQDOQHFHVDULR&RQGXFWRU\-HIHGH9HKtFXOR
+HUUDPLHQWD
0HGLRVDX[LOLDUHV
&RQVXPLEOHV
7LHPSRHVWLPDGRPLQ +[K 


(-(&8&,Ï1





127$
/DFRQGHQDGHHOHPHQWRVGHOWUHQGHURGDMHWDOHVFRPRUXHGDVSURSXOVRUDV
HVODERQHVRFDGHQDTXHLPSOLTXHQURWDFLyQRVXVWLWXFLyQHVUHVSRQVDELOLGDGGHOž
HVFDOyQ/DWULSXODFLyQLQIRUPDUiDOPLVPRGHORVQLYHOHVGHGHVJDVWHGHORVGLVWLQWRV
HOHPHQWRV


$  &$'(1$
 3DUDREWHQHUXQGHVJDVWHXQLIRUPHHOVHQWLGRGHPDUFKDGHODFDGHQDGHEH
FDPELDUVHFDGDNP
 8QDFDGHQDGHEHFDPELDUVHFXDQGRVHKDHVWLUDGRGHWDOPDQHUDTXHVHD
QHFHVDULRTXLWDUXQVHJXQGRHVODEyQSDUDSRGHUWHQVDUODFRQYHQLHQWHPHQWH

%  58('$35238/625$
&XDQGRHOGHVJDVWHGHOGLHQWHGHODV
FRURQDVVHVLW~DWDQJHQWHDOSDUGHRULILFLRV
PDUFDGRVHQXQGLHQWH )LJ VLJQLILFD
TXHODFRURQDHVWiGHVJDVWDGD\KDGHVHU
GDGDODYXHOWDRVXVWLWXLGDVL\DVHKXELHUD
KHFKRDQWHULRUPHQWH




 
 )LJXUD0DUFDVGHGHVJDVWHGH
 ODUXHGDSURSXOVRUD


127$
6LHPSUHTXHVHFDPELHHOVHQWLGRGHODVFRURQDVGHEHFDPELDUVHHOVHQWLGRGHODV
FDGHQDV

&  ',(17(6*8Ë$
/RVGLHQWHVJXtDWLHQHQXQGHVJDVWHPX\UHGXFLGR\QRVHPLGH1RREVWDQWHVLVH
REVHUYDVHQGHIRUPDFLRQHVRXQGHVJDVWHDQRUPDOFRPRDSDUHFHHQODILJXUD
VHSRQGUiHQFRQRFLPLHQWRGHOž(VFDOyQSDUDVXHYDOXDFLyQ


 
 
)LJXUD'HVJDVWHGHOGLHQWHJXtD)LJXUD'HVJDVWHGHOGLHQWHJXtD





'  =$3$7$6'(*20$
&RPSUREDUHOGHVJDVWHGHODV]DSDWDV )LJQž 6LHOGHVJDVWHHVH[FHVLYR\
DOFDQ]DODVJDUUDVGHOD]DSDWD )LJQž HOHVODEyQGHMDUiWUD]RVHQOD
FDUUHWHUD1RPRYHUQXQFDHOYHKtFXORHQHVWDVFRQGLFLRQHVKDVWDFDPELDUODV
]DSDWDVTXHFRUUHVSRQGDQ
/DYLGDHVWLPDGDGHODV]DSDWDVGHJRPDHVGH.P
3DUDVXVWLWXLUODWRWDOLGDGGHODV]DSDWDVVHUHFRPLHQGDHIHFWXDUODRSHUDFLyQFRQOD
FDGHQDTXLWDGD


 
)LJXUD'HVJDVWHGHODV]DSDWDV )LJXUD=RQDVGHGHVJDVWHGHORV
GHJRPD HVODERQHV


(  (6/$%21(6
&RPSUREDUHOGHVJDVWHGHOHVODEyQREVHUYDQGRODV]RQDVVHxDODGDVSRUODV
IOHFKDV )LJ 6LVHSXHGHYHUHOFDVTXLOORGHJRPDGHOSDVDGRUGHOHVODEyQ
GHEHFDPELDUVHHOHVODEyQ
&DPELRGHPiVGHHVODERQHVLPSOLFDFDPELDUODFDGHQD

)  &20352%$&,Ï1'(/'(6*$67('(/$658('$6'(52'$-(<52',//26
%$1'$6'(52'$-(
'HEHQVXVWLWXLUVHODVUXHGDV
 &RQDSODQDPLHQWRVVXSHULRUHVD
PP
 6L HO GHVSUHQGLPLHQWR GH OD
EDQGD HQ XQ VROR WUDPR VXSHUD
ORV  FP XQ SDOPR GH PDQR
DSUR[  \ ORV  PP GH
SURIXQGLGDG FRQWURODU FRQ XQ
GHVWRUQLOODGRU 
 0iV GH  KHQGLGXUDV HQ WRGD OD
FLUFXQIHUHQFLDGHODEDQGD
 )LJXUD$SODQDPLHQWRV





)LJXUD'HVSUHQGLPLHQWRV


)LJXUD+HQGLGXUDV
$1,//2$17,'(6*$67(
(VWDVUXHGDVVRQXWLOL]DEOHVPLHQWUDVHODQLOORDQWLGHVJDVWHFXEUHHQWHUDPHQWH\HQ
WRGDVXDQFKXUDODFLUFXQIHUHQFLD1RGHEHVHUYLVLEOHHOPDWHULDOEiVLFRGHODOODQWD
PiVFODUR 1RVRQSHUPLVLEOHVUXHGDVGHVSRUWLOODGDGDVVREUHWRGDODDQFKXUDGHO
DQLOOR



)LJXUD'DxRV\GHVSUHQGLPLHQWRVGHODQLOORGHGHVJDVWH



//$17$6
(VWDVUXHGDVVRQUHFKD]DEOHVVLODVOODQWDV
 (VWiQDEROODGDV
 7LHQHQJULHWDV
 7LHQHQORVWDODGURVGHILMDFLyQRYDODGRV


&20352%$&,Ï1'((67$'2<&$0%,2'(81$=$3$7$ 7$5($& 

7$5($&
7DUHD&DPELRGHODV]DSDWDV
3HUVRQDOQHFHVDULR&RQGXFWRU\7LUDGRU
+HUUDPLHQWD
 %RWDGRUH[WUDFWRUGH]DSDWDV
 %DUUDH[WUDFWRUD
 ÒWLOGHPRQWDMHGH]DSDWDV
 0DUWLOORGH.J
0HGLRVDX[LOLDUHV
&RQVXPLEOHV=DSDWD
7LHPSRHVWLPDGRPLQ]DSDWD +[K 

(-(&8&,Ï1
$  (;75$&&,Ï1
  ,QWURGXFLU HO ERWDGRU )LJ  Qž  SRU OD DEHUWXUD GHO HVODEyQ
D\XGiQGRVH GH XQ PDUWLOOR KDVWD TXH HOHYH OD OHQJHWD PXHOOH GH OD
]DSDWD



)LJXUD([WUDFFLyQGHOD]DSDWD


  3RQHU OD EDUUD H[WUDFWRUD GH ]DSDWDV )LJ  Qž   HQ HO HVSDFLR
FRPSUHQGLGRHQWUHODV]DSDWDV\DSDODQFDUKDFLDHOH[WHULRUSDUDVDFDUpVWD





)LJXUD([WUDFFLyQGHOD]DSDWD  

%  0217$-(
  /LPSLDUODVUDQXUDVJXtDGHOHVODEyQ
  &RQ OD OHQJHWD PXHOOH )LJ  Qž   RULHQWDGD KDFLD HO H[WHULRU
FRORFDU OD ]DSDWD QXHYD HQIUHQWDGR VXV JXtDV )LJ  Qž   D ODV
UDQXUDVGHILMDFLyQGHOHVODEyQ )LJQž 


 
)LJXUD0RQWDMHGHOD]DSDWD )LJXUD0RQWDMHGHOD]DSDWD  
 

  &RQXQPDUWLOORJROSHDUHO~WLOGHPRQWDMHGH]DSDWDVKDVWDTXHDJDUUH
HOPXHOOH )LJ 




 
)LJXUD0RQWDMHGHOD]DSDWD )LJXUD=DSDWDGHDJDUUH
  


127$
6LSRUQHFHVLGDGKXELHUDTXHPRQWDU]DSDWDVGHDJDUUH )LJ VHPRQWDUiXQ
MXHJRSRUFDGDDHVODERQHVHQIXQFLyQGHODXPHQWRGHWUDFFLyQTXHVHGHVHH



127$
6LHQXQDFDGHQDFRQ]DSDWDVSDUFLDOPHQWHJDVWDGDVKD\TXHVXVWLWXLU]DSDWDVHO
HVSHVRUGHpVWDVGHEHDMXVWDUVHDOGHODVXVDGDV


5(680(1

(QHVWDILFKDVHGHVFULEHQORVSDVRVDVHJXLUSRUODWULSXODFLyQSDUDHOFDPELRGHXQ
HVODEyQ\XQD]DSDWDGHODFDGHQDGHOYHKtFXORQRVHFRQVLGHUDQHFHVDULRUHDOL]DU
UHVXPHQ


35È&7,&$6

3DUDODUHDOL]DFLyQGHHVWDSUiFWLFDVHUiQQHFHVDULRVPLHPEURVGHODWULSXODFLyQ
\DTXHODVWDUHDVDUHDOL]DUSDUDFDPELDUXQHVODEyQFRQOOHYDODSUiFWLFDGHFRUWH\
XQLyQGHXQDFDGHQDDVtFRPRODGHVXSRVWHULRUWHQVDGR
/DHYDOXDFLyQSUiFWLFDVHKDUiSRUJUXSRVGHPLHPEURVFRQVLVWLHQGRHQUHDOL]DUQ
SULPHUOXJDUHOFRUWHGHODFDGHQDSRVWHULRUPHQWHUHDOL]DUHOFDPELRGHXQHVODEyQ\
ILQDOL]DQGRFRQODXQLyQ\WHQVDGRGHODFDGHQD
6HSURFHGHUiDOGHVPRQWDMH\SRVWHULRUPRQWDMHGHXQD]DSDWD

 




),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï10$17(1,0,(172'(/$7255(5(9,6,Ï10(168$/

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFD3UiFWLFD $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQXWRVDOXPQRV
$<8'$6$/$,16758&&,Ï1
9&,&3,=$552
3UHVHQWDFLRQHVYLGHRV\RDQLPDFLRQHV

%,%/,2*5$)Ë$
0DQXDO7pFQLFR070DQXDOGHODWULSXODFLyQ



&21',&,21(6'((-(&8&,Ï1

6LWXDUXQYHKtFXORFRQHOPRWRUSDUDGRHQXQOXJDUGHVSHMDGR\OXPLQRVR
/RV WULSXODFLyQ VH FRORFDUiQ D XQ FRVWDGR GHO YHKtFXOR \ HO LQVWUXFWRU UHDOL]DUi OD
H[SOLFDFLyQGHODILFKD
3RUVHUODUHYLVLyQPHQVXDOODWDUHDGHPDQWHQLPLHQWRSUHYHQWLYRGHžHVFDOyQSRU
H[FHOHQFLD HO LQVWUXFWRU SXHGH GLYLGLU OD ILFKD HQ ODV SDUWHV TXH FRQVLGHUH
GHSHQGLHQGRGHODLQVWUXFFLyQLQLFLDOGHOHYDOXDGR
/RV HTXLSRV PHFiQLFRV GH ž (VFDOyQ VXSHUYLVDUiQ FRPSOHPHQWDUiQ R UHDOL]DUiQ
ODV WDUHDV TXH VREUHSDVHQ ORV PHGLRV \ FRQRFLPLHQWRV GH OD WULSXODFLyQ VL IXHUD
QHFHVDULR

5(48,6,726$$/&$1=$5

6HHQWUHJDUiDOWULSXODFLyQXQDEDWHUtDGHSUHJXQWDVUHODFLRQDGDVFRQODILFKDHQOD
TXHKDEUiDOUHGHGRUSUHJXQWDV/RVHYDOXDGRVGHEHUiQVDEHUUHDOL]DUODUHYLVLyQ
PHQVXDO FRUUHFWDPHQWH SDUD OR FXDO GHEHUiQ UHVSRQGHU FRUUHFWDPHQWH QR PHQRV
GHOGHODVSUHJXQWDVTXHOHIRUPXOHHOLQVWUXFWRU

'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

/DUHYLVLyQPHQVXDOFRPSUHQGH
 5HYLVLyQGHVHUYLFLRFRPSOHWD
 7DUHDVFRPSOHPHQWDULDVPHQVXDOHV

1RWD$XQTXHVHUHODFLRQDUiQHQORVVLJXLHQWHVFXDGURVODVUHYLVLRQHVPHQVXDOHV
GHODUPDPHQWRVHGHWDOODQHQODVILFKDVDGHHVWHPDQXDO




5(9,6,Ï1'(6(59,&2

D&ULWHULRVGHDSOLFDFLyQGHODUHYLVLyQGHVHUYLFLR

'DGRHOJUDQQ~PHURGHWHVWLJRVDYLVDGRUHVGHDYHUtDVGHTXHGLVSRQHHOYHKtFXOR
ODVUHYLVLRQHVGHVHUYLFLRUHVSRQGHQDORVVLJXLHQWHVFULWHULRV
 /LPLWDU ODV FRPSUREDFLRQHV DQWHV GHO VHUYLFLR D DTXHOODV RSHUDFLRQHV
HVHQFLDOHV SDUD OD VHJXULGDG GHO YHKtFXOR R OD WULSXODFLyQ /DV DYHUtDV
GHILFLHQFLDV\GHWHULRURVGHWHFWDGRVWUDVHOVHUYLFLRKDQGHELGRFRUUHJLUVHSRU
ORTXHHOYHKtFXORGHEHHVWDUHQSHUIHFWDVFRQGLFLRQHV
 'XUDQWHHOVHUYLFLRHVPX\LPSRUWDQWHHOFRQWUROGHOIXQFLRQDPLHQWRGHWRGRV
ORVVLVWHPDV(QORVDOWRVRGHVFDQVRVODFRPSUREDFLyQGHOWUHQGHURGDMHHV
HVHQFLDO SDUD HYLWDU HO DJUDYDPLHQWR GH DYHUtDV /DV DYHUtDV GHWHFWDGDV R
VXUJLGDV GXUDQWH HO VHUYLFLR TXH SXGLHVHQ DFDUUHDU XQ DJUDYDPLHQWR GH ODV
PLVPDVRTXHSXGLHVHQDIHFWDUDRWURVVLVWHPDVGHEHQVXSRQHUODVXVSHQVLyQ
GHOPLVPR\HOUHJUHVRDODEDVH6LVHSURGXFHHQFRPEDWHGHEHUiUHWLUDUVH
VL OD VLWXDFLyQ OR SHUPLWLHUD HVSHFLDOPHQWH DTXHOODV DYHUtDV TXH SXGLHVHQ
FRPSURPHWHUODPRYLOLGDG
 ([WUHPDU ODV FRPSUREDFLRQHV GHVSXpV GHO VHUYLFLR \ HMHFXWDUODV
PLQXFLRVDPHQWH 1R GHEH SDVDUVH SRU DOWR QLQJXQD DQRPDOtD R DYHUtD GH
PRGR TXH SXHGDQ FRUUHJLUVH \ TXH HO YHKtFXOR TXHGH FXDQWR DQWHV HQ
FRQGLFLRQHVRSHUDWLYDV
 5HOOHQDU\FXUVDUORVIRUPXODULRVFRUUHVSRQGLHQWHVDODVDQRPDOtDVR
DYHUtDV TXH VH KD\DQ GHWHFWDGR (VWH UHTXLVLWR UHVXOWD LPSUHVFLQGLEOH D OD
KRUDGHFRQVLGHUDUSDVDGDXQDUHYLVLyQ


127$
/DH[SHULHQFLDSXHGHGLFWDUODDGLFLyQRHOLPLQDFLyQGHDOJXQDFRPSUREDFLyQGHODV
FRQWHPSODGDVHQODV5HYLVLRQHVGHHU(VFDOyQDXQTXHVLHPSUHUHVSHWDQGRORV
FULWHULRVDQWHVDSXQWDGRV


E&RPSUREDFLRQHVDQWHVGHOVHUYLFLR

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
$027253$5$'2
 (TXLSR\ORWHGHDERUGR $VHJXUDUVHTXHQDGDHVWp ; ; 
IXHUDGHOXJDU
 &RQMXQWR7RUUH ,QVSHFFLyQJHQHUDOH[WHULRU ; ; 
7DUHD7$
 (VFRWLOODV &RPSUREDUHQFODYDPLHQWRV ; ; 
\FDEOHGHVHJXULGDG7DUHD
7%
 &DxyQ\$0 5HWLUDUWDSDERFDVVLVH  ; 
IXHUDDUHDOL]DUWLUR
 (VFXGRVEDOtVWLFRV $EULU   



1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
 (OHPHQWRVySWLFRV\RFXODUHV  (OLPLQDUSROYR  ; 
GHSXQWHUtD  &RPSUREDU LQGLFDGRUHV
GHKXPHGDG7DUHD7
)
 /LPSLDU HQ VX FDVR
7DUHD7
 7ULQFDVGHGLUHFFLyQ\ /LEHUDU  ; 
HOHYDFLyQ
 0DPSDURV\UHJLVWURVGHOD 5HYLVDUFLHUUHV7DUHD7  ; 
FiPDUDGHDUPDV '
 3XHUWDVFRUUHGHUDV\ 5HYLVDUFLHUUHV7DUHD7  ; 
SURWHFWRUHVGHODFHVWD %
 $VLHQWRV\FLQWXURQHVGH $MXVWDU ; ; 
VHJXULGDG
&21(/02725(10$5&+$
 6LVWHPDV  (MHFXWDU 7DUHD 7
6XVWLWXLUOiPSDUDVHQVX
FDVR7DUHD7 ; ; 
 (MHFXWDU HO 7(67
$8720È7,&2
 'LUHFFLyQGH7LUR  (MHFXWDU OD SUXHED GH OD
'7
 ; 
 (MHFXWDU OD SUXHED GH OD
&7
 &LUFXLWRGHGLVSDURGHOFDxyQ &RPSUREDU7DUHD7 ; ; 
 &LUFXLWRGHGLVSDURGHOD$0 &RPSUREDU7DUHD7 ; ; 
 0HFDQLVPRGHDUPDGRGHO &RPSUREDU7DUHD7 ; ; 
FLHUUH
 3HULVFRSLRGHO-9  5HYLVDU HVWDGR \ ;  
IXQFLRQDPLHQWR
 &RPSUREDU
IXQFLRQDPLHQWR GHO
HTXLSRGHODYDGR
 (TXLSRGHFRPXQLFDFLRQHV &RPSUREDUIXQFLRQDPLHQWR ; ; ;
WDPELpQLQWHUYLHQHHO
-(&3 

F2SHUDFLRQHV\FRPSUREDFLRQHVDQWHVGHOWLUR YHUILFKDV
\ 

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
&$fÏ10.
 &RQMXQWR&DxyQ ,QVSHFFLyQGHOFRQMXQWR7DUHD7 ; ; 

 7XER 5HYLVDU\OLPSLDU7DUHD7 ; ; ;
 'REOHDOLPHQWDGRU 5HYLVDU\OLPSLDU7DUHD7 ; ; 
 &LHUUH 5HYLVDU\OLPSLDU7DUHD7  ; 
 &DMyQGHORVPHFDQLVPRV 5HYLVDU\OLPSLDU7DUHD7 ; ; 



1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG

3(/,*52
$6(*85$56('(48((/3$6$'25'(),-$&,Ï1'(/&$-Ï1'(
/260(&$1,6026$/0(&$1,602'()5(12<5(&83(5$&,Ï1
48('$&255(&7$0(17(,167$/$'2
(QFDVRFRQWUDULRHOFDMyQGHORVPHFDQLVPRVVHGHVSUHQGHUiGXUDQWH
HOWLURSXGLHQGRSURGXFLUVHOHVLRQHVDODWULSXODFLyQ\JUDYHVDYHUtDVHQ
HOFDxyQ
 &RPSUREDFLyQGHORV  5HYLVDU7DUHD7 ; ; 
PHFDQLVPRV\HOHPHQWRV  /LPSLDU \ DFHLWDU ORV URGLOORV
GHDOLPHQWDFLyQ\ GH ORV FDUJDGRUHV GH
H[SXOVLyQ PXQLFLyQ FRQ XQ WUDSR OLPSLR
HPSDSDGR FRQ DFHLWH \
DFHLWDUORVOLJHUDPHQWH
 /LPSLDU \ DFHLWDU OLJHUDPHQWH
ODVJXtDVIOH[LEOHV
$0(75$//$'25$&2$;,$/
 &RQMXQWR$0 ,QVSHFFLyQ\OLPSLH]D  ; 
 &DUJDGRUHVGHPXQLFLyQ\  5HYLVDU7DUHD7  ; 
DOPDFpQGHFDUJD  /LPSLDU
/$1=$,1*(1,26
 7XERV &RPSUREDFLyQ\OLPSLH]DGHORV ; ; 
WXERV7DUHD7
 &LUFXLWRGHGLVSDUR  &RPSUREDU7DUHD7 ; ; 
 &DPELDU FRQWDFWRV HQ VX 
FDVR7DUHD7 
 &DPELDU IXVLEOH GH OD FDMD GH
FRQWUROHQVXFDVR7DUHD7


F2SHUDFLRQHVWUDVHIHFWXDUGLVSDURV YHUILFKDV
\ 

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
&$fÏ10.
 &LHUUH  ([WUDHU GHVDUPDU \ OLPSLDU ; ; 
7DUHD7
 5HYLVDU YLVXDOPHQWH WRGRV VXV
FRPSRQHQWHV
 /XEULFDU\YROYHUDPRQWDU
 &DMyQGHORV /XEULFDUODVJXtDVGHOFLHUUH  ; 
PHFDQLVPRV

G2SHUDFLRQHVGHVSXpVGHXQDMRUQDGDGHWLUR YHUILFKDV
\ 

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
&$fÏ10.



1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
 &LHUUH  ([WUDHU GHVDUPDU \ OLPSLDU ; ; 
7DUHD7
 5HYLVDU YLVXDOPHQWH WRGRV VXV
FRPSRQHQWHV
 /XEULFDU\YROYHUDPRQWDU
 &DMyQGHORV /XEULFDUODVJXtDVGHOFLHUUH  ; 
PHFDQLVPRV
 7XER\IUHQRGHERFD /LPSLDULQWHULRU\H[WHULRUPHQWH ; ; ;
7DUHD7

H2SHUDFLRQHVGHVSXpVGHXQSURJUDPDGHWLUR YHUILFKDV
\ 

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
&$fÏ10.
 'REOHDOLPHQWDGRU ([WUDHU\OLPSLDUVXSHUILFLHV7DUHD ; ; 
7
 &DMyQGHORV  ([WUDHU OLPSLDU VXSHUILFLHV \ ; ; 
PHFDQLVPRV JXtDVGHOFLHUUH7DUHD7
 5HFXSHUDGRUHVGHO  ([WUDHU DPEDV XQLGDGHV \ ; ; 
FLHUUH OLPSLDUPXHOOHVUHFXSHUDGRUHV\
PDQJXLWRV
 /XEULFDU
 &LHUUH  ([WUDHU GHVDUPDU \ OLPSLDU ; ; 
7DUHD7
 5HYLVDU YLVXDOPHQWH WRGRV VXV
FRPSRQHQWHV
 /XEULFDU\YROYHUDPRQWDU
 /XEULFDUJXtDVGHGHVOL]DPLHQWR
 7XER\IUHQRGHERFD /LPSLDULQWHULRU\H[WHULRU7DUHD7 ; ; ;

 *XtDV\WROYDV ([WUDHUOLPSLDU  ; 
$0(75$//$'25$&2$;,$/
 $UPD ,QVSHFFLyQOLPSLH]D\HQJUDVH  ; 
 &DUJDGRUHVGHPXQLFLyQ  5HYLVDU7DUHD7  ; 
\DOPDFpQGHFDUJD  /LPSLDU
/$1=$,1*(1,26
 7XERV &RPSUREDFLyQ\OLPSLH]DGHORV ; ; 
WXERV7DUHD7

H'HVSXpVGHOVHUYLFLRRSDXVDVSURORQJDGDVHQ2SHUDFLRQHV

1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
 &RQMXQWRWRUUH ,QVSHFFLyQJHQHUDOH[WHULRU7DUHD7 ; ; 
$
 (OHPHQWRVGH /LPSLH]D7DUHD7  ; 
SXQWHUtD
 (VFXGRVEDOtVWLFRV &HUUDU ; ; 
 &RQMXQWRWRUUH /LPSLH]DLQWHULRU  ; 


1ž 6LVWHPDHOHPHQWR 2SHUDFLyQ -9 7LU &RQG
 (VFRWLOODV  /LPSLH]D GH ELVDJUDV \ SHVWLOORV  ; 
$FHLWDUHQVXFDVR
 5HYLVLyQ GH ORV HOHPHQWRV GH
VHJXULGDG
 $VLHQWRV /LPSLH]DGHSHVWLOORV\SDUWHVPyYLOHV  ; 
$FHLWDUHQVXFDVR


7$5($6&203/(0(17$5,$60(168$/(6


1ž -9 7LU &RQ
6LVWHPDHOHPHQWR 2EVHUYDFLRQHV
G
 /RWHGHDERUGR  &RPSUREDUIDOWDV ; ; 
 /LPSLDU\VHFDU
FRQGHQVDFLRQHV
 $FHLWDUFRQXQWUDSR
DTXHOORVHOHPHQWRV
PHWiOLFRVVXVFHSWLEOHVGH
R[LGDUVH
 (VFRWLOODV\FDMDVGH  ; 
/XEULFDUSHVWLOORV\ELVDJUDV
DOPDFHQDMH
 3URWHFWRUHVEDOtVWLFRV /XEULFDUPDQGRV\  ; 
DUWLFXODFLRQHV
 $IXVWH0*7RUUH /LPSLDU\OXEULFDU  ; 
 &iPDUDGHFRPEDWH  9HQWLODU \ VHFDU  ; 
FRQGHQVDFLRQHV
 &RPSUREDU LQGLFDGRU GH
KXPHGDG GH OD FDMD 7ZLQ
'58L7DUHD7)
 $VLHQWRV\FLQWXURQHVGH  5HYLVDU \ OLPSLDU 7DUHD 7 ; ; 
VHJXULGDG &
 /XEULFDUJXtDV\SHVWLOORV
 3XHUWDVFRUUHGHUDGHOD  /LPSLDU \ OXEULFDU JXtDV \  ; 
FHVWD SHVWLOORV
 (TXLSR  5HYLVDUHVWDGRHVFRELOOD  ; 
OLPSLDODYDSDUDEULVDVGHO  5HYLVDU QLYHO GH OtTXLGR
-9 5HOOHQDUHQVXFDVR
 &DUJDGRUHVPXQLFLyQ  9HQWLODU \ VHFDU  ; 
PP FRQGHQVDFLRQHV
 /LPSLDU \ DFHLWDU
OLJHUDPHQWHORVURGLOORV
 /LPSLDUYHQWDQDV
 (VWDGRGHOFDEOHDGR 5HYLVDU ; ; 
HOpFWULFR



1ž -9 7LU &RQ
6LVWHPDHOHPHQWR 2EVHUYDFLRQHV
G
 &iPDUDGHDUPDV  9HQWLODU OLPSLDU \ VHFDU  ; 
FRQGHQVDFLRQHV
 $FHLWDU FRQ XQ WUDSR
KXPHGHFLGR HQ DFHLWH
DTXHOORV HOHPHQWRV
VXVFHSWLEOHVGHR[LGDUVH
 $OPDFpQGHYDLQDV\  9HQWLODU OLPSLDU \ VHFDU  ; 
DORMDPLHQWRGHOFDUJDGRU FRQGHQVDFLRQHV
GHOD$0FRD[LDO  5HYLVDU7DUHD7'
 &DxyQ0.  /LPSLDU VXSHUILFLHV \ VHFDU  ; 
FRQGHQVDFLRQHV
 $FHLWDUHOiQLPD
 $0  /LPSLDU \ DFHLWDU  ; 
VXSHUILFLHV
 7XERVODQ]DLQJHQLRV  5HYLVDU WXERV OLPSLDU \  ; 
DFHLWDU


127$
6HHQWLHQGHSRUOXEULFDUDFHLWDUOLJHUDPHQWHFRQXQSDxRREURFKDLPSUHJQDGRVHQ
DFHLWHGHSHQGLHQGRGHODSLH]DRHOHPHQWRDOXEULFDU


'(6&5,3&,Ï1'(/$67$5($6

D7DUHD7

7$5($7
7DUHD,QVSHFFLyQJHQHUDOGHHOHPHQWRVDFFHVRULRVGHODWRUUH
3HUVRQDOQHFHVDULR7LUDGRU\-HIHGH9HKtFXOR
+HUUDPLHQWDV~WLOHV
0HGLRVDX[LOLDUHV
&RQVXPLEOHV
7LHPSRHVWLPDGRPLQ +[K 
(-(&8&,Ï1

$ *(1(5$/
  ,QVSHFFLRQDU H[WHULRU H LQWHULRUPHQWH HO HVWDGR GH OD SLQWXUD JROSHV \
GHVSHUIHFWRV
  ,QVSHFFLRQDUODVFDMDVGHDOPDFHQDMH\FRPSUREDQGRDEROODGXUDVILMDFLRQHV\
IXQFLRQDPLHQWRGHFLHUUHV\ELVDJUDV
% ,163(&&,Ï1'(/$6(6&27,//$6<&(67$'(/$7255(
  (VWDGRGHODVMXQWDVGHHVWDQTXHLGDG\HQJUDVHGHOPHFDQLVPRGHDSHUWXUD
LQWHULRU
  )XQFLRQDPLHQWRGHODVSDODQFDVGHUHWHQLGD
  (VWDGRGHOFDEOHGHVHJXULGDG
  )XQFLRQDPLHQWR\ILMDFLyQGHODVEDUUDVGHWRUVLyQ
  (VWDGRGHODVDVDV
  )XQFLRQDPLHQWRGHODVSXHUWDVFRUUHGHUDGHODFHVWD


  )XQFLRQDPLHQWRGHORVSURWHFWRUHVLQIHULRUHVL]TXLHUGR\GHUHFKR
  )XQFLRQDPLHQWRGHORVFRQWDFWRUHVHOpFWULFRVGHFLHUUH
& ,163(&&,Ï1'(/26$6,(1726<&,178521(6'(6(*85,'$'
  (VWDGRGHOWDSL]DGRGHORVDVLHQWRV
  )XQFLRQDPLHQWRGHOPHFDQLVPRGHDMXVWHHQDOWXUD
  )XQFLRQDPLHQWRGHOVLVWHPDGHSOHJDGRGHODVLHQWR
  )XQFLRQDPLHQWR\HVWDGRGHORVFLQWXURQHVGHVHJXULGDG
' &20352%$&,Ï1'((/(0(1726'(/$&È0$5$'($50$6<&$-$'(9$,1$6
  &RPSUREDUHOHVWDGRGHWRGDVODVWDSDV\UHJLVWURV\HOIXQFLRQDPLHQWRGHVXV
FLHUUHV
  &RPSUREDUODFDMDGHYDLQDVSRUVLSUHVHQWDGDxRV\HVWDGRGHOLPSLH]D
  &RPSUREDU ODV JXtDV \ SHVWLOORV GHO DORMDPLHQWR GHO FDUJDGRU GH OD
DPHWUDOODGRUD
( &20352%$&,Ï1'(//27('($%25'2
  5HYLVDUODEROVDGHKHUUDPLHQWDVGHODWRUUH
  5HYLVDUEROVDGH~WLOHVGHOLPSLH]DGHOFDxyQ
  5HYLVDUEROVD~WLOHVGHOLPSLH]DGHOD$0
  5HYLVDUUHVSHWRVGHDUPDPHQWR
  5HYLVDUUHVWRGHFRPSRQHQWHVGHOORWHGHDERUGRGHODWRUUH
) &20352%$&,Ï1'(/26,1',&$'25(6'(+80('$'



 )LJXUD,QGLFDGRUGHKXPHGDGGHOD
)LJXUD,QGLFDGRUHVGH
FDEH]DGHHVSHMR
KXPHGDGGHOD89/\GHO
6&7

/RV LQGLFDGRUHV GH KXPHGDG )LJ  Qž \  Qž  SUHVHQWDQ XQ FtUFXOR
FHQWUDO TXH GHEH DSDUHFHU GH FRORU D]XO 8Q FRORU URVDGR LQGLFD SUHVHQFLD GH
KXPHGDG HQ HO LQWHULRU GHO DSDUDWR SRU OR TXH GHEH FDPELDUVH HO GHVHFDQWH ž
(VFDOyQ 

E7DUHD7

7$5($7
7DUHD&RPSUREDFLyQGHVLVWHPDV
3HUVRQDOQHFHVDULR-HIHGH9HKtFXOR7LUDGRU
+HUUDPLHQWDV~WLOHV
0HGLRVDX[LOLDUHV
&RQVXPLEOHV
7LHPSRHVWLPDGRPLQ +[K 

(-(&8&,Ï1



$ 6,67(0$(/e&75,&2
  &RPSUREDUYLVXDOPHQWHHOFDEOHDGRHOpFWULFRSRUVLH[LVWHQGDxRVHQHOORV
  &RPSUREDUHODSULHWHGHORVFRQHFWRUHV
  'HVEORTXHDUODWRUUH\HOFDxyQ
  &RQHFWDUHOLQWHUUXSWRUJHQHUDO 7255(212)) GHO3DQHOGH&RQWURO
3ULQFLSDO
  &RPSUREDUOiPSDUDVGHORV3DQHOHVGH&RQWURO SULQFLSDO-9\7LUDGRU $O
FRQHFWDUHOLQWHUUXSWRUJHQHUDOSHUPDQHFHUiQHQFHQGLGDVGXUDQWHVHJXQGR
QRVHHQFLHQGHQ&203'(5,%,7352;<%,76(/(&HQHO3DQHO3ULQFLSDO
\/21*5$)HQORVRWURVGRV 
  &RPSUREDUHOIXQFLRQDPLHQWRGHORVFRQWDFWRUHVHOpFWULFRVGHODVHVFRWLOODV\
SXHUWDV
  &RPSUREDUDOXPEUDGR
 &iPDUDGHFRPEDWH
 &iPDUDGHDUPDV
 &DUJDGRUGHUHFKR
%  6,67(0$'(&21752/'(/$7255(


3(/,*52
$/321(5(10$5&+$(/6,67(0$(/e&75,&2'(029,0,(172'(/$
7255(6(7(1'5È1(1&8(17$/$61250$6'(6(*85,'$'$/
5(63(&7248(6(,1',&$1(1(/&$3'((67(0$18$/


  &RPSUREDUODVWULQFDVGHILMDFLyQGHODWRUUH\GHOFDxyQ
  &RPSUREDUHOIXQFLRQDPLHQWRGHORVPDQGRVPDQXDOHV
  &RPSUREDU TXH ORV PDQGRVHPSXxDGXUDV GH -9 \ 7LUDGRU VH PXHYHQ FRQ
VXDYLGDG\YXHOYHQDXWRPiWLFDPHQWHDODSRVLFLyQGHUHSRVRFXDQGRVHGHMD
GHDFWXDUVREUHHOODV
  &RPSUREDUTXHHOSXOVDGRUGHWRPDGHFDUJDGLVSDUDGRU\SXOVDGRUHV3/\
$&QRHVWiQEORTXHDGRV\UHFXSHUDQODSRVLFLyQLQLFLDODOGHMDUGHSXOVDUORV
  3UHVLRQDU HO LQWHUUXSWRU GH PRYLPLHQWR 6(592 212))  SDUD FRQHFWDU HO
PRYLPLHQWRDXWRPiWLFRGHWRUUH\FDxyQ6XOiPSDUDWHVWLJRVHHQFHQGHUi HQ
YHUGH 
  8WLOL]DU ORV PDQGRV GHO -HIH GH 9HKtFXOR \ GHO 7LUDGRU SDUD JLUDU OD WRUUH \
PRYHU HO FDxyQ /D WRUUH \ HO FDxyQ GHEHUiQ PRYHUVH FRQ VXDYLGDG HQ
FXDOTXLHU GLUHFFLyQ 1RWLILFDU FXDOTXLHU DQRPDOtD DO ƒ (VFDOyQ GH
0DQWHQLPLHQWR
  &RPSUREDUHOIXQFLRQDPLHQWRGHOVLVWHPDGHDXWRHOHYDFLyQ

& &20352%$&,Ï1'(/6,67(0$'(9(17,/$&,Ï1'(/$&È0$5$'($50$6
  3RQHUHQ21HOLQWHUUXSWRUSULQFLSDOGH7255(212))
  6HOHFFLRQDUODDPHWUDOODGRUDHQXQDGHORV3DQHOHVGH&RQWUROGHO-9RGHO7
  &RPSUREDU TXH DO SXOVDU HO SXOVDGRU LQGLFDGRU )8(*2 HQ FXDOTXLHUD GH ORV
3DQHOHV GH &RQWURO GHO -9 R GHO 7 VL QR SDUSDGHD VH SRQHQ HQ
IXQFLRQDPLHQWRORVH[WUDFWRUHVGHODFiPDUDGHDUPDV
  &RPSUREDUTXHDOSXOVDUHOSXOVDGRULQGLFDGRU6(*852HQORVXQLGDGHVGH
FRQWUROGHO-9RGHO7VHSDUDQORVH[WUDFWRUHV



F7DUHD7

7$5($7
7DUHD&DPELRGHOiPSDUDV
3HUVRQDOQHFHVDULR7LUDGRU
+HUUDPLHQWDV~WLOHV'HVWRUQLOODGRUSODQR
0HGLRVDX[LOLDUHV
&RQVXPLEOHV&DMDGHOiPSDUDVGHWRUUH
7LHPSRHVWLPDGRPLQSRUOiPSDUD +[K 
(-(&8&,Ï1

7 D 3ODIRQHV )LJ 
/iPSDUD ZHLVV : 3 
/iPSDUD WDUQ : 5 
7LHPSRHVWLPDGRPLQ +[K GHSHQGLHQGRGHOHVWDGRGHVXFLHGDG
GHORVWHUPLQDOHV\GHOLQWHULRU

  5HWLUDUODWDSD  VDFDQGRORVWRUQLOORVGHILMDFLyQ  
  ([WUDHU OD OiPSDUD IXQGLGD FRQ XQ PRYLPLHQWR GH SUHVLyQ \ JLUR KDFLD OD
L]TXLHUGD
  /LPSLDUWHUPLQDOHVy[LGRVKXPHGDGHV\VXFLHGDG
  ,QVWDODUXQDOiPSDUDQXHYD




)LJXUD6XVWLWXFLyQOiPSDUDSODIyQ

7 E /XFHVEODQFDVGHODFiPDUDGHDUPDV )LJ 
/iPSDUD: %$66 
  5HWLUDUODWDSD )LJQž VDFDQGRORVWRUQLOORVGHILMDFLyQ )LJ
Qž 
  ([WUDHU OD OiPSDUD GHIHFWXRVD FRQ XQ PRYLPLHQWR GH SUHVLyQ \ JLUR KDFLD OD
L]TXLHUGD
  /LPSLDUWHUPLQDOHVVXVWLWXLUODOiPSDUD\YROYHUDPRQWDUODWDSD




)LJXUD&DPELRGHOiPSDUDVGHSODIRQHVGHODFiPDUDGHDUPDV


7 F /XFHVWHVWLJRVGHODVSDQWDOODVGHODV8QLGDGHVGH&RQWUROGHO-9\
GHO7LUDGRU )LJ 
/iPSDUDP$ 9WLSR$ 
7LHPSRHVWLPDGRPLQ +[K 

  'HVDWRUQLOODU ORV WRUQLOORV   \ DEULU OD WDSD   KDFLpQGROD EDVFXODU KDFLD
DEDMR
  ([WUDHUHOPDUFRSDQWDOOD  
  ,QVHUWDUHOH[WUDFWRUGHOiPSDUDVLQFOXLGRHQODFDMDGHOiPSDUDVGHUHSXHVWR
GHO ORWH GH D ERUGR   HQ OD OiPSDUD GHIHFWXRVD   KDVWD TXH VH SURGX]FD
YDFtR$FRQWLQXDFLyQWLUDUKDFLDIXHUDSDUDH[WUDHUODOiPSDUD
  /LPSLDUWHUPLQDOHVy[LGRVKXPHGDGHV\VXFLHGDG
  ,QVHUWDUODQXHYDOiPSDUDFRQODPDQRWHQLHQGRFXLGDGRGHTXHODVGRVSDWDV
GH FRQH[LyQ VH LQWURGX]FDQ HQ VXV UHVSHFWLYRV WHUPLQDOHV 12 86$5 (/
(;75$&725SDUDFRORFDUODQXHYDOiPSDUD





)LJXUD6XVWLWXFLyQOiPSDUDVWHVWLJRV

7 G 3XOVDGRUHVGHORV3DQHOHVGH&RQWURO3ULQFLSDO-9\7LUDGRU


/iPSDUD: 7 
&RQXQGHVWRUQLOODGRUSODQRDSDODQFDUHQXQDGHODVUDQXUDVGHOSXOVDGRULQGLFDGRU
SDUDVDFDUODWXOLSD )LJQž 
6XVWLWXLUODOiPSDUD )LJQž SRUXQDQXHYDXVDQGRHOH[WUDFWRUPHGLDQWHHO
PLVPRSURFHGLPLHQWRGHODFDMDGHOiPSDUDV
  0RQWDUODWXOLSDGHOSXOVDGRULQGLFDGRUSUHVLRQiQGRODVREUHVXVRSRUWH





)LJXUD&DPELRGHOiPSDUDVGHORVSXOVDGRUHVGHODV8QLGDGHVGH&RQWURO

7 H /iPSDUDGHOFDUJDGRUGHUHFKR
/iPSDUD: %$6 

 ([WUDHU HO SDQHO GH D\XGD GH
FDUJDGHOFDUJDGRUSDUDDFFHGHU
DOSLORWR
 ([WUDHU PDQXDOPHQWH SRU
SUHVLyQODWXOLSD )LJQž 
 6XVWLWXLU OD OiPSDUD GHIHFWXRVD
SUHVLRQiQGROD \ JLUiQGROD D
L]TXLHUGDV
 9ROYHU D PRQWDU OD WXOLSD
SUHVLRQiQGRODVREUHVXVRSRUWH
 )LJXUD&DPELRGHOiPSDUDFDUJDGRU
 GHUHFKR
7 I /X]URWDWLYD
/iPSDUD: + 

 5HWLUDUODWXOLSDSUHVLRQDQGRODSHVWDxD )LJQž \VLPXOWiQHDPHQWH
JLUDUODHQVHQWLGRFRQWUDULRDODVDJXMDVGHOUHORM
 /LEHUDUHOIOHMHHOiVWLFRTXHILMDODOiPSDUD
 ([WUDHUODOiPSDUDOLPSLDQGRORVWHUPLQDOHVVLIXHUDQHFHVDULR\VXVWLWXLUODVLQ
WRFDUHOEXOER
 9ROYHUDFRORFDUODWXOLSDJLUiQGRODHQVHQWLGRKRUDULRKDVWDRtUHO³FOLFN´GHOD
SHVWDxDDOHQFDMDU





)LJXUD&DPELRGHOiPSDUDOX]URWDWLYD


H7DUHD7

7$5($7
7DUHD/LPSLH]DH[WHULRUGHORVHOHPHQWRVySWLFRV
3HUVRQDOQHFHVDULR7LUDGRU
+HUUDPLHQWDV~WLOHV%ROVDGHOLPSLH]DGHySWLFDGHORVSHULVFRSLRV3\3

0HGLRVDX[LOLDUHV
&RQVXPLEOHV
7LHPSRHVWLPDGRPLQ +[K 
(-(&8&,Ï1


35(&$8&,Ï1
7RGRVORVFRPSRQHQWHVySWLFRVGHEHQVHUWUDWDGRVFRQFXLGDGR\SURWHJHUORV
GHOSROYRVXFLHGDGKXHOODVGHORVGHGRV\KXPHGDGHVHQHODOPDFpQ
WUDQVSRUWH\PDQLSXODFLyQSDUDHYLWDUGDxRV\DUDxD]RVHQVXVFRPSRQHQWHV
(OPDQWHQLPLHQWRHVWiOLPLWDGRDOH[WHULRUGHORVDSDUDWRVySWLFRV

  /LPSLDUHOFXHUSRGHOHOHPHQWRFRQHOSDxR\HOFHSLOOR
  /LPSLDUODVVXSHUILFLHVySWLFDVFRQHOSLQFHOGHFRVPpWLFD
  6L ODV VXSHUILFLHV ySWLFDV HVWXYLHUDQ PX\ VXFLDV GHEHUi HQFRPHQGDUVH VX
OLPSLH]D DO ž (VFDOyQ TXH GLVSRQH GH ORV HOHPHQWRV \ FRQVXPLEOHV
DGHFXDGRV
  'HVSXpV GH OD OLPSLH]D WHQHU FXLGDGR HQ PDQWHQHU ODV VXSHUILFLHV OLEUHV GH
VXFLHGDGKXHOODVGHORVGHGRVKXPHGDGRFRQWDPLQDFLyQ


*8Ë$'((1*5$6(

$FHLWDUPHQVXDOPHQWHORVVLJXLHQWHVSXQWRV
 %LVDJUDV\FHUURMRVGHODVFDMDVGHDOPDFHQDMHLQWHULRUHV\H[WHULRUHV
 &HUURMRVGHODVSXHUWDVGHDFFHVRDODFiPDUDGHDUPDV



 0HFDQLVPRGHHOHYDFLyQGHORVDVLHQWRVGHO-9\7




)LJXUD*XtDGHHQJUDVHGHODWRUUH

5P5HYLVLyQ  5D5HYLVLyQDQXDO
PHQVXDO 
5VD5HYLVLyQ 
VHPHVWUDO 
**UDVD 2$FHLWH


5(680(1

D,QVSHFFLyQGHORVPRQWDMHVGHODWRUUH
x ,QVSHFFLyQYLVXDOGHODWRUUH
x ,QVSHFFLyQGHODVFDMDVGHDOPDFHQDMH
x &RPSUREDFLyQOLPSLH]D\HQJUDVHGHODVHVFRWLOODV\FHVWD
x &RPSUREDFLyQOLPSLH]D\HQJUDVHGHORVDVLHQWRV
x &RPSUREDFLyQGHODVVXMHFLRQHVGHHTXLSRHQHOLQWHULRU
x &RPSUREDFLyQOLPSLH]D\HQJUDVHGHODFDMDGHYDLQDV
x &RPSUREDFLyQOLPSLH]D\HQJUDVHGHOPHFDQLVPRGHEORTXHRGHOFDxyQ
x &RPSUREDFLyQOLPSLH]D\HQJUDVHGHOPHFDQLVPRGHEORTXHRGHJLURGHODWRUUH
x &RPSUREDFLyQ OLPSLH]D \ HQJUDVH GH ORV HVFXGRV EDOtVWLFRV GH ORV SHULVFRSLRV
GHSXQWHUtDP-9\7
x &RPSUREDFLyQGHORVSHULVFRSLRVGHREVHUYDFLyQ
x /LPSLH]DGHORVSHULVFRSLRV



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï1/27('($%25'2

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFRSUiFWLFR $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQWULSXODFLyQ
$<8'$6$/$,16758&&,Ï1
9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

'LVSRQHUGHXQYHKtFXOR\GHVXORWHGHDERUGR


5(48,6,726$$/&$1=$5

/DLGHQWLILFDFLyQGHWRGRVORVHOHPHQWRVTXHFRPSRQHQHOORWHGHDERUGR
/D HYDOXDFLyQ VH FRQVLGHUD VXSHUDGD VL VH VXSHUD HO  GH DFLHUWRV HQ ORV
DVSHFWRVDHYDOXDU


'(6$552//27(Ï5,&2'(/&217(1,'2

(O ORWH GH D ERUGR HVWi IRUPDGR SRU XQD VHULH GH KHUUDPLHQWDV ~WLOHV UHSXHVWRV \
DFFHVRULRVTXHVRQ QHFHVDULRV SDUDDVHJXUDUXQIXQFLRQDPLHQWRHILFLHQWH\VHJXUR
GHO YHKtFXOR HQ VX FRQMXQWR DVt FRPR SHUPLWLU OOHYDU D FDER HO 0DQWHQLPLHQWR
SUHYHQWLYR \ FLHUWDV UHSDUDFLRQHV GH HPHUJHQFLD WDQWR HQ HO YHKtFXOR FRPR HQ VX
DUPDPHQWRTXHQRVDVHJXUHQHVHQLYHOGHHILFDFLD
6HHQWLHQGHSRU3ODQGH&DUJDHOVLVWHPDySWLPRGHWUDQVSRUWDUHQHOYHKtFXORWRGRV
ORVHOHPHQWRVGHOORWHGHDERUGRPiVWRGDODPXQLFLyQFRUUHVSRQGLHQWHDXQDFDUJD
GHFRPEDWHDUPDPHQWRPDWHULDO\HTXLSRLQGLYLGXDO\FRPSOHPHQWDULRGHOD8QLGDG
XVXDULD
$FRQWLQXDFLyQVHH[SRQHXQDUHODFLyQGHWRGRHOPDWHULDOTXHFRQVWLWX\HHOORWHGHD
ERUGR GHO YHKtFXOR ³3,=$552´ DSDUHFLHQGR HQ OD SiJLQD GH OD L]TXLHUGD XQD ILJXUD
HQGRQGHYLHQHQUHSUHVHQWDGRVORVGLVWLQWRVDUWtFXORV\HQODSiJLQDGHODGHUHFKD
XQDWDEODHQODTXHDSDUHFHQORVVLJXLHQWHVFDPSRV
 1žGHRUGHQGHODUWtFXORSDUDLGHQWLILFDUORHQODILJXUDFRUUHVSRQGLHQWH
 1RPEUHRGHQRPLQDFLyQGHODUWtFXOR
 &DQWLGDGGHHOHPHQWRVGHHVHDUWtFXORTXHKD\HQHOORWHGHDERUGR
 8ELFDFLyQROXJDUGHWUDQVSRUWHFRUUHVSRQGLHQWHDO3ODQGH&DUJDHQGRQGH
YDHVHHOHPHQWR


6LJXLHQGR OD WyQLFD DQWHULRU HQ OD SiJLQD GH OD L]TXLHUGD DSDUHFHUi XQD ILJXUD FRQ
GLIHUHQWHV YLVWDV GHO YHKtFXOR HQ GRQGH DSDUHFHQ UHSUHVHQWDGRV FRQ VX
FRUUHVSRQGLHQWH1žGHRUGHQHOOXJDUGHXELFDFLyQGHORVGLVWLQWRHOHPHQWRVGHOORWH
GH D ERUGR HQ OR TXH UHVSHFWD DO 3ODQ GH &DUJD YHU ILFKD   \ HQ OD
SiJLQD GH OD GHUHFKD XQD WDEOD HQ GRQGH VH YXHOYH D SRQHU HO DUWtFXOR DO TXH
FRUUHVSRQGHFDGD1žSDUDTXHUHVXOWHPiVVHQFLOORVXLGHQWLILFDFLyQ


/27('($%25'2'(/9(+Ë&8/2


D0DOHWtQGHKHUUDPLHQWDV




)LJXUD0DOHWtQGHKHUUDPLHQWDV


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 0DOHWtQGHKHUUDPLHQWDVFRQ  0DOHWHURH[WHULRUWUDVHURL]TXLHUGR
D-XHJROODYHVILMDVSODQDVGH 
˜  
˜  
˜  
˜  
˜  
˜  


˜  
˜  
˜  
˜  
˜  
E-XHJRGHVWRUQLOODGRUHVSODQRV 
˜ [[PP 
˜ [[PP 

˜ [[PP

F-XHJRGHVWRUQLOODGRUHVHVWUHOOD

˜ ' PP[

˜ ' PP[ 
˜ ' PP[ 
G-XHJRERWDGRUHVFLOtQGULFRV 
˜ ' PP 
˜ ' PP 
˜ ' PP 
˜ ' PP 
H-XHJROODYHVDFRGDGDVGH 
HVWUHOOD 
˜  
˜  
˜  
˜  
˜ 
I/LPDPHGLDFDxD´
J/LPDSODQD´
K0DQJRVSDUDOLPDV
L$OLFDWHXQLYHUVDO
M$OLFDWHGHFRUWHREOLFXR
N0DUWLOORGHERODJU
O&RUWDIUtRV


E(TXLSRGHPRQWDMHGHFDGHQDV




)LJXUD(TXLSRGHPRQWDMHGHFDGHQDV


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 (TXLSRGHPRQWDMHGHFDGHQDVHQEROVD  0DOHWHURH[WHULRUWUDVHUR
FRQ  L]TXLHUGR
D *DWRGHUHFKR 
E *DWRL]TXLHUGR 
F *UDSDVGHPRQWDMH 
G %RWDGRUHVGHVPRQWDMH]DSDWDV 
H %DUUDVH[WUDFWRUDVGH]DSDWDV 
I /ODYHGLQDPRPpWULFDGH 
1P 
J /ODYHFDUUDFDFRQPDQJR 


K 9DVRGHSDUD 
L /ODYHFDUUDFD 
M 9DVRGHSDUD 
N $ODUJDGRUHVGHPP 
O ÒWLOJXLDGRFDGHQD 
P0DUWLOORGHNJ 
Q %DUUDH[WUDFWRUDGHFRQHFWRUHV 
R ÒWLOPRQWDMH]DSDWDV 
S (TXLSR GH FRPSUREDFLyQ GH WHQVDGR 
GHFDGHQDVHQEROVDFRQ 
T *DOJD 
U +LOR



F2WURPDWHULDO




)LJXUD(OHPHQWRVGHOORWHGHDERUGR  

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 /ODYHP~OWLSOHDSHUWXUD  3XHVWRGHFRQGXFFLyQ DEDMRDODL]T 
SXHUWDV
 /ODYHILMDFLyQHQFKXIH  &RPSDUWLPHQWR*03
UiSLGR
 /ODYHDSHUWXUDWDSyQ  6REUHUDGLDGRU
UDGLDGRUFRQFDGHQLOOD



 ([WLQWRUSRUWiWLOGHNJ  6RSRUWHHQVXHOREDMRSULPHUDVLHQWR
GHUHFKR
 ([WLQWRUSRUWiWLOGHNJ  6RSRUWHYHUWLFDOMXQWRDSRUWyQWUDVHUR
 (PEXGRSDUDOtTXLGRV  0DOHWHURH[WHULRUWUDVHURGHUHFKR
 -XHJRWULiQJXORVGH  0DOHWHURH[WHULRUWUDVHURGHUHFKR
VHxDOL]DFLyQFRQHVWXFKH
 &DQGDGRV  
D HVFRWLOODVWRUUH  (QVXVHVFRWLOODVUHVSHFWLYDV&XDQGRQRVH
  XVDQSXHGHQDOPDFHQDUVHHQODFDMD
H[WHULRUGHUHFKDGHODWRUUH
E HVFRWLOOD&RQGXFWRU  (QVXHVFRWLOOD&XDQGRQRVHXVHSXHGH
JXDUGDUVHHQODFDMDH[WHULRUGHUHFKDGHOD
WRUUH
 /ODYHDSHUWXUDHVFRWLOODV  (QPHFDQLVPRVGHDSHUWXUDHVFRWLOODV
WRUUH 
 -XHJRDUUDQTXHGH  0DOHWHURH[WHULRUWUDVHURL]TXLHUGR
HPHUJHQFLDFRQ  
DFDEOHHVFODYR 
EDGDSWDGRU 
 ÒWLODFRSODPLHQWRSDVRV  0DOHWHURH[WHULRUWUDVHURGHUHFKR
ILQDOHV 
 (TXLSRGHYDGHRFRQ  
D 3URORQJDGRU HVFDSH  &ROJDGRGHOODGRL]TGHOPDOHWHURH[WHULRU
VFKQRUNHO   WUDVHURGHUHFKR
E 3URWHFWRU GH UHMLOOD  
HQWUDGDDLUH  0DOHWHURH[WHULRUWUDVHURGHUHFKR
F 3URWHFWRU UHMLOOD  0DOHWHURH[WHULRUWUDVHURGHUHFKR
VDOLGDDLUH 






)LJXUD(OHPHQWRVGHOORWHGHDERUGR  


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 %DUUDSDODQFD HVSHTXH   7HFKR SDUWHWUDVHUD 

 0D]R  7HFKR MXQWRDF~SXOD-(&3 

 3DOD  &RVWDGRGHUHFKR

 +DFKD  &RVWDGRGHUHFKR



 3LFRFRQPDQJR  &RVWDGRGHUHFKR

 6LUJDVGHUHPROTXH  &RVWDGRL]TXLHUGR

 %RPEDPDQXDOGHHQJUDVHFRQ  0DOHWHURL]TXLHUGRWRUUH
ODWLJXLOOR

 $FHLWHUDDSUHVLyQ/  0DOHWHURL]TXLHUGRWRUUH

 /LQWHUQD  0DOHWHURGHUHFKRWRUUH

 /iPSDUDSRUWiWLO  0DOHWHURGHUHFKRWRUUH

 *XDQWHV  0DOHWHURGHUHFKRWRUUH

 6RSRUWHEDQGHUDV  7HFKRWRUUHGHODQWHVRSRUWHDQWHQD
 L]TXLHUGD



G0DWHULDOGHUHVSHWRUHSXHVWRV\DFFHVRULRV




)LJXUD0DWHULDOGHUHVSHWRUHSXHVWRV\DFFHVRULRV

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 3HULVFRSLR0FHQWUDOGHFRQGXFFLyQ  &DMDVREUHSDQHO
LQVWUXPHQWRV
 3HULVFRSLRODWHUDOGHFRQGXFFLyQ  &DMDVREUHFDMDSHULVFRSLR
3&1
 3HULVFRSLRGHFRQGXFFLyQQRFWXUQD  &DMDVREUHQRGUL]DDOD
3&1FRQHVWXFKHGHWUDQVSRUWHFDEOH GHUHFKD
GHFRQH[LyQPDQXDOGHLQVWUXFFLRQHV\SLODV
/5
 %ROVDGHHTXLSRGHOLPSLH]DGHO3&1  &DMDVREUHFDMDGHO



FRQ  SHULVFRSLR3&1
˜ /LEULOORGHSDSHOVLOLFRQDGR 
˜ 3LQFHOSHTXHxRGHFRVPpWLFD 
˜ 3DxRGHKLORGH[FP 
˜ &HSLOORSHORWUHVKLOHUDV
 3HULVFRSLRGHREVHUYDFLyQGHWRUUH )  &DMDODWHUDOGHUHFKRGHWUiV
  GHWRUUH
 3HULVFRSLRF~SXOD-(&3 )   &DMDEDMRSULPHUDVLHQWR
GHUHFKD
 &DMD [[PP GHOiPSDUDVGH  0DOHWHURGHUHFKRWRUUH
UHSXHVWRGHWRUUHFRQ 
˜ /iPSDUD+9GH: 
˜ /iPSDUD59GH: 
˜ /iPSDUD39GH: 
˜ /iPSDUD5*9GH: 
˜ /iPSDUD9GH: 
˜ /iPSDUD9GH: 
˜ /iPSDUD9GHP$ 

˜ /iPSDUD9GHP$

˜ /iPSDUD+9GH:
˜ ([WUDFWRUGHOiPSDUDV
 &DMD [[PP GHOiPSDUDVGH  0DOHWHURGHUHFKRWRUUH
UHSXHVWRGHFDVFRFRQ 
˜ /iPSDUD$9GH: 
˜ /iPSDUD59GH: 
˜ /iPSDUD39GH: 
˜ /iPSDUD7+9GH: 
˜ /iPSDUD5*9GH: 
˜ /iPSDUDKDOyJHQD9GH: 
˜ /iPSDUD9GH: 

˜ /iPSDUD9GH:

˜ /iPSDUD9GHP$

˜ ([WUDFWRUGHOiPSDUDV
 (VODERQHVGHFDGHQDFRPSOHWRV  (QWHFKRGHODQWH\D
L]TXLHUGDGHODF~SXODGHO
-(&3


H2WURVDFFHVRULRV




)LJXUD2WURVDFFHVRULRV


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

 %RWLTXtQSULPHURVDX[LOLRV  /DWHUDOGHUHFKRGHODQWHGHO6&&$


 3DUDEULVDVFRQGXFFLyQH[WHULRUFRQ  (QVRSRUWHGHEDMRFLOLQGURGH
OLPSLDSDUDEULVDVFDEOH\IXQGD DSHUWXUDSRUWyQWUDVHUR

 &RFLQDGHFDPSDxDFRQFDEOHGH  6RSRUWHLQWHULRUGHWUiVGHWRUUH
FRQH[LyQ\PDQXDOGHLQVWUXFFLRQHV




 /X]JLUDWRULD  6RSRUWHGHWUiVGHO&RQGXFWRU

 3HWDFDVGH/FRQERTXLOODIOH[LEOH  
D 3HWDFD  6RSRUWHLQWHULRUGHWUiVGHWRUUH
E 3HWDFD  6RSRUWHGHWUiVFDMDH[WHULRU
F 3HWDFD  GHUHFKD
6RSRUWHGHWUiVFDMDH[WHULRU
L]TXLHUGD

 -XHJRGHEDQGHUDVGHVHxDOHV  6REUHFDUJDGRUL]TXLHUGRWRUUH
URMDDPDULOOD\YHUGH FRQIXQGD

 5HGHVPLPpWLFDVHQEROVD  
D 5HG  &RVWDGRGHUHFKRWRUUHEDMR
E 5HG  ODQ]DGRUHV
 ³L]TXLHUGR³³³
 $WDODMHVSDUDHTXLSRV  
D 'HWUiVDVLHQWRVGHODGHUHFKD  -XQWRDO6&&$
E (QSRUWyQWUDVHUR  3DUWHVXSHULRU
F 'HWUiVGHO&FRQEROVD  6REUHGHSyVLWRQRGUL]D
 
 $OPRKDGLOODVGHDVLHQWRVGHO-9\7  (QVXVDVLHQWRVFRUUHVSRQGLHQWHV



/27('($%25'2'(7255(

D%ROVDGHKHUUDPLHQWDV







)LJXUD%ROVDGHKHUUDPLHQWDVGHODWRUUH


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 %ROVDKHUUDPLHQWDVSDUDODWRUUHFRQ  %DQGHMDHQWUH-9\7LUDGRU
D 3DODQFDGHGLVSDUR 
E 'HVWRUQLOODGRUSODQR 
F +LORGHDUUDVWUHGHPXQLFLyQ 
G /ODYHGHFDUUDFDGHPP 
H 3URORQJDGRUODUJRó´PP 
I &DODGHDMXVWHGHO'$/ 
J 9DVRGHPP 
K 9DVRGHPP 
L 0DQLYHODGHUHDUPH 
M *DQFKR 
N /ODYHDOOHQGHPP 
O %ROVDGHOLPSLH]DySWLFDFRQ 
/LEULOORGHSDSHOVLOLFRQDGR 
3LQFHOGHFRVPpWLFDSHTXHxR 
3DxRGHKLOR[FP 
&HSLOORSHORWUHVKLOHUDV 
P 3URORQJDGRUFRUWR´PP 
Q /ODYHGHFDUUDFDGH´ 





/27('($%25'2'(&$fÏ1

DÒWLOHVGHOLPSLH]D


)LJXUDÒWLOHVGHOLPSLH]DGHOFDxyQ



1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 -XHJRGH~WLOHVGHOLPSLH]DGHO  &DMDLQIHULRUWRUUH SDUWHODUJD 
FDxyQHQEROVDFRQ 
D /ODYHGHJDQFKRDUWLFXODGD 



E %DTXHWDHQWUDPRV   
F )HPLQHODGHEURQFH 
G )HPLQHODGHQ\ORQ 
H )HPLQHODGHRMDO 

 )HPLQHODGHEURQFHSDUDUHFiPDUD  &DMDLQIHULRUWRUUH SDUWHGHUHFKD 
FRQIXQGD
 )HPLQHODGHQ\ORQSDUDUHFiPDUD  &DMDLQIHULRUWRUUH SDUWHGHUHFKD 
FRQIXQGD
 %RWHGHJUDVD  &DMDLQIHULRUWRUUH SDUWHGHUHFKD 
 %RWHGHDFHLWH  &DMDLQIHULRUWRUUH SDUWHGHUHFKD 
 7DSDERFDVGHFDxyQ  7DSDUHJLVWURGHFDMDVXSHULRU
GHUHFKDGHH[WHULRUWRUUH


/27('($%25'2'($0(75$//$'25$






)LJXUD/RWHGHDERUGRGHODDPHWUDOODGRUD

1 '(120,1$&,Ï1 & 8%,&$&,Ï1
ž %ROVDGHUHSXHVWRV\~WLOHVGHOLPSLH]D  &DMDLQIHULRUWRUUH SDUWH
 GHODDPHWUDOODGRUDFRQ  FHQWUDO 
D &LHUUH 
E ([WUDFWRU 
F 0XHOOHH[WUDFWRU 


G 7RSHH[WUDFWRU 
H &KDSDGHFLHUUH 
I ([SXOVRUGHFLHUUH 
J 3HUFXWRU 
K %DTXHWD GH  WUDPRV FRQ 
PDQJR 
L $FHLWHUD 
M )HPLQHODGHFREUH 
N )HPLQHODGHQ\ORQ 
O +HUUDPLHQWDFRPELQDGD

 &DxyQGHUHVSHWRFRQHVWXFKH  
 D (QWRUUH  3DUWHEDMDGHOD]RQDGHO-9
E (QFDVFR  6RSRUWHDVLHQWRVGHUHFKD
 
 &DUJDGRUGHODDPHWUDOODGRUD  
 D (QHODUPD  $ORMDPLHQWRHQODFHVWDGHOD
  WRUUH
E 'HUHVSHWR  'HEDMRGHODFHVWDGHODWRUUH
 7DSDERFDVGHODDPHWUDOODGRUD  7DSDUHJLVWURGHFDMD
  VXSHULRUGHUHFKDGHH[WHULRU
WRUUH


/27('($%25'2'(//$1=$,1*(1,26





)LJXUD/RWHGHDERUGRGHOODQ]DLQJHQLRV



1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

 &RPSUREDGRUFRQHVWXFKH  &DMDLQIHULRUWRUUH SDUWHFHQWUDO 


 (VFRELOOyQFRQIXQGD 
 %ROVDGHDFFHVRULRV\~WLOHVGH 
OLPSLH]DFRQ 
D &RQWDFWRU 
E &HSLOOROLPSLH]DFRQWDFWRU 
F $OLFDWHSDUDDQLOORHOiVWLFR 


G $QLOORVHOiVWLFRV 
H )XVLEOHV 
I /ODYHDOOHQGHPP 


(48,32<0$7(5,$/'(&$03$f$



)LJXUD(TXLSR\PDWHULDOGHFDPSDxD





1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1 ),*
3&
 0RFKLODVGHFRPEDWH   
 D 7ULSXODFLyQ  $WDODMHVREUHQRGUL]D SDUWH
E (&3  VXSHULRU 
'HEDMRDVLHQWRUHVSHFWLYR
 &RUUHDMHV 3(&26   6REUHHOWULSXODQWH 
 &KDOHFRVDQWLIUDJPHQWRV  6REUHHOWULSXODQWH 
 %ROVDV1%4   
 D &RQGXFWRU  $WDODMHVREUHQRGUL]D
E -9  'HODQWHFHVWD
F 7  7UDVHUDFHVWDDODGHUHFKD
G -(&3\&(GHUHFKD  $WDODMHSRUWyQWUDVHUR
H )XVLOHURVGHUHFKD  6REUHVRSRUWH&
I &(\HUIXVLOHURL]TXLHUGD  (QWUHSDUHG\DVLHQWR-(&3
J žIXVLOHURL]TXLHUGD  $WDODMHSRUWyQWUDVHUR
 &DVFRGHJXHUUDWLSR0$57(   
D &RQGXFWRU  ,]TXLHUGDGHODVLHQWR
E -9\7  'HODQWHDUPHURSDVLOOR
F 'RV(VFXDGUDV\-(&3  &RQGXFWRU
(QDWDODMHMXQWRD6&&$
 &DVFRVLQWHUIyQLFRV'+SDUD  (QORVUHVSHFWLYRVJDQFKRVGH 
D &RQGXFWRU  FDGDSXHVWR
E -9 
F 7LUDGRU 
G -(&3 
H &( 
 %ROVDFRQ(3,   
D &RQGXFWRU  $WDODMHVREUHQRGUL]D SDUWH
E -9  EDMD 
F 7LUDGRU  -XQWRVXEROVD1%4
G )XVLOHURVGHUHFKD  -XQWRVXEROVD1%4
H )XVLOHURVL]TXLHUGD  $WDODMHMXQWR6&&$
I -(&3  $WDODMHVREUHQRGUL]D
7UDVHUDFHVWDDODGHUHFKD
 6DFRVGHGRUPLU   
D 7ULSXODFLyQ  0DOHWHURH[WHULRUWUDVHUR
E (&3  GHUHFKR
0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
 (VWHULOODV  0DOHWHURH[WHULRUWUDVHUR 
GHUHFKR
 7LHQGDV$1(72 HQVXVEROVDV   0DOHWHURH[WHULRUWUDVHUR 
L]TXLHUGR
 3ULVPiWLFRVGHFDPSDxD  6RSRUWHVREUHFDUJDGRU 
GHUHFKR WRUUH
 *DIDVGHSURWHFFLyQGLXUQDSDUD  (QORVUHVSHFWLYRVJDQFKRVGH 
D &RQGXFWRU  ORVFDVFRVLQWHUIyQLFRV
E -9 
F -(&3 





),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï13/$1'(&$5*$

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1


7HyULFRSUiFWLFR $XOD\9HKtFXOR 7HRUtDPLQXWRV
3UiFWLFDPLQWULSXODFLyQ
$<8'$6$/$,16758&&,Ï1
9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

'LVSRQHUGHXQYHKtFXOR\GHVXORWHGHDERUGR

5(48,6,726$$/&$1=$5

/DSHUIHFWDFRORFDFLyQHQHOYHKtFXORGHWRGRVORVHOHPHQWRVTXHFRPSRQHQHOORWH
GHDERUGR
/D HYDOXDFLyQ VH FRQVLGHUD VXSHUDGD VL VH VXSHUD HO  GH DFLHUWRV HQ ORV
DVSHFWRVDHYDOXDU

'(6$552//27(Ï5,&2'(/&217(1,'2

/DGHVFULSFLyQGHWRGRVORVHOHPHQWRVTXHFRPSRQHQHOORWHGHDERUGRVHGHWDOOD
HQODILFKDGHHVWHPDQXDO

3/$1'(&$5*$

D([WHULRUGHOFDVFR





)LJXUD3ODQGHFDUJDHQHOH[WHULRUGHOFDVFR  


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

E 3URWHFWRUGHUHMLOODGHHQWUDGDGH  &DMD~WLOHVGHYDGHRHQFRVWDGR


DLUHSDUDYDGHR GHUHFKR

F 3URWHFWRUGHUHMLOODGHVDOLGDGH  &DMD~WLOHVGHYDGHRHQFRVWDGR
DLUHSDUDYDGHR GHUHFKR

 3DOD  &RVWDGRGHUHFKR

 +DFKD  &RVWDGRGHUHFKR

 3LFR  &RVWDGRGHUHFKR



 6LUJDVGHUHPROTXH  &RVWDGRL]TXLHUGR


)LJXUD3ODQGHFDUJDHQHOH[WHULRUGHOFDVFR  


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1



 (PEXGRSDUDOtTXLGRV  0DOHWHURH[WHULRUWUDVHUR
 GHUHFKR
 &DMDFRQMXHJRGHWULiQJXORVGH  0DOHWHURH[WHULRUWUDVHUR
VHxDOL]DFLyQGHDYHUtD GHUHFKR

D 6DFRVGHGRUPLUGHODWULSXODFLyQ  0DOHWHURH[WHULRUWUDVHUR
GHUHFKR
 (VWHULOODV  0DOHWHURH[WHULRUWUDVHUR
GHUHFKR
E 3HWDFDGHOtTXLGRV  6REUHPDOHWHURH[WHULRUWUDVHUR
GHUHFKR
D 6FKQRUNHO  (QODWHUDOGHPDOHWHURH[WHULRU
WUDVHURGHUHFKR

 %DUUDVHVSHTXH  3DUWHVXSHULRUFDVFR

F 3HWDFDGHOtTXLGRV  6REUHPDOHWHURH[WHULRUWUDVHUR


L]TXLHUGR
 0DOHWtQGHKHUUDPLHQWDV  0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
 &DEOHHVFODYRFRQDGDSWDGRU  0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
 ÒWLODFRSODPLHQWRSDVRVILQDOHV  0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
E 6DFRVGHGRUPLUGHOD(&3  0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
 7LHQGDV$1(72  0DOHWHURH[WHULRUWUDVHUR
L]TXLHUGR
 %ROVDFRQHTXLSRGHPRQWDMHGH  0DOHWHURH[WHULRUWUDVHUR
FDGHQDV L]TXLHUGR

 0D]R  3DUWHVXSHULRUFDVFR

 (VODERQHVGHFDGHQD  3DUWHVXSHULRUFDVFR

E &DQGDGRGHFLHUUHGHODHVFRWLOOD  (QODRUHMHWDGHODSURSLD


&RQGXFWRU HVFRWLOOD

E,QWHULRUGHOFDVFR





)LJXUD3ODQGHFDUJDHQHOLQWHULRUGHOFDVFR  


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

 ([WLQWRUSRUWiWLOGHNJ  6RSRUWHYHUWLFDOMXQWRSRUWyQWUDVHUR

 *DIDVGHSURWHFFLyQGLXUQDGHO  (QJDQFKRGHOFDVFRLQWHUIyQLFR


-(&3
 &RFLQDGHFDPSDxD  'HWUiVGHWRUUHHQVRSRUWHVREUHSLVR

 3HULVFRSLRGHFRQGXFFLyQ  &DMDVREUHQRGUL]DDODGHUHFKDGHO&


QRFWXUQD3&1

 %ROVDFRQHTXLSROLPSLH]DGHO  &DMDVREUHFDMDGHOSHULVFRSLR3&1
3&1

 3HULVFRSLRODWHUDOGH  &DMDVREUHFDMDGHOSHULVFRSLR3&1
FRQGXFFLyQ
 /ODYHP~OWLSOHGHDSHUWXUDGH  (QSXHVWRGHFRQGXFFLyQDODL]TXLHUGD
SXHUWDV GHOSHGDOGHIUHQR

 /ODYHGHILMDFLyQGHHQFKXIH  (QODFiPDUD*03VREUHPRWRU
UiSLGR


 /ODYHDSHUWXUDWDSyQUDGLDGRU  6REUHUDGLDGRU

 3HULVFRSLRGHUHVSHWRGH  &DMDHQHOODWHUDOGHUHFKRGHWUiVGHOD


REVHUYDFLyQGHWRUUH WRUUH

 %RWLTXtQSULPHURVDX[LOLRV  /DWHUDOGHUHFKRDODGHUHFKDGHODWRUUH
GHODQWHGHO6&&$

D 3HWDFDSDUDOtTXLGRV  6RSRUWHVREUHSLVRGHWUiVGHODWRUUH

 3HULVFRSLRGHUHVSHWRGH  &DMDEDMRSULPHUDVLHQWRGHUHFKD


F~SXOD-(&3
 ([WLQWRUSRUWiWLOGHNJ  6RSRUWHHQVXHOREDMRSULPHUDVLHQWR
GHUHFKR

 %ROVDFRQFRQMXQWRSDUDEULVDV  (QVRSRUWHGHEDMRGHOFLOLQGURGH
GHFRQGXFFLyQH[WHULRU DSHUWXUDSRUWyQWUDVHUR GHEDMRDVLHQWR
GHO&(GHODGHUHFKD 



)LJXUD3ODQGHFDUJDHQHOLQWHULRUGHOFDVFR  


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1



 *DIDVSURWHFFLyQGLXUQDGHO&  (QJDQFKRGHFDVFRLQWHUIyQLFR
D
D $WDODMHSDUDHTXLSRV  6REUHSRUWyQWUDVHURSDUWH
VXSHULRU
G %ROVDV1%4GHO-(&3\GHO&(  (QDWDODMHD
GHUHFKD
J %ROVD1%4GHOžIXVLOHURL]GD  (QDWDODMHD

H %ROVDV1%4GHIXVLOHURVGHUHFKD  6REUHVRSRUWH&

E $WDODMHSDUDHTXLSRV  -XQWRDO6&&$GHWUiVDVLHQWRV


GHODGHUHFKD

F &DVFRVGHFRPEDWHGHOD(&3  (QDWDODMHE

G %ROVDVGH(3,VGHORVPLHPEURVGH  (QDWDODMHE


OD(&3GHODGHUHFKD

 &DxyQGHUHVSHWRGHDPHWUDOODGRUD  (QHVWXFKHHQODWHUDOGHUHFKRHQ
FRD[LDO SDUWHDQWHULRUGHDVLHQWRVGHOD
 GHUHFKD
 3HULVFRSLRGHUHVSHWRGHREVHUYDFLyQ  &DMDHQODWHUDOGHUHFKRGHWUiVGH
GHWRUUH WRUUH

 3HULVFRSLRGHFRQGXFFLyQQRFWXUQD  &DMDVREUHQRGUL]DDODGHUHFKD
3&1 GHWUiVGHO&RQGXFWRU

 %ROVDFRQHTXLSRGHOLPSLH]D\FDEOH  &DMDVREUHFDMDGHOSHULVFRSLR
GHFRQH[LyQGHOSHULVFRSLR3&1 3&1

 3HULVFRSLRGHUHVSHWRODWHUDOGH  &DMDVREUHFDMDGHOSHULVFRSLR
FRQGXFFLyQ 3&1





)LJXUD3ODQGHFDUJDHQHOLQWHULRUGHOFDVFR  

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

F *DIDVGHSURWHFFLyQGLXUQD  (QHOJDQFKRGHOFDVFRLQWHUIyQLFR


GHO-(&3
E &DVFRVGHJXHUUDGHO-9\  (QDWDODMHVREUHVRSRUWHMXQWRDDUPHUR
7LUDGRU GHGHWUiVGHO&(L]TGD
 /X]JLUDWRULDSDUDWHFKRWRUUH  6RSRUWHGHWUiVGHO&RQGXFWRU



 3HULVFRSLR0FHQWUDOGH  &DMDVREUHSDQHOGHLQVWUXPHQWRV
FRQGXFFLyQ
 $WDODMHSDUDHTXLSRV  'HWUiVGHO&VREUHQRGUL]D
F
 0RFKLODVGHFRPEDWHGH-97  (QDWDODMHF
D \&
 %ROVD1%4GHO&RQGXFWRU  (QDWDODMHF
D
 %ROVD(3,GHO&RQGXFWRU  (QDWDODMHF
D
 %ROVD(3,GHOD(&3GHOD  (QDWDODMHF
H L]GD
 &DVFRGHJXHUUDGHO  $ODL]GDGHOSDQHOGHLQVWUXPHQWRV
D &RQGXFWRU
E 0RFKLODVGHFRPEDWHGHOD  'HEDMRGHORVUHVSHFWLYRVDVLHQWRV
(&3
I %ROVDV1%4GH&(\HU  (QWUHSDUHG\DVLHQWR-(&3
IXVLOHURL]GD
E $WDODMHSDUDHTXLSRV  'HWUiVDVLHQWRVGFKDMXQWRDO6&&$

F &DVFRVGHJXHUUDGHOD(&3  (QDWDODMHE

G %ROVDV(3,GH(&3GFKD  (QDWDODMHE

H %ROVDV1%4GHIXVLOHURV  6RSRUWHVREUH&


GHUHFKD
I %ROVD(3,GHO-(&3  7UDVHUDFHVWDGFKD

F %ROVD1%4GHO7LUDGRU  7UDVHUDFHVWDGFKD

F %ROVD(3,GHO7LUHDGRU  -XQWRVXEROVD1%4

E %ROVD1%4GHO-9  'HODQWHFHVWD

E %ROVD(3,GHO-9  -XQWRVXEROVD1%4


F([WHULRUGHODWRUUH






)LJXUD3ODQGHFDUJDHQHOH[WHULRUGHODWRUUH


1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

D 5HGPLPpWLFD  &RVWDGRGHUHFKRGHODWRUUH

E 5HGPLPpWLFD  &RVWDGRL]TXLHUGRGHODWRUUH

D &DQGDGRVHVFRWLOODV  (QVXVHVFRWLOODVUHVSHFWLYDVRHQ


PDOHWHURH[WHULRUGHUHFKRGHODWRUUH



 6RSRUWHEDQGHUDV  7HFKRWRUUH

 %RPEDPDQXDOGHHQJUDVHFRQ  0DOHWHURL]GRWRUUH


ODWLJXLOOR
 $FHLWHUD  0DOHWHURL]GRWRUUH

 /LQWHUQD  &DMDVXSHULRUGHUHFKDGHWRUUH

 /iPSDUDSRUWiWLO  &DMDVXSHULRUGHUHFKDGHWRUUH

 *XDQWHV  &DMDVXSHULRUGHUHFKDGHWRUUH

 &DMDFRQOiPSDUDVGHUHSXHVWR  &DMDVXSHULRUGHUHFKDGHWRUUH


GHWRUUH
 &DMDFRQOiPSDUDVGHUHSXHVWR  &DMDVXSHULRUGHUHFKDGHWRUUH
GHFDVFR
 7DSDERFDGHOFDxyQ  7DSDUHJLVWURGHFDMDVXSHULRUGFKD

 7DSDERFDGHODDPHWUDOODGRUD  7DSDUHJLVWURGHFDMDVXSHULRUGFKD

 %ROVD~WLOHVGHOLPSLH]DGHO  &DMDLQIHULRUWRUUH SDUWHODUJD 


FDxyQ
 %ROVD~WLOHVOLPSLH]D  &DMDLQIHULRUWRUUH SDUWHODUJD 
DPHWUDOODGRUD
 &RPSUREDGRUODQ]DLQJHQLRVHQ  &DMDLQIHULRUWRUUH SDUWHODUJD 
HVWXFKH
 (VFRELOOyQOLPSLH]DWXERV  &DMDLQIHULRUWRUUH SDUWHODUJD 
ODQ]DLQJHQLRVFRQIXQGD
 %ROVD~WLOHVOLPSLH]D  &DMDLQIHULRUWRUUH SDUWHODUJD 
ODQ]DLQJHQLRV
 )HPLQHODGHEURQFHSDUD  &DMDLQIHULRUGHUHFKDWRUUH
UHFiPDUDFRQIXQGD
 )HPLQHODGHQ\ORQSDUD  &DMDLQIHULRUGHUHFKDWRUUH
UHFiPDUDFRQIXQGD
 %RWHGHJUDVDSDUDDUPDV  &DMDLQIHULRUGHUHFKDWRUUH

 %RWHGHDFHLWHOXEULFDQWH  &DMDLQIHULRUGHUHFKDWRUUH


G,QWHULRUGHODWRUUH





)LJXUD3ODQGHFDUJDHQHOLQWHULRUGHODWRUUH

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

D &DxyQGHUHVSHWRGHOD  (QODFHVWDSDUWHLQIHULRU]RQDGHO-9


DPHWUDOODGRUDFRD[LDO

 %ROVDGHKHUUDPLHQWDVGHOD  %DQGHMDHQWUH-9\7
WRUUH
 /ODYHSDUDDSHUWXUDH[WHULRUGH  $GRVDGDVODWHUDOPHQWHVREUHHO
ODVHVFRWLOODVGHODWRUUH PHFDQLVPRGHDSHUWXUDLQWHULRUGHODV
HVFRWLOODVGHO-9\GHO7




 3ULVPiWLFRVGHFDPSDxDSDUD  6REUHFDUJDGRUGHUHFKRGHOFDxyQ


HO-9
 %ROVDFRQMXHJRGHWUHV  6REUHFDUJDGRUL]TXLHUGRGHOFDxyQ
EDQGHUDVGHFRORUHVSDUD
VHxDOHV

E *DIDVSURWHFWRUDVSDUDHO-9  (QJDQFKRGHOFDVFRLQWHUIyQLFR


H$UPDPHQWROLJHUR\VXPXQLFLyQ





)LJXUD$UPDPHQWROLJHUR\VXPXQLFLyQ

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

 )86$/PP  
   
 )86$/ -9   (QDUPHURSDVLOOR&RQGXFWRU
 )86$/& 7   6REUHFDUJDGRUGHUHFKRHQWRUUH
 )86$/ &   6REUHSDQHODFFHVRPRWRU
 )86$/ -(&3   (QSRUWyQWUDVHUR



 )86$/ IXVLOHURV,]T   (QDUPHURSDVLOOR&RQGXFWRU
 )86$/ HUIXVLOHUR'FKD   (QSDQHO6&&$WUDVHURGFKD
 )86$/ žIXVLOHUR'FKD   (QSRUWyQWUDVHUR
 $PHWUDOODGRUDVOLJHUDVGH  
 PP  
   6RSRUWHPyYLOSDQHOHQWUHPRWRU\
 &(,]GD  WRUUH
   6REUHSDQHOGHO6&&$
&('FKD
 /DQ]DJUDQDGDVGHVHFKDEOHV&  %DVWLGRUGHWUiVDVLHQWRVWUDVHURV
 GFKD
 *UDQDGDVGHPDQR WXERV   6RSRUWHVREUHEDVWLGRUGH&
 GHWUiVGHOSULPHUDVLHQWR
 081,&,Ï100;  
 DGHPiVGHFDUJDGRUHV)86$\  
 FDUW0RFKLODV   
   EROVDV GH  FDUWXFKRV  3RUWyQWUDVHURHQEROVDVGHSOiVWLFR
 VLQHVODERQDUSDUD)86$   GH[ SDUD)86$ 
   EDQGROHUDV GH   6RSRUWHWUDVHURGHUHFKDGHWUiVGHO
 FDUWXFKRV HVODERQDGRV  6&&$
 SDUD$0(/,   3DVLOOR&RQGXFWRUGHODQWHGHDUPHUR
   EDQGROHUDV GH   
 FDUWXFKRV HVODERQDGRV  3DVLOOR&RQGXFWRUGHODQWHGHDUPHUR
SDUD$0(/, 
  EDQGROHUDV GH 
FDUWXFKRV HVODERQDGRV
SDUD$0(/, 

081,&,Ï1

D0XQLFLyQGHOFDxyQ




)LJXUD&RQWHQHGRUHVGHPXQLFLyQGHFDxyQ

1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1
 'HPP[  
 &DUJDGRUGHUHFKR HVODERQDGRV   /DGRGHUHFKRFiPDUDGH
FRPEDWH



 &DUJDGRUL]TXLHUGR HVODERQDGRV   /DGRL]TXLHUGRFiPDUDGH
FRPEDWH
 &RQWHQHGRUHVFRQHWLTXHWD  
DPDULOOD FRUUHVSRQGHDPXQLFLyQ
GHHMHUFLFLR 737 PXOWLSURSyVLWR
037 RURPSHGRU +(7 
   GH  WUDPR FDGD WUDPR  6REUHGHSyVLWRQRGUL]D
FRQVWD GH  SUR\HFWLOHV FRQ
HVODERQHV  [ 
  GHWUDPRV [   /DGRL]TXLHUGRFiPDUDGH
SHUVRQDO
  GHWUDPR [   ³³³³³
  GHWUDPRV [   ³³³³³
  GHWUDPR [   ³³³³³
  GHWUDPRV [   ³³³³³
  GHWUDPR [   ³³³³³
  GHWUDPRV [   

 &RQWHQHGRUHVFRQHWLTXHWDQHJUD   
PXQLFLyQSHUIRUDQWH $3)6'6 
  GHWUDPRV [   'HEDMRGHODFHVWD
  GHWUDPRV [   /DGRL]TXLHUGRFiPDUDGH
SHUVRQDO
  GHWUDPRV [   ³³³³³
 &DMDGLVSDURVVXHOWRV  
  FRQHWLTXHWDQHJUD  'HEDMRGHODFHVWD
  FRQHWLTXHWDDPDULOOD  ³³³³
 &DMDGLVSDURVVXHOWRVHWLTXHWD  ³³³³
DPDULOOD

E0XQLFLyQGHDPHWUDOODGRUD\ODQ]DLQJHQLRV





)LJXUD0XQLFLyQGHOD$0FRD[LDO\HOODQ]DLQJHQLRV



1ž '(120,1$&,Ï1 &DQW 8%,&$&,Ï1

 'HPP[SDUDDPHWUDOODGRUD  
 FRD[LDO  
D &DUJDGRUHQHODUPD  &RORFDGRHQVXDORMDPLHQWR
   GHODFHVWD
E &DUJDGRUGHUHVSHWR  'HEDMRGHODFHVWD )LJ
    


 FDMDV [   
   -XQWRDDUPHURSDVLOOR&
 FDMDV [   
  6RSRUWHWUDVHURGHWUiVGHO
6&&$
 'HO/DQ]DLQJHQLRV  
   
 %RWHVIXPtJHQRV  0DOHWHURVWUDVHURVWRUUH
   
 %RWHVIXPtJHQRV  (QORVWXERVGHODQWHURV
   
 *UDQDGDVIUDJPHQWDULDV  0DOHWHURVWUDVHURVWRUUH
   
 *UDQDGDVIUDJPHQWDULDV  (QORVWXERVWUDVHURV
 


5(680(1

(Q HVWD ILFKD VH GHVFULEHQ ORV HOHPHQWRV GHO ORWH GH D ERUGR GHO YHKtFXOR QR VH
FRQVLGHUDQHFHVDULRUHDOL]DUUHVXPHQ

35È&7,&$6

&RORFDUXQYHKtFXORHQOD]RQDGHKDQJDUHVGHVSOHJDUHOORWHGHDERUGRDOODGRGHO
YHKtFXOR SRVWHULRUPHQWH FDGD PLHPEUR GH OD WULSXODFLyQ UHDOL]DUi OD FRORFDFLyQ GH
ORVHOHPHQWRVTXHHQHOYHKtFXORVHSXHGHQLQVWDODU
 



),&+$'(7$5($

&Ï',*2

'(6&5,3&,Ï175$163257('(/9(+Ë&8/2

,'(17,),&$&,Ï1
1,9(/,,&ROHFWLYD(VSHFtILFD

7,32 /8*$5 '85$&,Ï1
7HyULFDSUiFWLFD $XOD\PXHOOHGHHPEDUTXH 7HRUtDPLQXWRV
 3UiFWLFDPLQXWRVWULS
$<8'$6$/$,16758&&,Ï1
9&,&
%,%/,2*5$)Ë$
0DQXDOWpFQLFR070DQXDOGHODWULSXODFLyQ


&21',&,21(6'((-(&8&,Ï1

6LHVSRVLEOHHQXQPXHOOHGHHPEDUTXHRVREUHXQDVXSHUILFLHOODQDVLWXDUXQ
YHKtFXORFRQHOPRWRUSDUDGR
6HGHVSOHJDUDWRGRHOPDWHULDOUHODFLRQDGRFRQHOHPEDUTXHGHOYHKtFXOR
(O LQVWUXFWRU H[SOLFDUi HO PDWHULDO \ OD IRUPD GH XWLOL]DFLyQ GHO PLVPR SUHVWDQGR
HVSHFLDODWHQFLyQDOFDO]DGRGHOYHKtFXOR
/DWULSXODFLyQUHDOL]DUiHOFDO]DGRGHOYHKtFXORWDQWDVYHFHVFRPRHVWLPHRSRUWXQRHO
LQVWUXFWRU


5(48,6,726$$/&$1=$5

/DWULSXODFLyQGHEHVDEHUUHDOL]DUHOHPEDUTXHGHOYHKtFXORSHUIHFWDPHQWH
/DWULSXODFLyQGHEHVDEHUFDO]DUHOYHKtFXOR\VDEHUXWLOL]DUWRGRHOHTXLSRGHDPDUUH
GHOYHKtFXOR


'(6$552//27(Ï5,&2'(/&217(1,'2

*(1(5$/,'$'(6

(O HPEDUTXH GHO YHKtFXOR 9&,& 3,=$552 GHEH HIHFWXDUVH VHJ~Q ODV
SUHVFULSFLRQHV JHQHUDOHV GHILQLGDV HQ OD LQVWUXFFLyQ UHODWLYD D OD HMHFXFLyQ GH ORV
WUDQVSRUWHV PLOLWDUHV SRU IHUURFDUULO /DV QRUPDV JHQHUDOHV TXH VLJXHQ D
FRQWLQXDFLyQVHGDQDWtWXORLQIRUPDWLYR
&RPRQRUPDJHQHUDO\DWHQGLHQGRDO67$1$*VREUHHPEDUTXHGHYHKtFXORV
SRU IHUURFDUULO HV SUHFHSWLYR TXH H[LVWD XQ -HIH GH 9HKtFXOR UHVSRQVDEOH GHO
PRYLPLHQWR VREUH ODV SODWDIRUPDV \ TXH UHFLED ODV QRYHGDGHV VREUH WRGDV ODV
RSHUDFLRQHVTXHVHGHVFULEHQHQHODSDUWDGR³(PEDUTXH´
(V DVLPLVPR LPSUHVFLQGLEOH TXH HQ HVWD RSHUDFLyQ FRPR HQ FXDOTXLHU RWUD HO
HPEDUTXH\HVWLEDGHOYHKtFXORORHIHFW~HODWULSXODFLyQDOFRPSOHWR8QDWULSXODFLyQ



LQFRPSOHWDFRPSRUWDVLHPSUHXQDGLVPLQXFLyQGHORVQLYHOHVGHVHJXULGDGH[LJLEOHV
HQHOPDQHMRGHYHKtFXORVDFRUD]DGRV
$GHPiVGHHVWRVHUHFRPLHQGDVHWRPHQODVVLJXLHQWHVSUHFDXFLRQHV
 (Q FDVR GH WHQHU TXH PDQLSXODU FRPSXHUWDV R FDUWRODV GH ORV YDJRQHV
KiJDVHFRQSUHFDXFLyQ\DOPDQGRGHXQDVRODSHUVRQD
 ([WUHPDU OD UHJODPHQWDULHGDG GH ODV VHxDOHV GH FRQGXFFLyQ 8QD VHxDO
LQDSURSLDGDRFRQIXVDSXHGHSURYRFDUDFFLGHQWHV
 1RFDPLQDUKDFLDDWUiVPLHQWUDVVHGLULJHDOYHKtFXOR
 (YLWDUODFHUFDQtDGHRWURVPLHPEURVGHODWULSXODFLyQDOYHKtFXORPLHQWUDVVH
PXHYH
 (QFDVRGHRSHUDFLRQHVGHHPEDUTXHQRFWXUQRFRPSUREDUTXH HOFRQGXFWRU
HQWLHQGHODVVHxDOHVFRQOLQWHUQD
 8VDUVLHPSUHJXDQWHVGXUDQWHODVRSHUDFLRQHVGHDPDUUHGHOYHKtFXOR


35(3$5$&,Ï1'(/9(+Ë&8/2

6HFRPSUREDUiQORVQLYHOHVGHDFHLWHVHOLPSLDUiHOYHKtFXOR\VHHQJUDVDUi
(QWLHPSRGHSD]HOYHKtFXORSXHGHVHUHPEDUFDGRFRQORVGHSyVLWRVGHFDUEXUDQWH
DGHVXFDSDFLGDG
$QWHV GH HPEDUFDU HO YHKtFXOR HO ORWH GH D ERUGR \ HTXLSDMH GHEH HVWDU
SHUIHFWDPHQWHHVWLEDGR
(QXQiUHDSUy[LPDDOPXHOOHGHHPEDUTXHGHEHUiSURFHGHUVHDUHWLUDUODVDQWHQDV\
WRGRV DTXHOORV FRPSOHPHQWRV H[WHULRUHV VXVFHSWLEOHV GH PRYLPLHQWR R SpUGLGD
GXUDQWHHOWUDQVSRUWHDEDWLUORVHVSHMRVUHWURYLVRUHV6LIXHUDDSRQHUVHXQDORQD QR
UHFRPHQGDEOH VDOYR FDVRV H[FHSFLRQDOHV  SURWHJHU ODV SDUWHV VDOLHQWHV SRU PHGLR
GHPDWHULDOHVGLYHUVRV FDXFKRWUDSRV DILQGHQRGDxDUOD&RORFDUODWRUUHDODV
HOFDxyQDž\SRQHUODVWULQFKDVFRUUHVSRQGLHQWHV


(0%$548(



3(/,*52
1268%,5$/9(+Ë&8/2(0%$5&$'26,1$6(*85$56(48(12&,5&8/$
&255,(17(325/$&$7(1$5,$3(/,*52'(08(57(


3(/,*52
6( (9,7$5È 6,(035( 48( 6($ 326,%/( 48( (/ 3(5621$/ $&7Ò(
62%5(/$63/$7$)250$6%$-2/$&$7(1$5,$

&RORFDU HO YHKtFXOR H[DFWDPHQWH HQ HO HMH GH OD SODWDIRUPD \ VHQVLEOHPHQWH HQ HO
FHQWUR GH PRGR TXH OD FDUJD VH GLVWULEX\D LJXDOPHQWH VREUH ORV HMHV 3HUVRQDO GH
5(1)(GHEHUiGDUHOYLVWREXHQR
3DUDHOHPEDUTXHSURSLDPHQWHGLFKRRSHUDUFRPRVLJXH
  0DQLREUDUHOYHKtFXORVLWXiQGRORHQSRVLFLyQVREUHODSODWDIRUPD
  8QDYH]FDO]DGRHOYHKtFXORSURFHGHUDVXLQPRYLOL]DFLyQ
  $FFLRQDUHOIUHQRGHDSDUFDPLHQWR
  6LWXDUODSDODQFDLQYHUVRUDHQ1


  6LWXDUHOYRODQWHGHGLUHFFLyQHQVXSRVLFLyQFHQWUDO
  &HUUDUHOSDVRGHFDUEXUDQWH
  &HUUDUGHVGHHOLQWHULRUODVHVFRWLOODVGHO-HIHGH9HKtFXOR\GHO7LUDGRU
  'HVFRQHFWDUHOLQWHUUXSWRUJHQHUDO
  8QD YH] ILQDOL]DGD WRGD OD PDQLREUD \ DQWHV GH DEDQGRQDU HO YHKtFXOR
FHUUDUGHVGHHOH[WHULRUODHVFRWLOODGHO&RQGXFWRUSRUPHGLRGHVXFDQGDGR


),-$&,Ï1'(/9(+Ë&8/2

D&DO]DGRGHOYHKtFXOR

(OFDO]DGRVREUHODSODWDIRUPDVHHIHFW~DSRUPHGLRGHXQRVFDO]RVPHWiOLFRV )LJ
 TXHVHILMDQDOSLVRGHODSODWDIRUPDLQWURGXFLHQGRVXWHWyQ  HQORVRULILFLRV
TXH SDUD WDO ILQ OOHYD GLFKD SODWDIRUPD (O XVR GH HVWRV FDO]RV HV QHFHVDULR
VRODPHQWH FXDQGR QR VH HPSOHDQ DPDUUDV R FXDQGR HPSOHiQGRVH ODV PLVPDV OD
SODWDIRUPD XVDGD HV GHO WLSR 300( GH VXHOR PHWiOLFR \ GH XVR HQ HO (MpUFLWR
(VSDxRO SDUD HO WUDQVSRUWH GH YHKtFXORV GH FDGHQDV GH JUDQ WRQHODMH 6H UHDOL]DUi
GHOPRGRVLJXLHQWH
  6HSRQGUiQHQVXOXJDUORVGRVFDO]RVGHODQWHURV
  6H DYDQ]DUi HO YHKtFXOR FRQ PXFKR FXLGDGR GH PRGR TXH OD SULPHUD UXHGD VH
VLW~H SRU HQFLPD GHO FDO]R \ VH LQPRYLOL]DUi HQ HVD SRVLFLyQ GXUDQWH XQRV
VHJXQGRV ORV VXILFLHQWHV SDUD VLWXDU ORV GRV FDO]RV WUDVHURV HQ VXV RULILFLRV
FRUUHVSRQGLHQWHV
  6LWXDGRVGLFKRVFDO]RVVHGHMDUiTXHHOYHKtFXORFDLJDDVXSRVLFLyQQDWXUDOFRQ
WRGDV VXV UXHGDV GH URGDMH DSR\DGDV VREUH OD SODWDIRUPD GH HVH PRGR HO
YHKtFXORTXHGDUiSHUIHFWDPHQWHFRORFDGRHQWUHORVFDO]RVGHODQWHURV\WUDVHURV
)LJ 
  3RQHUODVFDGHQLOODVGHVHJXULGDG  URGHDQGRODFDGHQDGHOYHKtFXOR



)LJXUD&DO]RV





)LJXUD6XMHFLyQGHOYHKtFXORDODSODWDIRUPD


E$PDUUH\HTXLSRGHWULQFDMH

3DUD DVHJXUDU OD LQPRYLOL]DFLyQ GHO YHKtFXOR GXUDQWH HO WUDQVSRUWH IHUURYLDULR VH
XWLOL]D XQ HTXLSR GH DPDUUH GHO WLSR & GH PDWHULDO VLQWpWLFR FRQ XQD FDUJD GH
WUDEDMRPtQLPDJDUDQWL]DGDSDUDFDGDDQFODMHGHN1SDUDXQSHVRPi[LPRGHO
YHKtFXORGHWFX\DXWLOL]DFLyQ\PDQHMRVHGHVFULEHDFRQWLQXDFLyQ

E  '(6&5,3&,Ï1'(/0$7(5,$/
&RQVWD GH XQD EROVD GH WHOD FRQIHFFLRQDGD HQ Q\ORQ YHUGH 27$1 FRQ DVDV GH
SROLpVWHU(OFLHUUHVHDVHJXUDFRQFXDWURFLQWDVSRUFLHUUHGHSUHVLyQFRQPXHOOHGH
DFHUR LQR[LGDEOH (VWi GLPHQVLRQDGD SDUD FRQWHQHU WRGRV ORV DFFHVRULRV GHO NLW GH
WULQFDMHFRPSXHVWRSRU
 WHQVRUHV
 HVOLQJDV
 SURWHFFLRQHVDGLFLRQDOHV
 OODYHILMDGHODPHGLGDLGyQHDSDUDHOGHVPRQWDMHGHOWULiQJXORGHDQFODMH

x $1&/$-(6

'H FRORU YHUGH 27$1 H[FHSWR OD HWLTXHWD \ FRPSXHVWRV GH ORV VLJXLHQWHV
HOHPHQWRV
 7HQVRU5HDOL]DGRHQDFHURFLQFDGR\GRWDGRGHXQVHJXURFRQWUDGHVEORTXHR
DFFLGHQWDO \ GH XQ GLVSRVLWLYR GH GHVDSULHWH JUDGXDO GHO DQFODMH HQ WHQVLyQ
0HGLDQWH XQ PHFDQLVPR DFWLYDEOH VyOR FRQ HO GHVEORTXHR GH OD PDQLOOD OD
FLQWDEDMRWHQVLyQSXHGHVHUDIORMDGRJUDGXDOPHQWH
 *DQFKRGHRMDOFRQFLHUUHGHVHJXULGDG5HDOL]DGRHQDFHURIRUMDGR\FLQFDGR
LQFOXLGR HO FLHUUH GH VHJXULGDG HO PXHOOH GH DFHUR LQR[LGDEOH OD WXHUFD
DXWREORFDQWH\HOWRUQLOORLQR[LGDEOH
 7ULiQJXORGHVPRQWDEOH5HDOL]DGRHQDFHURIRUMDGR\FLQFDGR
 %DQGD 5HDOL]DGD FRQ FLQWD GH SROLpVWHU WHUPRILMDGR \ SLJPHQWDGR SDUD XQD
PD\RU UHVLVWHQFLD DO GHVJDVWH 7RGDV ODV FRVWXUDV HVWiQ KHFKDV FRQ KLOR GH
SROLpVWHU
 3URWHFFLyQ GHVOL]DEOH 7HMLGD HQ SROLpVWHU FRQ UHYHVWLPLHQWR DQWLFRUWH HQ
6HFXWH['HEHXWLOL]DUVHHQODSUR[LPLGDGGHDULVWDVSDUDHYLWDUHOURFHGHOD
FLQWD\PHMRUDUHOWHQVDGR


 &LQWDV GH VXMHFLyQ 5HDOL]DGDV HQ SROLpVWHU \ GRWDGDV GH FLHUUH FRQ PXHOOH
LQR[LGDEOHHQVXH[WUHPR/DFRVWXUDLPSHUGLEOHHQHOH[WUHPROLEUHGHODFLQWD
FXPSOHODVIXQFLRQHVGHHYLWDUHOGHVKLODGRGHODFLQWDEDMRWHQVLyQ\UHFRJHU
HOVREUDQWHDVtFRPRUHFRJHUHOFRQMXQWRHQFRQGLFLRQHVGHQRXWLOL]DFLyQ
 (WLTXHWD5HDOL]DGDHQ39&\FRVLGDGHPDQHUDLPSHUGLEOHHQODJD]DGHOD
FLQWD &DGD HWLTXHWD LQGLFD OD UHVLVWHQFLD HQ N1 IHFKD GH IDEULFDFLyQ \ GH
LQVSHFFLyQ\QRPEUHGHOIDEULFDQWH(VGHFRORUD]XO

x &$%/(6

(VWiQ UHDOL]DGRV FRPSOHWDPHQWH HQ SROLpVWHU WHUPRILMDGR \ SLJPHQWDGR SDUD
LQFUHPHQWDU VX UHVLVWHQFLD DO GHVJDVWH (VWiQ FRPSXHVWDV GH XQD HVOLQJD UHGRQGD
LQWURGXFLGDHQXQDSURWHFFLyQWXEXODUFRQORTXHDSDUHFHFRPRVLWXYLHVHGRVJD]DV
HQ VXV H[WUHPRV TXH VH SXHGHQ DFRSODU DO JDQFKR WHUPLQDO GHO DQFODMH 7DQWR OD
IXQGDFRPRHOWLUDQWHOOHYDQFRVLGRHQUHOLHYHHOtQGLFHGHXWLOL]DFLyQ HQN1 HOWLSR
GHDQFODMH\HOQRPEUHGHOIDEULFDQWH
3URWHFFLRQHV DGLFLRQDOHV DQWLFRUWH GH GREOH FDUD 5HDOL]DGDV HQ SROLpVWHU FRQ
UHFXEULPLHQWRGHSROLXUHWDQR\GLPHQVLRQDGDVSDUDDGDSWDUVHDODFLQWD6XIRUPDGH
FOLS IDFLOLWD HO OLEUH SRVLFLRQDPLHQWR SURWHJH GH OD VXFLHGDG \ UHVJXDUGD DO 9HOFUR
FRVLGRHQWRGDVXORQJLWXG7RGRVORVHOHPHQWRVWLHQHQFRORUYHUGH27$1

x &216(59$&,Ï1

/D FRQVHUYDFLyQ FXLGDGRVD GHO HTXLSR PDQWLHQH OD HILFDFLD D ODUJR SOD]R 3DUD HO
DOPDFHQDPLHQWRGHFDGDHTXLSRVHJXLUODVVLJXLHQWHVUHFRPHQGDFLRQHV
 *XDUGDUHONLWHQXQOXJDUVHFRRVFXUR\OHMRVGHFXDOTXLHUIXHQWHGHFDORU
 9HULILFDUTXHWDQWRODEROVDFRPRHOFDMyQHVWiQGHELGDPHQWHFHUUDGRV
 1R DSLODU FDMRQHV SRU HQFLPD GH FXDWUR DOWXUDV \ DVHJXUDUVH GH TXH HVWiQ
GHELGDPHQWHDOLQHDGRVXQRVHQFLPDGHRWURV
 7UDQVSRUWDU XQD VROD FDMD FDGD YH] \ VL VH HPSOHD FDUUHWLOOD HOHYDGRUD
HQJDQFKDUODGHPDQHUDWUDQVYHUVDO
 1RDUUDVWUDUODVFDMDVQLJROSHDUODVXQDFRQWUDRWUD

E  862'(/(48,32
&RQ HO ILQ GH DVHJXUDU OD LQPRYLOL]DFLyQ GHO YHKtFXOR VREUH HO SODQR GH FDUJD GHO
YDJyQ WDQWR HQ VHQWLGR ORQJLWXGLQDO FRPR HQ HO WUDQVYHUVDO HO HTXLSR GH DPDUUH
SUHYp OD XWLOL]DFLyQ GH DQFODMHV SRU PHGLR GH FLQWDV GH SROLpVWHU FRQ WHQVRUHV \
HVOLQJDV

E  87,/,=$&,Ï1'(/$0$55(
6H GHEHQ ILMDU GRV DQFODMHV D FDGD H[WUHPR GHO YHKtFXOR (VWRV GHEHQ WUDEDMDU
FUX]DGRV GH PDQHUD TXH SXHGDQ VRSRUWDU GHELGDPHQWH WDQWR ORV HVIXHU]RV
WUDQVYHUVDOHVFRPRORVORQJLWXGLQDOHV
(V QHFHVDULR GLVSRQHU ORV DQFODMHV WUDQVYHUVDOPHQWH DO HMH ORQJLWXGLQDO GHO YDJyQ
FRQXQiQJXORGHDOPHQRVžFRQUHVSHFWRDOIURQWDOGHOYHKtFXOR
3DUDJDUDQWL]DUXQEXHQDPDUUHVHGHEHQWRPDUODVVLJXLHQWHVSUHFDXFLRQHV
 1R FRPSDUWLU SXQWRV GH DQFODMH FDGD SXQWR GH DQFODMH WDQWR GHO YHKtFXOR
FRPRGHOYDJyQVRSRUWDUiQXQVRORDPDUUH
 8WLOL]DUWRGRV\FDGD XQRGHORVGLVSRVLWLYRVGHONLWGHOPRGR DGHFXDGRWDO \
FRPRVHLQGLFD

E  381726'($1&/$-(


(Q FDGD H[WUHPR GHO YHKtFXOR VH GHEHQ ILMDU GRV DQFODMHV TXH KDQ GH HVWDU
GLVSXHVWRV WUDQVYHUVDOPHQWH DO HMH ORQJLWXGLQDO GHO YDJyQ TXH GHEHQ SHUPLWLU HO
DPDUUHODWHUDOGHOYHKtFXOR
 'HODQWH )LMDU OD H[WUHPLGDG GHO FDEOH GH VXMHFLyQ D OD DUJROOD GHUHFKD GH OD
SODWDIRUPD VXMHWDU HO DQLOOR GH OD RWUD H[WUHPLGDG HQ HO JDQFKR GH UHPROTXH
L]TXLHUGRGHOYHKtFXOR\WHQVDUHOFDEOH3URFHGHUGHODPLVPDPDQHUDTXHVH
KDSURFHGLGRFRQODDUJROODL]TXLHUGDGHODSODWDIRUPD\HOJDQFKRGHUHFKRGHO
YHKtFXOR
 'HWUiV'HODPLVPDPDQHUDTXHVHKDSURGXFLGRHQODSDUWHGHODQWHUD


35(&$8&,Ï1
$QWHVGHLQLFLDUHOWHQVDGRVHGHEHYHULILFDUODFRUUHFWDSRVLFLyQGHODQFODMH\
GHOJDQFKRGHVHJXULGDG

E  87,/,=$&,Ï1'(/$(6/,1*$
/D HVOLQJD GHEH HPSOHDUVH FRPR DFFHVRULR GHO VLVWHPD ~QLFDPHQWH HQ HO FDVR GH
TXHQRVHDSRVLEOHODXWLOL]DFLyQGLUHFWDGHOJDQFKRGHVHJXULGDGHQDOJXQRGHHVWRV
FDVRV
 /RVSXQWRVGHDQFODMHGHOYHKtFXORHVWiQURWRVRHQPDOHVWDGR
 /DSODWDIRUPDQRGLVSRQHGHDQFODMHVDGHFXDGRV
 /DVGLPHQVLRQHVGHOSXQWRGHDQFODMHQRVRQFRPSDWLEOHVFRQHOJDQFKR
 1HFHVLGDGGHSURORQJDUHODQFODMH
 1HFHVLGDGGHILMDUHODQFODMHDOEDVWLGRUGHOYDJyQRGHOYHKtFXOR


E  0217$-('(/$(6/,1*$
&XDQGR VHD QHFHVDULR OD XWLOL]DFLyQ GH HVWH DFFHVRULR SXHGH VHU PRQWDGR
LQGLVWLQWDPHQWH VREUH FXDOTXLHUD GH ODV GRV H[WUHPLGDGHV GHO HTXLSR 6LQ HPEDUJR
HVWiQSUHYLVWDVGRVFRQILJXUDFLRQHVGLIHUHQWHV )LJ 
 7LURGLUHFWR,QVHUWDQGRXQDJD]DGHOWLUDQWHHQHOJDQFKRGHODQFODMH\ODRWUD
GLUHFWDPHQWHDOSXQWRGHDQFODMHGHOYHKtFXORRYDJyQ  
 7LUR GREOH R FHVWR LQVHUWDQGR DPEDV JD]DV HQ HO JDQFKR GHO WULQFDMH
KDELHQGR SDVDGR SUHYLDPHQWH HO WLUDQWH SRU HO EDVWLGRU GHO YHKtFXOR R GHO
YDJyQ  



)LJXUD0RQWDMHGHODHVOLQJD


E  87,/,=$&,Ï1'(/$3527(&&,Ï1$',&,21$/
'XUDQWHHOSURFHVRGHDPDUUHGHOYHKtFXORPLOLWDUVREUHODSODWDIRUPDIHUURYLDULDVH
GHEH HYLWDU VLHPSUH HO FRQWDFWR GH OD EDQGD WH[WLO FRQ DULVWDV YLYDV R ERUGHV
FRUWDQWHV (Q HVWRV FDVRV VH GHEHQ XWLOL]DU VLHPSUH ODV SURWHFFLRQHV GHVOL]DQWHV \
ODVSURWHFFLRQHVDGLFLRQDOHVVXPLQLVWUDGDVHQHONLW )LJ 





)LJXUD8WLOL]DFLyQGHODSURWHFFLyQDGLFLRQDO

(OXVRGHODSURWHFFLyQ6HFXWH[HYLWDFRUWHV\GHVJDUUDGXUDVGHODFLQWDGHWULQFDMH
GLVPLQX\HQGRUR]DGXUDV\PHMRUDQGRHOWHQVDGR
(QHOFDVRGHXQYDJyQGRWDGRFRQHQJDQFKHHQODSDUWHLQIHULRUGHODSODWDIRUPD
SRVLFLRQDUODSURWHFFLyQGHVOL]DEOHGHODQFODMHVREUHODDULVWDLQIHULRUGHODSODWDIRUPD
\ODSURWHFFLyQDGLFLRQDOVREUHODDULVWDVXSHULRU
7DPELpQ VH GHEHQ HPSOHDU ODV SURWHFFLRQHV SURYLVWDV GH FLHUUH ³YHOFUR´ HQ ORV
FUXFHV GH ODV FLQWDV SDUD SURWHJHU GH OD IULFFLyQ GH XQD FLQWD FRQWUD RWUD 6H
HPSOHDUi XQD IXQGD SDUD FDGD EDQGD \ HQ HO FUXFH VH DSR\DUi XQD SURWHFFLyQ
FRQWUDRWUD

E  6,67(0$'('(67(16$'2&21752/$'2
&XDQGR GXUDQWH HO WUDQVSRUWH XQD FDUJD KD DOFDQ]DGR XQD SRVLFLyQ LQHVWDEOH OD
OLEHUDFLyQ V~ELWD GH OD VXMHFLyQ SXHGH FDXVDU VHULRV GDxRV 3DUD HYLWDU ULHVJRV
LQ~WLOHVVHGHEHDFFLRQDUHOGLVSRVLWLYRGHGHVWHQVDGRFRQWURODGR
3DUDWHQVDUXQDQFODMHSURFHGHUGHODVLJXLHQWHIRUPD )LJ 
  ,QWURGXFLUODH[WUHPLGDGOLEUHGHODFLQWDSRUODUDQXUDGHOHMHGHOWHQVRU\WHQVDUOD
OLJHUDPHQWHDPDQR $ 
  'HVEORTXHDUHOVHJXURGHOWHQVRU\OHYDQWDUODPDQLOOD % 
  $FFLRQDUUHSHWLGDVYHFHVODPDQLOODKDVWDDOFDQ]DUODWHQVLyQGHVHDGD & 
  (PSXMDUODPDQLOODKDVWDODSRVLFLyQGHUHSRVRDFWLYDQGRHOVHJXURGHOWHQVRU ' 



)LJXUD7HQVDGRGHXQDQFODMH

&RPROLEHUDUXQDQFODMH )LJ 
  'HVEORTXHDUHOVHJXURWHQVRU\OHYDQWDUODPDQLOOD ( 
  0DQWHQLHQGR HO VHJXUR GHVEORTXHDGR OOHYDU OD PDQLOOD GHO WHQVRU D OD SRVLFLyQ
LQWHUPHGLDGHGHVWHQVDGR ) \DFFLRQDUUHSHWLGDPHQWHODPDQLOODSDUDGLVPLQXLU
ODWHQVLyQGHODQFODMHVLQOOHJDUQXQFDKDVWDORVž
  'HVEORTXHDUHOVHJXURGHOWHQVRU\OOHYDUODPDQLOODDODSRVLFLyQFRPSOHWDPHQWH
DELHUWDOLEHUDQGRODFLQWDGHOPROLQHWH * 
  /OHYDUODPDQLOODDODSRVLFLyQGHUHSRVR + 





)LJXUD/LEHUDFLyQGHXQDQFODMH


35(&$8&,Ï1
(Q FDVR GH UHTXHULUVH XQ GHVEORTXHR LQPHGLDWR SRU UD]RQHV GH HPHUJHQFLD
RPLWLUORVGRVSDVRVDQWHULRUHV\HPSH]DUGLUHFWDPHQWHSRUHVWH.


1250$6*(1(5$/(6'(6(*85,'$'

(VWH FRQMXQWR GH PDWHULDOHV HVWi GHVWLQDGR H[FOXVLYDPHQWH DO DPDUUH GHO YHKtFXOR
VREUH SODWDIRUPDV IHUURYLDULDV \ QR GHEH XWLOL]DUVH SDUD HOHYDU FDUJDV UHPROFDU
YHKtFXORV R FXDOTXLHU RWUD FRVD TXH QR VHD OD HVSHFtILFD SDUD OD TXH KD VLGR
GLVHxDGR

D&RQWUROHV

$QWHVGHHIHFWXDUXQDPDUUHVHJXLUVLHPSUHHVWRVFRQWUROHV
  9HULILFDUTXHHONLWDHPSOHDUHVHOTXHFRUUHVSRQGHDOYHKtFXOR
  9HULILFDU TXH HO FRQWHQLGR GH OD EROVD VH FRUUHVSRQGH FRQ OR HVSHFLILFDGR HQ OD
HWLTXHWD
  $QWHVGHFDGDXVRYHULILFDUODSUHVHQFLDGHWRGRVORVFRPSRQHQWHV\FRQWURODUVX
HVWDGR\IXQFLRQDPLHQWR
  9HULILFDUTXHQLODVFLQWDVQLORVWLUDQWHVSUHVHQWDQQXGRVFRUWHVRGHVJDUURV
  9HULILFDU TXH WRGRV ORV FRPSRQHQWHV PHWiOLFRV FRPR WHQVRUHV JDQFKRV \
WULiQJXORVHVWiQHQEXHQHVWDGR

E3UHFDXFLRQHV

3DUD  JDUDQWL]DU OD Pi[LPD HILFLHQFLD GHO NLW  GHEHQ VHJXLUVH ODV VLJXLHQWHV
SUHFDXFLRQHV
  1RXWLOL]DUHONLWVLDOJ~QFRPSRQHQWHHVWiGDxDGR
  1RDQXGDUQLHQOD]DUODVFLQWDVGHODQFODMHRODVHVOLQJDV
  1XQFD GHMDU HQ HO VXHOR QLQJ~Q FRPSRQHQWH GHO NLW QL GRQGH DOJ~Q YHKtFXOR
SXHGDSDVDUOHSRUHQFLPD
  (PSOHDU VLHPSUH SURWHFFLRQHV SDUD SURWHJHU OD EDQGD WH[WLO GH DULVWDV R ERUGHV
FRUWDQWHV
  /DV FLQWDV R HVOLQJDV QR GHEHQ VHU GHSRVLWDGDV FHUFD GH XQD IXHQWH GH FDORU R
OODPD
  1RGHVPRQWDUQLQJ~QHOHPHQWRGHOFRQMXQWRGHONLW




F6HJXULGDG

3DUDJDUDQWL]DUODPi[LPDVHJXULGDGVHGHEHHIHFWXDUXQDVHQFLOODLQVSHFFLyQYLVXDO
GH WRGRV ORV FRPSRQHQWHV GHO HTXLSR DQWHV GH VHU XWLOL]DGRV (Q HO FDVR GH
HQFRQWUDUVH DOJ~Q GHVSHUIHFWRHO HTXLSR VHUi UHWLUDGR GH XVR \ HQYLDGR DO VHUYLFLR
GHPDQWHQLPLHQWRSDUDVXVXVWLWXFLyQDVtFRPRFXDQGR
  (OFRPSRQHQWHQRHVWiGHELGDPHQWHLGHQWLILFDGRRVXQ~PHURGHUHIHUHQFLDQRVH
FRUUHVSRQGH
  /D EDQGD WH[WLO GHO HTXLSR R GH OD HVOLQJD SUHVHQWD GDxRV GHELGRV DO FDORU R D
VXVWDQFLDVTXtPLFDV
  /DVJD]DVGHOHTXLSRRGHODHVOLQJDHVWiQGDxDGDV
  /DIXQGDH[WHULRUGHOWLUDQWHHVWiGHWHULRUDGD
  &XDOTXLHU HOHPHQWR PHWiOLFR GHO VLVWHPD FRPR WHQVRU WULiQJXOR R JDQFKR KD
VRSRUWDGR XQD VROLFLWDFLyQ WDO TXH KD VXSHUDGR HO OtPLWH HOiVWLFR GH DFHUR
SURGXFLHQGRXQDGHIRUPDFLyQSHUPDQHQWH

G5HFXSHUDFLyQ

8QD FRUUHFWD UHFXSHUDFLyQ GHO HTXLSR JDUDQWL]D VLHPSUH XQD UiSLGD \ HILFLHQWH
GLVSRQLELOLGDGSDUDVXXWLOL]DFLyQSDUDORFXDO
 7RGR DQFODMH GHEH JXDUGDUVH HQUROODGR FXLGDGRVDPHQWH VREUH Vt PLVPR \
VXMHWRFRQODVFLQWDVDGHFXDGDVWDOFRPRVHPXHVWUDHQODILJXUD
 *XDUGDUWRGRHOPDWHULDORUGHQDGDPHQWH DPDUUHVWLUDQWHV\SURWHFFLRQHV HQ
VXSURSLDEROVDVLJXLHQGRODLQIRUPDFLyQLQGLFDGDHQODHWLTXHWD


)LJXUD$QFODMHSDUDJXDUGDU

$QWHVGHJXDUGDUHODQFODMHWHQHUHQFXHQWDODVVLJXLHQWHVSUHFDXFLRQHV
 6LHOHTXLSRKDHQWUDGRHQFRQWDFWRFRQDFHLWHRFDUEXUDQWHGHEHVHUODYDGR
FXLGDGRVDPHQWHFRQDJXDMDERQRVD
 6L KD VXIULGR VDOSLFDGXUDV GH GHWHUJHQWH FDO R SURGXFWRV VDOLQRV GHEH VHU
ODYDGRFRQDJXDGXOFH
 /DFLQWDRORVWLUDQWHVMDPiVGHEHQVHFDUVHFHUFDGHOIXHJRQLGHRWUDIXHQWH
GHFDORU





)LJXUD&RWDV\JiOLERVGHOYHKtFXORVREUHODSODWDIRUPDIHUURYLDULD


5(680(1

(QHVWDILFKDVHGHVFULEHQORVSDVRVDVHJXLUSRUODWULSXODFLyQSDUDHOHPEDUTXH\
WUDQVSRUWHGHOYHKtFXORQRVHFRQVLGHUDQHFHVDULRUHDOL]DUUHVXPHQ


35È&7,&$6




ANEXO A

NORMAS DE SEGURIDAD

A. Generales:

 No fumar dentro del vehículo ni en sus proximidades.


 Evitar la caída de objetos de los bolsillos.
 Para subir y bajar a la parte exterior del vehículo, hacerlo por la parte
delantera.
 Al subir o bajar del vehículo no agarrar o pisar sitios inadecuados
(cables, faros, ópticas, etc.)
 Antes de poner el motor en marcha:
o Tocar la bocina varias veces, si está autorizado.
o Vigilar que no haya nadie próximo al vehículo ni a la salida del
escape.
 No mantener el motor en marcha en local cerrado.
 Cuando el vehículo se desplace con ayuda de guías, al Conductor sólo
le dirigirá uno. Si el vehículo oculta al guía, se auxiliará con otro guía,
pero seguirá siendo únicamente uno de ellos quien transmita las
órdenes al Conductor.
 El guía se colocará a ocho metros, como mínimo, delante del vehículo y,
si se ha de mover, no lo hará marchando hacia atrás.
 Al acercarse el vehículo a cualquier obstáculo, el guía y sus auxiliares,
deben colocarse fuera de la trayectoria que vaya a seguir.
 Todo el personal que se encuentre en las proximidades de un vehículo
tomará precauciones para no ser alcanzado por éste en los giros. La
distancia no será inferior de tres metros.
 Manipular los portones, escotillas y registros con precaución para evitar
accidentes.
 Comprobar que portones y escotillas queden asegurados por sus
pestillos de fijación.
 Durante la marcha del vehículo, cada tripulante ocupará su puesto.
 Si se ilumina la luz general de aviso y suena el zumbador, parar el
vehículo y comprobar los testigos que se han encendido. Tener en
cuenta los niveles de alarma que se especifican en el Capítulo 5 del
Tomo I de este Manual, y obrar según lo especificado.
 Al repostar el vehículo, cuidar que:
o El interruptor general (INT.PRIN.BATERIAS) esté desconectado
(en 0).
o Si se utiliza manguera metálica, aunque sólo sea la boquilla,
mantenerla en contacto permanente con la boca de llenado, para
evitar que pueda saltar alguna chispa entre la boquilla y la boca
de llenado.

A-1
o Un tripulante permanecerá, durante toda la operación con un
extintor portátil en la mano y con la boca de salida dirigida a la
boca del depósito, dispuesto a ponerlo en funcionamiento al
instante.
o No abrir los bidones o petacas golpeándolos con objetos
metálicos.

B. Específicas:

 Antes de poner en funcionamiento la torre, debe ponerse en marcha el


motor del vehículo, a no ser que la torre esté recibiendo alimentación
eléctrica de una fuente exterior a través de la toma existente en el casco,
para evitar que el consumo eléctrico pueda agotar las baterías.
 No poner en funcionamiento la torre hasta que todo el personal esté en
sus puestos y preparado para el movimiento de la torre y del cañón, con
las escotillas del casco y la cesta de la torre cerradas. Ninguna persona
está autorizada a permanecer en la zona barrida por la torre y el cañón.
 Cuando se opere con la torre, poner en su lugar y en funcionamiento la
luz giratoria.
 Cuando se conecte el interruptor ANULACIÓN SEGURO ESCOTILLAS
(bajo la responsabilidad del Jefe de Vehículo) que permite el
funcionamiento del sistema de movimiento de torre y cañón con las
escotillas del casco abiertas, SE PRESTARA ATENCIÓN ESPECIAL
para no golpear la torre o el cañón con ellas.
 En Ejercicios no se permitirá que personal alguno esté en la zona batida
por las armas. Cuando éstas estén dispuestas para el tiro y antes de
comenzar el mismo, se deberá avisar con señales claras, para que todo
el personal se retire de la zona batida, de modo que la zona de tiro esté
limpia de personal y vehículos.
 El uso de munición MP/HEI está prohibido con tormentas de granizo o
lluvias fuertes, por el peligro de explosión prematura.
 Si el vehículo va a utilizarse cerca o debajo de cables de alta tensión,
deberán abatirse las antenas. Si no se realiza esta operación, podrían
ocasionarse heridas graves al personal o incluso la muerte y graves
averías en el equipo.
 Procurar que las antenas no golpeen las ramas, cables de conducción
eléctrica, edificios, etc.
 No cruzar las antenas al abatirlas, pues se podrían producir averías en
las radios.
 No intentar salir o entrar del puesto de conducción hasta que el Jefe de
Vehículo haya puesto en OFF el interruptor SERVO. Los tripulantes que
no estén en sus puestos al girar la torre o mover el cañón, corren grave
peligro.
 El jefe de vehículo desconectará el movimiento automático de la torre y
del cañón, antes de permitir que la tripulación abandone sus puestos.

A-2
C. Con respecto al láser:

PELIGRO
EL RAYO LÁSER ES PELIGROSO Y PUEDE CAUSAR CEGUERA SI
PENETRA DIRECTAMENTE EN EL OJO HUMANO O SI SE REFLEJA EN
UNA SUPERFICIE PULIDA.

 La tripulación se encuentra protegida en el interior del vehículo contra


las radiaciones de un láser del tipo Nd-YAG, si las escotillas
permanecen cerradas y los filtros de protección originales de los
elementos ópticos no han sido dañados.
 Todo el personal que se encuentre dentro del campo de seguridad del
láser deberá llevar puestas gafas con un nivel mínimo de protección de
factor 7 (OD 7) para una longitud de onda de 1.064 nm. Esta norma es
también de aplicación si se usan filtros de amortiguación.
 El área de peligro láser debe ser señalizada por medio de señales de
peligro y carteles de advertencia, debiendo asegurarse que nadie pueda
introducirse inadvertidamente en la zona.
 El área de peligro láser se calcula a partir de los sectores de tiro en
dirección y elevación autorizados según las normas particulares de
seguridad láser del lugar del ejercicio, ampliados con un sector de
seguridad de 5 milésimas y de la distancia de seguridad láser.
 Para evitar accidentes al personal sin protección ocular, queda prohibido
disparar el rayo láser:
o Dentro del acuartelamiento.
o Contra blancos de prueba que reflejen el rayo o a superficies que
puedan interceptarlo.
o Cuando haya personal dentro de una zona de 20° de la línea de
mira del láser.
o En ejercicios tácticos de doble acción salvo que todo el personal
sea equipado con gafas protectoras antiláser
 Las distancias mínimas permisibles a los blancos estando el láser en
funcionamiento deben ser:
o 500 m si se carece de filtros amortiguadores.
o 300 m si se dispone de filtros amortiguadores.
 Tan solo pueden ser realizadas mediciones sobre aquellos objetivos que
hayan sido designados para tal fin por el Jefe del Campo de tiro o el
director del ejercicio.
 Los operadores del telémetro láser solo podrán utilizarlo sobre objetivos
designados como tales objetivos láser y nunca sobre cristales planos u
otros objetivos de superficies pulidas.
 En caso de que personal no autorizado aparezca en el campo de
seguridad del láser, se interrumpirá inmediatamente el funcionamiento
de éste.
 No se deben utilizar instrumentos tales como telescopios, periscopios y
binoculares para observar un objetivo que está siendo impactado por el
A-3
rayo láser, a no ser que todas las superficies pulidas del objetivo hayan
sido eliminadas, o que se utilicen filtros o protectores oculares contra
rayos láser.
 El régimen de funcionamiento del láser en el marco de la instrucción de
combate y tiro sólo podrá ser de total libertad si se dan las medidas
internas y externas de seguridad y está presente el encargado de
seguridad láser.
 El Jefe de Vehículo será el responsable de la puesta en funcionamiento
del láser de su vehículo. así como de su correcta utilización y ningún
miembro de la tripulación deberá hacer uso del mismo sin su
autorización.
 Jefe de Vehículo debe estar presente siempre que el láser del VCI/C
esté activado.
 El Jefe de Vehículo, o la persona designada para el control del
funcionamiento del mismo, deberá conocer antes del ejercicio, las
distancias de seguridad conforme a las normas particulares de
seguridad del lugar donde se vaya a desarrollar el ejercicio.
 No debe colocarse ningún objetivo dentro del sector de seguridad.
 Antes de utilizar el láser comprobar que todos los visores ópticos han
sido equipados con sus filtros de seguridad.
 Antes de disparar el telémetro láser, comprobar que el escudo balístico
del visor del Tirador está abierto y asegurado.

D. Con respecto a la corriente eléctrica.

Para cables del vehículo:

 Antes de desconectar el cable de alimentación del periscopio de


conducción nocturna o del codo pasivo del Tirador, deberán haber
estado apagados al menos durante un minuto.
 Los conectores eléctricos sueltos deberán apretarse tan solo cuando la
torre haya sido desconectada (interruptor TORRE ON/OFF en OFF) y el
interruptor general de baterías (INT.PRIN.BATERIAS) se encuentre en
posición 0 (desconectado).
 Todas las tomas eléctricas deberán estar cubiertas con su conector, o
bien con su tapa protectora, si están libres.
 Si se descubre un cable con el aislamiento en malas condiciones no se
deberá conectar al aparato eléctrico correspondiente, o se apagará éste.
 Como norma general, no tocar ningún cable que se encuentre dañado.
Notificarlo inmediatamente al 2º Escalón de Mantenimiento para que
proceda a su sustitución.
 Cuando se realicen trabajos dentro del vehículo, se utilizarán tan solo
aparatos que utilicen una tensión de 24 V, lo que significa la utilización
de transformadores en algunos casos.

A-4
Para cables exteriores de alta tensión.

PELIGRO
EXISTE PELIGRO DE MUERTE EN LAS PROXIMIDADES DE ELEMENTOS
EN CONTACTO CON CONDUCTORES ELÉCTRICOS DAÑADOS Y AL
DESCUBIERTO, ASÍ COMO TOCAR EL VEHÍCULO Y EL SUELO, ESTANDO
AQUEL EN CONTACTO CON UN CABLE AL DESCUBIERTO.

El riesgo de contacto, dentro de un vehículo de este tipo, con tendidos


eléctricos de alta tensión caídos aparece, especialmente, cuando se trabaja en
condiciones de oscuridad, visibilidad limitada, tiempo atmosférico extremo o
durante el uso de vehículos de recuperación. En estos casos, la tripulación
deberá adoptar las siguientes medidas:
 No debe abandonar el vehículo.
 Si es posible, mover el vehículo y sacarlo de la zona de peligro.
 Si el vehículo se encuentra inmovilizado y resulta imprescindible el
abandono del mismo, saltar del vehículo con los pies juntos lo más lejos
posible.
 ESTABLECER UNA ZONA DE SEGURIDAD EN TORNO A CABLES
ELÉCTRICOS CAÍDOS, DE 10 m DE RADIO Y CONTACTAR CON LA
EMPRESA CORRESPONDIENTE DE SUMINISTRO ELÉCTRICO.

Ante el riesgo de caída de rayos.

En caso de riesgo de ser alcanzado por un rayo, adoptar las siguientes


medidas:
 Desconectar los equipos de comunicaciones del vehículo.
 Desmontar las antenas.
 Cerrar todas las puertas de las escotillas.
No permitir que haya personal sobre o en las proximidades del vehículo; la
tripulación permanecerá en el interior del vehículo.

E. Con respecto al monóxido de carbono.

El monóxido de carbono es un gas incoloro e inodoro, mortalmente


venenoso, que al ser respirado, priva al cuerpo de oxígeno y produce
asfixia. La exposición al aire contaminado por monóxido de carbono
produce síntomas tales como: dolor de cabeza, mareo, pérdida del
dominio de los músculos, aparente somnolencia y coma. Una exposición
prolongada puede producir daños permanentes en el cerebro o la muerte.
Este gas se encuentra en el humo de escape de los motores de
combustión interna o estufas que emplean gasóleo, llegando a ser
peligrosamente venenoso cuando las condiciones de ventilación son

A-5
inadecuadas. Por seguridad de la tripulación, siempre que se ponga en
funcionamiento el motor o la calefacción del vehículo, deben observarse
las siguientes precauciones:

 En recintos cerrados no poner en marcha la calefacción o el motor del


vehículo, a menos que el lugar tenga la adecuada ventilación.
 No mantener el motor en funcionamiento, durante períodos de tiempo
prolongados, sin activar sus ventiladores. Si la situación táctica lo
permite, abrir las escotillas.
 No conducir el vehículo con las tapas de registro quitadas, a no ser que
sea necesario por motivo de mantenimiento.
 Durante el funcionamiento del vehículo estar atentos en todo momento a
la aparición de olores de escape y síntomas de exposición al monóxido
de carbono. Si esto ocurre, ventilar inmediatamente la cámara de
personal. Si los síntomas persistieran, evacuar al personal del vehículo,
exponerlos al aire libre y mantenerlos abrigados, impidiendo que realicen
ejercicios físicos y, si fuera necesario, aplicarles la respiración artificial.

F. Con respecto al tiro:

 Se tendrán en cuenta las medidas de seguridad contempladas en las


PMET en vigor sobre el empleo de los carros de combate, así como la
normativa específica de cada Unidad y las contempladas en el presente
Manual.
 Siempre que se acometan operaciones de mantenimiento con el cañón,
éste debe ser considerado como cargado mientras no se compruebe la
ausencia de munición en la recámara o el doble alimentador.
 En caso de arma cargada total o parcialmente el área de peligro a
vanguardia debe estar despejada.
 No introducir manualmente disparos individuales en la recámara.
 Durante tormentas de granizo o fuertes aguaceros detener el fuego con
munición HEI/MP para evitar explosiones prematuras.
 En cuanto a la munición, para su almacenaje y manipulación se
observarán las prevenciones dictadas por el fabricante de la misma y por
los órganos de municionamiento del ET.

G. Con respecto a los lanzaingenios:

 Durante su carga y descarga, nadie deberá ponerse delante de los tubos


lanzadores.
 No colocar ninguna parte del cuerpo delante de los tubos lanzaingenios,
al cargar los botes de humo o las granadas fragmentarias.

A-6
 Durante la realización de ejercicios o maniobras, se cargarán los tubos
en la zona de ejercicios y poco antes del inicio de los mismos.
 Durante la carga y descarga de los tubos lanzaingenios deberá
colocarse el interruptor de la caja de control en OFF y el conmutador en
0.
 Antes de introducir la granada comprobar que el tubo está limpio y que
los contactos eléctricos sobresalen.
 Cuando se vaya a efectuar el disparo de los lanzaingenios, no deberá
haber ninguna persona a menos de 100 m del vehículo en un sector
comprendido entre las 10,00 y las 02,00 de la torre.
 Existe riesgo de incendio si se utilizan los artificios fumígenos en
terrenos con arbustos combustibles.
 Antes del tiro con los lanzaingenios, comprobar la posición de los vientos
de las antenas por si interfieren en la trayectoria de lanzamiento. En
caso de duda, dejar sueltas las antenas.
 Para hacer FUEGO con los lanzaingenios es condición indispensable
que la escotilla del Conductor esté correctamente cerrada y bloqueada
(activar el seguro de escotilla).

NOTA
Si la escotilla del conductor no está bloqueada, el seguro de escotilla impide el
disparo de los artificios fumígenos aunque se anula en la Panel de Control
Principal de la torre.

 Cuando se conecte el interruptor de la caja de control, actuar como si


todos los tubos estuvieran cargados.
 En caso de interrupciones, deberá esperarse un tiempo de 10 minutos
antes de adoptar cualquier otra medida.
 Aquellos ingenios rotos o dañados en la parte superior pueden continuar
teniendo operativo uno de los mecanismos iniciadores.
 No tocar los artificios fumígenos que estén generando humos.
 Aquellos ingenios que no hayan funcionado al ser lanzados por el tubo,
ni hayan podido ser activados manualmente, únicamente serán
destruidos por personal especializado.
 Antes de abandonar la zona de tiro deberán vaciarse los tubos
lanzadores.
 Antes de circular por vías públicas, o de atravesar núcleos de población,
se deben haber vaciado los tubos lanzadores.

H. En el transporte:

A-7
 Se tendrán en cuenta las normas generales contenidas en la NG03/01
Servicio Logístico de transportes, así como las específicas para el
transporte para carretera, ferrocarril y vía marítima.
 Para cualquiera de los transportes mencionados se preparará el
vehículo según lo expresado en las Normas Operativas de cada Unidad,
evitando en lo posible que en el exterior de la torre y del casco queden
elementos del lote de a bordo que se puedan soltar de sus sujeciones.
 Asimismo, para el transporte por ferrocarril se tendrán en cuenta las
observaciones específicas para el VCI/C Pizarro contenidas en el
apartado 7.6 de este Manual (Tomo I).

I. Normas de seguridad del sistema de extinción y


antiexplosión.

Generales.

El funcionamiento del sistema se basa en una rápida descarga del agente


extintor en la cámara de personal del vehículo de combate.

Para evitar posibles accidentes y daños a la tripulación, deben observarse las


normas siguientes:
 No fumar ni encender cerillas en la cámara de personal.
 Comprobar la correcta sujeción de los cilindros extintores.
 Colocar el interruptor INT. PRIN. BATERIAS en la posición 0
(desconectado) y esperar al menos 40 minutos, siempre que:
o Se realicen soldaduras en el interior de la cámara de personal,
debiendo proteger convenientemente todos los componentes del
sistema.
o Durante las operaciones de mantenimiento del sistema que
incluyan revisión o sustitución de componentes.
 No desconectar ningún cilindro extintor sin autorización del 2º Escalón.

Cilindros extintores.

Durante las operaciones de mantenimiento de los cilindros extintores o


próximas a ellos, el interruptor INT. PRIN. BATERIAS debe permanecer en la
posición 0 (desconectado) y tener siempre presente:
 No introducir los dedos en ningún caso o acercar la vista a los
deflectores de dispersión.
 No dejar equipo o herramientas cerca de los deflectores.

Detectores ópticos.

No acercar a los detectores ninguna fuente de alta radiación.

A-8
Caja de control.

Colocar el selector de funcionamiento en la posición de COMBATE, en


combate y ejercicios de tiro.

Interruptor de emergencia.

Activar manualmente el sistema, solo por motivos de extinción.

Conducta a seguir después de una activación.

El agente extintor HALON 1301 usado en el sistema no es tóxico y no


constituye peligro para la tripulación, ya que la máxima concentración oscilará
entre un 6 y un 7%, que no resulta nocivo en absoluto para la tripulación.
Debe activarse el sistema de ventilación y NBQ de la cámara de la tripulación,
pasados 5 segundos desde la liberación del agente extintor y abrir las escotillas
momentáneamente, si la situación lo permite, para que la evacuación de gases
sea más efectiva.
Como regla general, no es necesaria la evacuación del vehículo después de la
activación del sistema. Sin embargo, si como resultado de la activación del
sistema, aparecen en la tripulación síntomas como fuerte irritación en los ojos y
del aparato respiratorio o mareos, debe abandonarse el vehículo, siempre que
la situación lo permita, hasta que los gases hayan desaparecido.

J. Normas de seguridad del sistema de A/A.

El circuito de aire acondicionado contiene refrigerante R1344a que es un gas


tóxico incoloro e inodoro. Aunque su nivel de toxicidad es bajo, puede resultar
potencialmente sofocante en espacios cerrados.
El circuito está cargado a alta presión. Bajo ningún concepto debe intentarse
desconectar elementos o manipularlos, sin descargar de gas previamente el
sistema.
Evitar el contacto con el gas. Los escapes de gas pueden causar quemaduras
por congelación en la piel.
El condensador puede llegar a calentarse durante y después del
funcionamiento del sistema.

A-9